FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37240

FusionGeneSummary for TAOK3_VSIG10

check button Fusion gene summary
Fusion gene informationFusion gene name: TAOK3_VSIG10
Fusion gene ID: 37240
HgeneTgene
Gene symbol

TAOK3

VSIG10

Gene ID

51347

54621

Gene nameTAO kinase 3V-set and immunoglobulin domain containing 10
SynonymsDPK|JIK|MAP3K18|hKFC-A-
Cytomap

12q24.23

12q24.23

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase TAO3CTCL-associated antigen HD-CL-09JNK/SAPK-inhibitory kinaseSTE20-like kinasecutaneous T-cell lymphoma-associated antigen HD-CL-09dendritic cell-derived protein kinasejun kinase-inhibitory kinasekinase from chickenV-set and immunoglobulin domain-containing protein 10
Modification date2018052320180519
UniProtAcc

Q9H2K8

Q8N0Z9

Ensembl transtripts involved in fusion geneENST00000419821, ENST00000392533, 
ENST00000537952, ENST00000543709, 
ENST00000536979, 
ENST00000359236, 
ENST00000536905, 
Fusion gene scores* DoF score7 X 5 X 6=2103 X 4 X 3=36
# samples 84
** MAII scorelog2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TAOK3 [Title/Abstract] AND VSIG10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTAOK3

GO:0006468

protein phosphorylation

10559204

HgeneTAOK3

GO:0006974

cellular response to DNA damage stimulus

17396146

HgeneTAOK3

GO:0046329

negative regulation of JNK cascade

10559204

HgeneTAOK3

GO:0046777

protein autophosphorylation

10559204


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-LC-A66R-01ATAOK3chr12

118636856

-VSIG10chr12

118504499

-
TCGALDLUSCTCGA-60-2724-01ATAOK3chr12

118810453

-VSIG10chr12

118520234

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000419821ENST00000359236TAOK3chr12

118636856

-VSIG10chr12

118504499

-
5CDS-intronENST00000419821ENST00000536905TAOK3chr12

118636856

-VSIG10chr12

118504499

-
Frame-shiftENST00000392533ENST00000359236TAOK3chr12

118636856

-VSIG10chr12

118504499

-
5CDS-intronENST00000392533ENST00000536905TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-3CDSENST00000537952ENST00000359236TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-intronENST00000537952ENST00000536905TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-3CDSENST00000543709ENST00000359236TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-intronENST00000543709ENST00000536905TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-3CDSENST00000536979ENST00000359236TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-intronENST00000536979ENST00000536905TAOK3chr12

118636856

-VSIG10chr12

118504499

-
intron-3CDSENST00000419821ENST00000359236TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-5UTRENST00000419821ENST00000536905TAOK3chr12

118810453

-VSIG10chr12

118520234

-
5UTR-3CDSENST00000392533ENST00000359236TAOK3chr12

118810453

-VSIG10chr12

118520234

-
5UTR-5UTRENST00000392533ENST00000536905TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-3CDSENST00000537952ENST00000359236TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-5UTRENST00000537952ENST00000536905TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-3CDSENST00000543709ENST00000359236TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-5UTRENST00000543709ENST00000536905TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-3CDSENST00000536979ENST00000359236TAOK3chr12

118810453

-VSIG10chr12

118520234

-
intron-5UTRENST00000536979ENST00000536905TAOK3chr12

118810453

-VSIG10chr12

118520234

-

Top

FusionProtFeatures for TAOK3_VSIG10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAOK3

