FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37290

FusionGeneSummary for TAX1BP1_BRAF

check button Fusion gene summary
Fusion gene informationFusion gene name: TAX1BP1_BRAF
Fusion gene ID: 37290
HgeneTgene
Gene symbol

TAX1BP1

BRAF

Gene ID

8887

673

Gene nameTax1 binding protein 1B-Raf proto-oncogene, serine/threonine kinase
SynonymsCALCOCO3|T6BP|TXBP151B-RAF1|B-raf|BRAF1|NS7|RAFB1
Cytomap

7p15.2

7q34

Type of geneprotein-codingprotein-coding
Descriptiontax1-binding protein 1TRAF6-binding proteinTax1 (human T-cell leukemia virus type I) binding protein 1serine/threonine-protein kinase B-raf94 kDa B-raf proteinB-Raf proto-oncogene serine/threonine-protein kinase (p94)B-Raf serine/threonine-proteinmurine sarcoma viral (v-raf) oncogene homolog B1proto-oncogene B-Rafv-raf murine sarcoma viral oncogene
Modification date2018052220180527
UniProtAcc

Q86VP1

P15056

Ensembl transtripts involved in fusion geneENST00000543117, ENST00000265393, 
ENST00000409980, ENST00000433216, 
ENST00000396319, ENST00000494033, 
ENST00000288602, 
Fusion gene scores* DoF score9 X 6 X 7=37824 X 11 X 10=2640
# samples 835
** MAII scorelog2(8/378*10)=-2.24031432933371
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(35/2640*10)=-2.91511110241349
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TAX1BP1 [Title/Abstract] AND BRAF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneBRAF

GO:0006468

protein phosphorylation

17563371

TgeneBRAF

GO:0010828

positive regulation of glucose transmembrane transport

23010278

TgeneBRAF

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

TgeneBRAF

GO:0043066

negative regulation of apoptotic process

19667065

TgeneBRAF

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22065586

TgeneBRAF

GO:0071277

cellular response to calcium ion

18567582

TgeneBRAF

GO:0090150

establishment of protein localization to membrane

23010278


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-D3-A2JC-06ATAX1BP1chr7

27827222

+BRAFchr7

140481493

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000543117ENST00000288602TAX1BP1chr7

27827222

+BRAFchr7

140481493

-
In-frameENST00000265393ENST00000288602TAX1BP1chr7

27827222

+BRAFchr7

140481493

-
In-frameENST00000409980ENST00000288602TAX1BP1chr7

27827222

+BRAFchr7

140481493

-
In-frameENST00000433216ENST00000288602TAX1BP1chr7

27827222

+BRAFchr7

140481493

-
In-frameENST00000396319ENST00000288602TAX1BP1chr7

27827222

+BRAFchr7

140481493

-
intron-3CDSENST00000494033ENST00000288602TAX1BP1chr7

27827222

+BRAFchr7

140481493

-

Top

FusionProtFeatures for TAX1BP1_BRAF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAX1BP1

Q86VP1

BRAF

P15056


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-918457_717438767DomainProtein kinase
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-918463_471438767Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000265393+817144_599346748Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000396319+817144_599346790Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000433216+716144_599189591Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000543117+817144_599346748Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000265393+817320_420346748RegionNote=Oligomerization
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000396319+817320_420346790RegionNote=Oligomerization
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000433216+716320_420189591RegionNote=Oligomerization
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000543117+817320_420346748RegionNote=Oligomerization
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000265393+817725_754346748Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000265393+817755_789346748Zinc fingerNote=UBZ-type 2
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000396319+817725_754346790Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000396319+817755_789346790Zinc fingerNote=UBZ-type 2
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000433216+716725_754189591Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000433216+716755_789189591Zinc fingerNote=UBZ-type 2
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000543117+817725_754346748Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27827222chr7:140481493ENST00000543117+817755_789346748Zinc fingerNote=UBZ-type 2
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-918122_129438767Compositional biasNote=Poly-Ser
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-918428_432438767Compositional biasNote=Poly-Ser
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-9186_11438767Compositional biasNote=Poly-Gly
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-918155_227438767DomainRBD
TgeneBRAFchr7:27827222chr7:140481493ENST00000288602-918234_280438767Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for TAX1BP1_BRAF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAX1BP1_ENST00000543117_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_675aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPTIHPHPKDWVGIFKVGWSTARDTYTFLWSPMPEHTVEGSTVNCVLAFQGT
YLPNDDGEFTQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLE
CQLKTEKDEKELTKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKKTLGRRDSSDDWEI
PDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEGSSLTHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP

>In-frame_TAX1BP1_ENST00000265393_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_675aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPTIHPHPKDWVGIFKVGWSTARDTYTFLWSPMPEHTVEGSTVNCVLAFQGT
YLPNDDGEFTQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLE
CQLKTEKDEKELTKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKKTLGRRDSSDDWEI
PDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEGSSLTHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP

>In-frame_TAX1BP1_ENST00000409980_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_675aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPTIHPHPKDWVGIFKVGWSTARDTYTFLWSPMPEHTVEGSTVNCVLAFQGT
YLPNDDGEFTQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLE
CQLKTEKDEKELTKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKKTLGRRDSSDDWEI
PDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEGSSLTHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP

>In-frame_TAX1BP1_ENST00000433216_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_518aa
MKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIE
KETELDSLKDKLKKAQHEREQLECQLKTEKDEKELTKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQR
TFLLTTSSKKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGT
STKPQLAIVTQWCEGSSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQ
FEQLSGSILWMAPEVIRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKK

>In-frame_TAX1BP1_ENST00000396319_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_675aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPTIHPHPKDWVGIFKVGWSTARDTYTFLWSPMPEHTVEGSTVNCVLAFQGT
YLPNDDGEFTQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLE
CQLKTEKDEKELTKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKKTLGRRDSSDDWEI
PDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEGSSLTHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAX1BP1_ENST00000543117_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2025nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACA
CAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCA
GTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAA
TGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAG
GTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCT
GAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATT
CCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTG
AAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAAT
ATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCAT
ATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATC
ATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCT
CGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCA
TACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGG
GACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTA
ATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCA
AAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAA

>In-frame_TAX1BP1_ENST00000265393_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2025nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACA
CAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCA
GTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAA
TGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAG
GTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCT
GAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATT
CCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTG
AAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAAT
ATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCAT
ATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATC
ATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCT
CGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCA
TACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGG
GACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTA
ATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCA
AAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAA

>In-frame_TAX1BP1_ENST00000409980_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2025nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACA
CAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCA
GTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAA
TGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAG
GTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCT
GAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATT
CCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTG
AAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAAT
ATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCAT
ATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATC
ATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCT
CGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCA
TACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGG
GACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTA
ATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCA
AAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAA

>In-frame_TAX1BP1_ENST00000433216_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_1554nt
ATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGA
GAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACACAAAGCTTAAAAATGGAAAAT
GAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCAGTAACACATAAAGCAATTGAA
AAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAATGTCAGTTGAAGACAGAGAAG
GATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAGGTCCAGACTTTAAAAAATTTA
GATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCTGAAAAGGAAAATCTGCAAAGA
ACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTG
GGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCA
CCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTAT
TCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAG
ATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGT
AATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAG
TTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTA
TATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTG
GGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAG
AAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCA
GAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGA

>In-frame_TAX1BP1_ENST00000396319_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2025nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACA
CAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCA
GTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAA
TGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAG
GTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCT
GAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATT
CCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTG
AAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAAT
ATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCAT
ATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATC
ATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCT
CGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCA
TACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGG
GACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTA
ATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCA
AAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAX1BP1_ENST00000543117_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2328nt
ACGGCAACAGAAGACTATGATGAATTCGAATGGGACACATTTGCTTCTGTGGAGTTACGATTCAAACTGAATGTCCAATATAGGAAGGCA
ACATATACAACAAGCAAAAGTGATTTTAGAAATAACAGAACGCGGGAGAAAATTCACACACGGAAAATGATACGGATAACAAAAGCAGAT
TCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTA
ATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTA
CTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAG
GATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCC
AGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCC
TTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTC
GAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAG
TAACACAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTG
TGTCAGTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAAC
TTGAATGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGT
CAGAGGTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTT
TGGCTGAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGG
AGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGG
CAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATG
TGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATC
TCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGT
CAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGA
AATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAA
ATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACA
ACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGA
GATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCAT
TGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTC
CAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAG

>In-frame_TAX1BP1_ENST00000265393_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2325nt
GGAAGAGACCGCCCCGTGGGCGGAAGTGACGCAAGGCCTACTGTCGGCTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGT
GGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCA
CAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATG
CACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTG
CTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGAT
ATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGT
TTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTC
TTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAG
AACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAA
CACAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGT
CAGTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTG
AATGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAG
AGGTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGG
CTGAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGA
TTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAG
TGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGA
ATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCC
ATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAA
TCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAAT
CTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATC
CATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACA
GGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGAT
TAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGC
CAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAA
AAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAA

>In-frame_TAX1BP1_ENST00000409980_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2278nt
CTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTG
CGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCC
CATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACAT
CCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTAT
GTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTT
ACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAA
GGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTA
AAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGA
TGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACACAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGT
GATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCAGTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTA
AAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAATGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTA
CATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAGGTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATT
ACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCTGAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGT
AAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCA
TTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCC
TTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATT
GTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCA
CGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGAC
CTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATT
TTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTAT
GAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGAT
CTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTT
CCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGT
TTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGA
AACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACATATGTTTGCTTATATGTTAAATTGAATAAAATACT

>In-frame_TAX1BP1_ENST00000433216_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2085nt
AGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAA
CTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGT
CATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAA
AGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGA
AGGATCAACAGTCAATTGTGTACTAGCATTCCAAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCG
TTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGC
AAGCAGAACAAAAGGGTCTTACTGAAGTAACACAAAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCA
AAGCCCATCAGCTTGAGGAAGATATTGTGTCAGTAACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCA
AGAAGGCACAACATGAAAGAGAACAACTTGAATGTCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATA
CAGAAATAGAAAATACCAAGCTTATGTCAGAGGTCCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAG
AAGAGATTGGCAGGCTGCAGTTATGTTTGGCTGAAAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTG
GTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCT
ACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAG
TAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGT
GTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCAC
AGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAA
TAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCAC
CAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTG
GACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTAC
GGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCG
CCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGG
ATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGA
GAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACATATGTTTGCTTATATGTTAAATTGAATAAAATACTCTCTTTTTTTTTA

>In-frame_TAX1BP1_ENST00000396319_chr7_27827222_+_BRAF_ENST00000288602_chr7_140481493_-_2231nt
GAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAAT
GACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACA
CCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCG
TGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTA
CCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCG
AGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGA
GTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACA
AGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGGTCTTACTGAAGTAACACA
AAGCTTAAAAATGGAAAATGAAGAGTTTAAGAAGAGGTTCAGTGATGCTACATCCAAAGCCCATCAGCTTGAGGAAGATATTGTGTCAGT
AACACATAAAGCAATTGAAAAAGAAACCGAATTAGACAGTTTAAAGGACAAACTCAAGAAGGCACAACATGAAAGAGAACAACTTGAATG
TCAGTTGAAGACAGAGAAGGATGAAAAGGAACTTTATAAGGTACATTTGAAGAATACAGAAATAGAAAATACCAAGCTTATGTCAGAGGT
CCAGACTTTAAAAAATTTAGATGGGAACAAAGAAAGCGTGATTACTCATTTCAAAGAAGAGATTGGCAGGCTGCAGTTATGTTTGGCTGA
AAAGGAAAATCTGCAAAGAACTTTCCTGCTTACAACCTCAAGTAAAAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCC
TGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAA
AATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATAT
CCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATAT
CATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCAT
CCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCG
ATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATA
CAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGA
CCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAAT
GGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAA
AATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAAC
ACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATA


Top

FusionGenePPI for TAX1BP1_BRAF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAX1BP1TNFAIP3, STARD13, TBC1D17, TRAF6, RNF11, RIPK1, OPTN, TNIP1, IKBKE, TBK1, TRAF3, GABRR1, ITCH, MYO6, CALCOCO2, UBC, VCP, PARK2, ORC5, IKBKG, MAP1LC3B, MAP1LC3C, GABARAP, FOXC2, KIF5B, LGALS8, SSX2, TCEA2, TSG101, FAM189A2, DAZAP2, DSTN, EMILIN1, RAB18, FAM168A, CXXC1, NMRK1, LMO3, RAD18, TSHZ3, MRPL11, TNIP3, PLEKHN1, COG7, MRPL53, CWF19L2, REEP4, FHL5, RNF126, HSD17B3, FAM58A, LDLRAD4, NTRK1, MED4, RAD54L2, HNRNPD, UBE2A, AGO1, GABARAPL1, GABARAPL2, RFWD2, RABGEF1, SLC22A23, KDELR1, RNF115, DNAJC11, SLC5A12, RNF26, DLSTBRAFYWHAB, YWHAG, YWHAQ, YWHAZ, SFN, HRAS, AKT1, MAPK3, RAP1GAP, RAF1, MRAS, RAP1A, PAK2, TERF1, CCDC88A, NEDD4L, MAP2K1, RNF149, KSR1, BRAP, PRKCE, RPS6KB2, HSP90AA1, BRAF, YWHAE, HSPA5, MAP2K2, HSPA1A, HSPA8, YWHAH, HSPA9, ARAF, CDC37, HSP90AB1, PHKB, LIMK1, IQGAP1, MAPK1, BAD, LIPF, MUS81, FBXW7, FGFR2, BRCA2, VHL, FNTA, HDAC2, PIK3CA, EGFR, PTEN, FNIP1, FNIP2, RAB3GAP1, KRAS, KIAA0141, FKBPL, ARMCX3, KCNC4, RPTOR, CYLD, NRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAX1BP1_BRAF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneBRAFP15056DB08881VemurafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB08896RegorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB00398SorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational
TgeneBRAFP15056DB08912DabrafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational

Top

RelatedDiseases for TAX1BP1_BRAF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneBRAFC0025202melanoma21CTD_human
TgeneBRAFC1527249Colorectal Cancer8UNIPROT
TgeneBRAFC1275081Cardio-facio-cutaneous syndrome6CTD_human;ORPHANET;UNIPROT
TgeneBRAFC0009404Colorectal Neoplasms4CTD_human
TgeneBRAFC0040136Thyroid Neoplasm4CTD_human
TgeneBRAFC0024305Lymphoma, Non-Hodgkin3UNIPROT
TgeneBRAFC0684249Carcinoma of lung3UNIPROT
TgeneBRAFC3150970NOONAN SYNDROME 73CTD_human;UNIPROT
TgeneBRAFC0152013Adenocarcinoma of lung (disorder)2CTD_human
TgeneBRAFC0002448Ameloblastoma1CTD_human
TgeneBRAFC0004114Astrocytoma1CTD_human
TgeneBRAFC0010276Craniopharyngioma1CTD_human;ORPHANET
TgeneBRAFC0017638Glioma1CTD_human
TgeneBRAFC0022665Kidney Neoplasm1CTD_human
TgeneBRAFC0023903Liver neoplasms1CTD_human
TgeneBRAFC0024694Mandibular Neoplasms1CTD_human
TgeneBRAFC0028326Noonan Syndrome1CTD_human;ORPHANET
TgeneBRAFC0033578Prostatic Neoplasms1CTD_human
TgeneBRAFC0036920Sezary Syndrome1CTD_human
TgeneBRAFC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
TgeneBRAFC0206686Adrenocortical carcinoma1CTD_human
TgeneBRAFC0206754Neuroendocrine Tumors1CTD_human
TgeneBRAFC0238463Papillary thyroid carcinoma1CTD_human;ORPHANET
TgeneBRAFC0587248Costello syndrome (disorder)1CTD_human
TgeneBRAFC0596263Carcinogenesis1CTD_human
TgeneBRAFC0920269Microsatellite Instability1CTD_human
TgeneBRAFC2239176Liver carcinoma1CTD_human