Q9H2K8

VSIG10

Q8N0Z9

Serine/threonine-protein kinase that acts as a regulatorof the p38/MAPK14 stress-activated MAPK cascade and of theMAPK8/JNK cascade. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, involved in theG2/M transition DNA damage checkpoint by activating the p38/MAPK14stress-activated MAPK cascade, probably by mediatingphosphorylation of upstream MAP2K3 and MAP2K6 kinases. Inhibitsbasal activity of MAPK8/JNK cascade and diminishes its activationin response epidermal growth factor (EGF).{ECO:0000269|PubMed:10559204, ECO:0000269|PubMed:10924369,ECO:0000269|PubMed:17396146}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAOK3chr12:118636856chr12:118504499ENST00000392533-1321343_393398899Compositional biasNote=Ser-rich
HgeneTAOK3chr12:118636856chr12:118504499ENST00000419821-1321343_393398899Compositional biasNote=Ser-rich
HgeneTAOK3chr12:118636856chr12:118504499ENST00000392533-132124_277398899DomainProtein kinase
HgeneTAOK3chr12:118636856chr12:118504499ENST00000419821-132124_277398899DomainProtein kinase
HgeneTAOK3chr12:118636856chr12:118504499ENST00000392533-132130_38398899Nucleotide bindingATP
HgeneTAOK3chr12:118636856chr12:118504499ENST00000419821-132130_38398899Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAOK3chr12:118636856chr12:118504499ENST00000392533-1321452_502398899Coiled coilOntology_term=ECO:0000255
HgeneTAOK3chr12:118636856chr12:118504499ENST00000392533-1321548_649398899Coiled coilOntology_term=ECO:0000255
HgeneTAOK3chr12:118636856chr12:118504499ENST00000392533-1321754_879398899Coiled coilOntology_term=ECO:0000255
HgeneTAOK3chr12:118636856chr12:118504499ENST00000419821-1321452_502398899Coiled coilOntology_term=ECO:0000255
HgeneTAOK3chr12:118636856chr12:118504499ENST00000419821-1321548_649398899Coiled coilOntology_term=ECO:0000255
HgeneTAOK3chr12:118636856chr12:118504499ENST00000419821-1321754_879398899Coiled coilOntology_term=ECO:0000255
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79421_426522541Compositional biasNote=Poly-Leu
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79463_493522541Compositional biasNote=Glu-rich
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79123_215522541DomainNote=Ig-like C2-type 2
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79223_309522541DomainNote=Ig-like C2-type 3
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79311_404522541DomainNote=Ig-like C2-type 4
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-7931_119522541DomainNote=Ig-like C2-type 1
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-7931_413522541Topological domainExtracellular
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79435_540522541Topological domainCytoplasmic
TgeneVSIG10chr12:118636856chr12:118504499ENST00000359236-79414_434522541TransmembraneHelical


Top

FusionGeneSequence for TAOK3_VSIG10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAOK3_ENST00000419821_chr12_118636856_-_VSIG10_ENST00000359236_chr12_118504499_-_416aa
MRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGKQTHEKWQDILKEVKFLRQLKHPNTIEYKGC
YLKEHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVG
TPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPTLQSNEWTDSFRRFVDYCLQKIPQERPTSAE
LLRHDFVRRDRPLRVLIDLIQRTKDAVRELDNLQYRKMKKILFQETRNGPLNESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAOK3_ENST00000419821_chr12_118636856_-_VSIG10_ENST00000359236_chr12_118504499_-_1250nt
ATGCGTAAAGGGGTGCTGAAGGACCCAGAGATTGCCGATCTATTCTACAAAGATGATCCTGAGGAACTTTTTATTGGTTTGCATGAAATT
GGACATGGAAGTTTTGGAGCAGTTTATTTTGCTACAAATGCTCACACCAGTGAGGTGGTGGCAATTAAGAAGATGTCCTATAGTGGGAAG
CAGACCCATGAGAAATGGCAAGATATTCTTAAGGAAGTTAAATTTTTACGACAATTGAAGCATCCTAATACTATTGAGTACAAAGGCTGT
TACTTGAAAGAACACACTGCTTGGTTGGTGATGGAATATTGCTTAGGCTCAGCCTCTGATTTATTAGAAGTTCATAAAAAACCACTTCAG
GAAGTGGAGATCGCTGCCATTACTCATGGAGCCTTGCATGGACTAGCCTACCTACATTCTCATGCATTGATTCATAGGGATATTAAAGCA
GGAAATATTCTTCTAACAGAGCCAGGTCAGGTAAAACTAGCTGATTTTGGATCTGCTTCAATGGCTTCTCCTGCCAACTCCTTCGTGGGC
ACACCTTACTGGATGGCTCCAGAGGTGATCTTAGCTATGGATGAAGGACAGTATGATGGGAAAGTTGATATTTGGTCACTTGGCATCACT
TGTATTGAATTGGCGGAACGGAAGCCGCCCCTTTTCAACATGAATGCAATGAGTGCCTTATATCACATTGCCCAGAATGACTCCCCAACG
TTACAGTCTAATGAATGGACAGACTCCTTTAGGAGATTTGTTGATTACTGCTTGCAGAAAATACCTCAGGAAAGGCCAACATCAGCAGAA
CTATTAAGGCATGACTTTGTTCGACGAGACCGGCCACTACGTGTCCTCATTGACCTCATACAGAGGACAAAAGATGCAGTTCGTGAGCTA
GATAACCTACAGTACCGAAAAATGAAAAAAATACTTTTCCAAGAGACACGGAATGGACCCTTGAATGAGTCACAGGAGGATGAGGAAGAC
AGTGAACATGGAACCAGCCTGAACAGGGAAATGGACAGCCTGGGCAGCAACCATTCCATTCCAAGCATGTCCGTGAGCACAGGCAGCCAG
AGCAGCAGTGTGAACAGCATGCAGGAAGTCATGGACGAGAGCAGTTCCGAACTTGTCATGATGCACGATGACGAAAGCACAATCAATTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAOK3_ENST00000419821_chr12_118636856_-_VSIG10_ENST00000359236_chr12_118504499_-_4704nt
GTTGTAACAGGAAATACTTCAGCTTGCAATACTGATAGTAATGTGTGGCACCCAGATCACGCTGTTTTTATCTGCAGTTCCTTTTTAGTA
TTGTACAAAGTTTCTTGAAGATTTTTAAATACATAAGTTTAAAAGAGAATTAACTTTCAATTTGCAAATTAAAATGAGAATGGTTGCCTT
TTCTTCATTATCAAGAGATGGTGAGTTGTCCTCCTGTTGCATCATAAATACAAAGGACTGAAGTTATAAAAGAGAAAAGAGAAGTTTGCT
GCTAAAATGAATCTGAGCAATATGGAATATTTTGTGCCACACACAAAAAGGTACTGAAGATTTACCCCCCAAAAAAAATTGTCAATGAGA
AATAAAGCTAACTGATATCAAAAAGCAGAGCCTGCTCTACTGGCCATCATGCGTAAAGGGGTGCTGAAGGACCCAGAGATTGCCGATCTA
TTCTACAAAGATGATCCTGAGGAACTTTTTATTGGTTTGCATGAAATTGGACATGGAAGTTTTGGAGCAGTTTATTTTGCTACAAATGCT
CACACCAGTGAGGTGGTGGCAATTAAGAAGATGTCCTATAGTGGGAAGCAGACCCATGAGAAATGGCAAGATATTCTTAAGGAAGTTAAA
TTTTTACGACAATTGAAGCATCCTAATACTATTGAGTACAAAGGCTGTTACTTGAAAGAACACACTGCTTGGTTGGTGATGGAATATTGC
TTAGGCTCAGCCTCTGATTTATTAGAAGTTCATAAAAAACCACTTCAGGAAGTGGAGATCGCTGCCATTACTCATGGAGCCTTGCATGGA
CTAGCCTACCTACATTCTCATGCATTGATTCATAGGGATATTAAAGCAGGAAATATTCTTCTAACAGAGCCAGGTCAGGTAAAACTAGCT
GATTTTGGATCTGCTTCAATGGCTTCTCCTGCCAACTCCTTCGTGGGCACACCTTACTGGATGGCTCCAGAGGTGATCTTAGCTATGGAT
GAAGGACAGTATGATGGGAAAGTTGATATTTGGTCACTTGGCATCACTTGTATTGAATTGGCGGAACGGAAGCCGCCCCTTTTCAACATG
AATGCAATGAGTGCCTTATATCACATTGCCCAGAATGACTCCCCAACGTTACAGTCTAATGAATGGACAGACTCCTTTAGGAGATTTGTT
GATTACTGCTTGCAGAAAATACCTCAGGAAAGGCCAACATCAGCAGAACTATTAAGGCATGACTTTGTTCGACGAGACCGGCCACTACGT
GTCCTCATTGACCTCATACAGAGGACAAAAGATGCAGTTCGTGAGCTAGATAACCTACAGTACCGAAAAATGAAAAAAATACTTTTCCAA
GAGACACGGAATGGACCCTTGAATGAGTCACAGGAGGATGAGGAAGACAGTGAACATGGAACCAGCCTGAACAGGGAAATGGACAGCCTG
GGCAGCAACCATTCCATTCCAAGCATGTCCGTGAGCACAGGCAGCCAGAGCAGCAGTGTGAACAGCATGCAGGAAGTCATGGACGAGAGC
AGTTCCGAACTTGTCATGATGCACGATGACGAAAGCACAATCAATTCCAGCTCCTCCGTCGTGCATAAGAAAATGACAGCAGTGAGGAGC
AAAGTGACATTGTTCAAGAAGAAGACAGGCCAGTCTGAAGAAGAGGATGGTCCATGGTTGTCTTGCTCTGAAAGCTTGGAGAGCTACATT
GAAGACGAGCTCTTCATTCAGCTTTGACTCCACCTGCACCCCTGGCGGGGGCTTGCACTAACAATGTTTGGGTCTCAGCAAAAAACAAAA
CCAAGCACACACATCTTTCCTTCCATGTATTGAAAAACATTGGTTTGATTTGCTCTAAGTTTTCCCAATGATGTTTAAAAGCTTTGAGAA
GGAAAGCTGCTTTGGTGTCTGAGGTGCCACTTCTGCTGTGAATCCTGGCTTTATCCAGGTTGATCTACTGTGATAGATGCTGATTTAGAG
GGAACAGAGGTCAGGGAAGCACTGGGTCTTGGTGCCTTTTGCCGCTTTTTTTTTTTTTTTTTTTTTTTTTTGAGACGGAGTCTCCCTCTA
TTGCCCAGGCTGGAGTGCAATGGCACGATCTTGGCTCACCACAACTTCTGCCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCACGGCA
CCTTGCAAATATCAGCTCCTTGGAACAGGTGAAGTTCCAGGTACCAATGCCAATCAGAGGAAGGCAGTTTGGTTCAGGCTTTGGAGTTAG
AAACACCTGAAGTTGAATCTGGGCTCTGTTGCTTCCTTCTTTCATGGGCTAGAGCACGACTCTTTACCTCTCTCTTGGCCTCAATTTCCT
CACCTGTAAAATAGATGAGGAAGCTGCTCACTTATTATTGTCTCGTTCTGAAAGCTTGGAAAGCTACATCGAAGATGAGCTCTTCATTCA
GCTTTGATTTGACCTGTACCCCTGGTGGGGGATTGCACTGGCAACATTTGGGTCTCAGCAAAAAAACCAAGCACACACATCTTTCCTTCC
ATTTATTGAAAAACATCTTTGTAAGATCCATTCATTGAAAAACATAATCCATTTATTGAAAAATATCTTTGTAAGATCACCTGCTAAATA
TGAAAATCTGACTTGAATTTGTACTCTTTAAAGTTGCGTATCTGCTCTAGTGGGCAGGACCTAGGGCTTAAAGGGGAACTTCCTTTCTCC
ATTTCTAAGAACTGGGACTCTAAAATGAGAAGCTGGTTGTCTGAAGTAACCCTGCAGGTGTGGTTGGGGAAGGTCTGTTTTCTTGGATGA
AGGAACTAAACTAAGCATATCAGAGCACTGTCTTAACCAGTTTTATTTCCCTGGAGATAGAATTCTTTTAAAAAGAGTTAGGGAGCTGGT
AATAGGAAGTGCCTTTCATTATAACTACATTTTGCAGAGCTTCATATTTATATACAAGCCTCCTAGGTGATACACTGTTAGCTTGCAGAC
TTTCCTATGCTTCATTTCTCCTGTTGCTTTCAAAGAAGGCAGGAGACACGTTTAATAACGGAGTATCTGGTGATAAGAATTGCTTGGGCA
AACCAGCTCATCTGGACTCTTTCTCAGTCTTGGAAGTGGGAAGAGGAAAACTTGTTTCCTTCCTGCTTCTTAAGGATATTCTGAGGGTAC
ACTGATCAATAACACTAAATTTGGAATGAAAATACCATGTGATGAGTTTAGCCTGCTGATGCTTCCAGTAGATCCTTGTATAGTTTCAAG
ATTTAAGTTTTCCGATTTCATATAAATTTCTTAAAGTCGAGGACCTTATAAGGGTGCAATGGATGTTTGCTAAATATGAAAAACTGACTT
GAATTTGCACTCTTTAATGTTGCGTATCTGCTCTAGTGGGCAGGACCTAGGGCTTAAAGGGGAACTTCCTTTCTCCAATTCTAGGAACTG
GGACTCTAAAATGAGAAGCTGGTTGTCTGAAGTAACCCTGCAGGTGTGGTTGGGGAAGGTCTGTTTTCTTGGATGAAGGGATTAAACTGA
GCAAATCACTAGAAGTATGCCCTGTCCCCTGCTCAGAACACTGGGGAGCTCAAGAGTGGGCTGCAATGTGCACCCCTCAGGAATAGCTGT
GAATTGCAGGTCTACTGGCTTTTTGCTTTTTGTCTTTTGCTGCAAGGTACCCCACGTACTTAACCATTCTCAACAGTGTAAATCAGTGTC
ATTTTAGAATGAGATACTCAGCTTGCTTCTAAAGTCACTGAATTACTGAGTGAGTCTCTCCTTTAGAGTCTTCGGCAACCAAATTCCAGA
ATTGAAGAGTCTACTACTCAGAGGCAACAAGATTAAAAAAAGAAAACACAAAAACTGTTGAGGTGAAAAAAAAAAAAAACCCTAGCTAGG
AACACAGAGAATGTTTTGTAGGATCACTGGGATATTTTCCACAACTTCCTCTTCTCTAGCACACACATCTGTTGATAGGAAATATTTGAG
GGTTTTTCCACTACCAAATGGGAGCTTCATGGTCCTGGTGTCAAACACTATAAACCTTTGACCAGCTGAGCTGTGACTGCTGTCACATAT
CTGAGTCCTGTGTGCACAGTAATATCCTGGGTCAGGTAAAATCCAGGTCTTCAAGTTTTAAGGATTTTTTGAAGAATTCGGGCTTCTTTA
AGACGATCCATGCCCAAATCCACAAGCTTGTTGACAGTGGATTACAGTTTGTGTGGCAAAGTCCAAGTTGTTACACTGTGCTTTAAAAAA
AATCTTATCTGCATGTATTGTTAACTTAGAGACCATGAGATCTATTTATCAGGACCAGGAAGATACACACTTCAGGTCCATTGCAACTGA
CTTTTTTCTTGTTTTTCTCAAACCCTGGTGGAGCCTGGGAAGGGGGCCTCCACAATTCTGTGGCTTTGATATTAGCCCCAATTCTCACAA
GCACATACAAGCCCCATAATTGCCGCAGGAAAACACAAGATGGAAAATTGCAATAACCCATGCACTGAGACTTAGAAAATCATCCTTACT
AGGCAAAATGTATTATGATGCAATAAGTGCCAACTGATATTTCTCACGTTGGGACTGGCCAGGAACTGCTGCAAAGAAAAATAAGCAGCT
CCTTCTCCATTATTTACATTTTAAGATGTGGTGGGGGGAGGTTGGGAGAAATTAGTTCTGAGGTTATCATATGCCTTTTTTAAAAGATAA


Top

FusionGenePPI for TAOK3_VSIG10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAOK3TRAF2, ERN1, ATM, LRRK2, HSP90AA1, ATF7, CTR9, SMURF1, TRIM25VSIG10ELAVL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAOK3_VSIG10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TAOK3_VSIG10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource