FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37230

FusionGeneSummary for TAOK1_VMP1

check button Fusion gene summary
Fusion gene informationFusion gene name: TAOK1_VMP1
Fusion gene ID: 37230
HgeneTgene
Gene symbol

TAOK1

VMP1

Gene ID

57551

81671

Gene nameTAO kinase 1vacuole membrane protein 1
SynonymsKFC-B|MAP3K16|MARKK|PSK-2|PSK2|TAO1|hKFC-B|hTAOK1EPG3|TANGO5|TMEM49
Cytomap

17q11.2

17q23.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase TAO1MARK KinaseSTE20-like kinase PSK2kinase from chicken homolog Bmicrotubule affinity regulating kinase kinaseprostate-derived STE20-like kinase 2prostate-derived sterile 20-like kinase 2serine/threonine protein kinvacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homolog
Modification date2018052320180523
UniProtAcc

Q7L7X3

Q96GC9

Ensembl transtripts involved in fusion geneENST00000261716, ENST00000536202, 
ENST00000262291, ENST00000537567, 
ENST00000539763, ENST00000536180, 
ENST00000545362, ENST00000588617, 
Fusion gene scores* DoF score27 X 13 X 16=561624 X 11 X 12=3168
# samples 2827
** MAII scorelog2(28/5616*10)=-4.32604420335959
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/3168*10)=-3.55254102302878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TAOK1 [Title/Abstract] AND VMP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTAOK1

GO:0006974

cellular response to DNA damage stimulus

17396146

HgeneTAOK1

GO:0046330

positive regulation of JNK cascade

16407310

HgeneTAOK1

GO:0097194

execution phase of apoptosis

16407310


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-AZ-4323-01ATAOK1chr17

27844674

+VMP1chr17

57842332

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261716ENST00000262291TAOK1chr17

27844674

+VMP1chr17

57842332

+
In-frameENST00000261716ENST00000537567TAOK1chr17

27844674

+VMP1chr17

57842332

+
5CDS-5UTRENST00000261716ENST00000539763TAOK1chr17

27844674

+VMP1chr17

57842332

+
5CDS-5UTRENST00000261716ENST00000536180TAOK1chr17

27844674

+VMP1chr17

57842332

+
5CDS-intronENST00000261716ENST00000545362TAOK1chr17

27844674

+VMP1chr17

57842332

+
5CDS-intronENST00000261716ENST00000588617TAOK1chr17

27844674

+VMP1chr17

57842332

+
intron-3CDSENST00000536202ENST00000262291TAOK1chr17

27844674

+VMP1chr17

57842332

+
intron-3CDSENST00000536202ENST00000537567TAOK1chr17

27844674

+VMP1chr17

57842332

+
intron-5UTRENST00000536202ENST00000539763TAOK1chr17

27844674

+VMP1chr17

57842332

+
intron-5UTRENST00000536202ENST00000536180TAOK1chr17

27844674

+VMP1chr17

57842332

+
intron-intronENST00000536202ENST00000545362TAOK1chr17

27844674

+VMP1chr17

57842332

+
intron-intronENST00000536202ENST00000588617TAOK1chr17

27844674

+VMP1chr17

57842332

+

Top

FusionProtFeatures for TAOK1_VMP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAOK1

Q7L7X3

VMP1

Q96GC9

Serine/threonine-protein kinase involved in variousprocesses such as p38/MAPK14 stress-activated MAPK cascade, DNAdamage response and regulation of cytoskeleton stability.Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator ofthe p38/MAPK14 stress-activated MAPK cascade by mediatingphosphorylation and subsequent activation of the upstream MAP2K3and MAP2K6 kinases. Involved in G-protein coupled receptorsignaling to p38/MAPK14. In response to DNA damage, involved inthe G2/M transition DNA damage checkpoint by activating thep38/MAPK14 stress-activated MAPK cascade, probably by mediatingphosphorylation of MAP2K3 and MAP2K6. Acts as a regulator ofcytoskeleton stability by phosphorylating 'Thr-208' of MARK2,leading to activate MARK2 kinase activity and subsequentphosphorylation and detachment of MAPT/TAU from microtubules. Alsoacts as a regulator of apoptosis: regulates apoptoticmorphological changes, including cell contraction, membraneblebbing and apoptotic bodies formation via activation of theMAPK8/JNK cascade. {ECO:0000269|PubMed:12665513,ECO:0000269|PubMed:13679851, ECO:0000269|PubMed:16407310,ECO:0000269|PubMed:17396146, ECO:0000269|PubMed:17900936}. Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAOK1chr17:27844674chr17:57842332ENST00000261716+1620330_3346361002Compositional biasNote=Poly-Glu
HgeneTAOK1chr17:27844674chr17:57842332ENST00000261716+1620347_3796361002Compositional biasNote=Ser-rich
HgeneTAOK1chr17:27844674chr17:57842332ENST00000261716+162028_2816361002DomainProtein kinase
HgeneTAOK1chr17:27844674chr17:57842332ENST00000261716+162034_426361002Nucleotide bindingATP
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412272_273138407Topological domainCytoplasmic
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412295_305138407Topological domainExtracellular
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412327_363138407Topological domainCytoplasmic
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412385_406138407Topological domainExtracellular
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412251_271138407TransmembraneHelical
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412274_294138407TransmembraneHelical
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412306_326138407TransmembraneHelical
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412364_384138407TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAOK1chr17:27844674chr17:57842332ENST00000261716+1620458_6516361002Coiled coilOntology_term=ECO:0000255
HgeneTAOK1chr17:27844674chr17:57842332ENST00000261716+1620754_8776361002Coiled coilOntology_term=ECO:0000255
HgeneTAOK1chr17:27844674chr17:57842332ENST00000536202+118458_651-63854Coiled coilOntology_term=ECO:0000255
HgeneTAOK1chr17:27844674chr17:57842332ENST00000536202+118754_877-63854Coiled coilOntology_term=ECO:0000255
HgeneTAOK1chr17:27844674chr17:57842332ENST00000536202+118330_334-63854Compositional biasNote=Poly-Glu
HgeneTAOK1chr17:27844674chr17:57842332ENST00000536202+118347_379-63854Compositional biasNote=Ser-rich
HgeneTAOK1chr17:27844674chr17:57842332ENST00000536202+11828_281-63854DomainProtein kinase
HgeneTAOK1chr17:27844674chr17:57842332ENST00000536202+11834_42-63854Nucleotide bindingATP
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412131_250138407Topological domainExtracellular
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+4122_43138407Topological domainCytoplasmic
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+41265_77138407Topological domainExtracellular
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+41299_109138407Topological domainCytoplasmic
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+412110_130138407TransmembraneHelical
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+41244_64138407TransmembraneHelical
TgeneVMP1chr17:27844674chr17:57842332ENST00000262291+41278_98138407TransmembraneHelical


Top

FusionGeneSequence for TAOK1_VMP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAOK1_ENST00000261716_chr17_27844674_+_VMP1_ENST00000262291_chr17_57842332_+_905aa
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVTFARDVRTNEVVAIKKMSTSGKQSTEKWQDIIKEVKFLQRIKHPNSIE
YKGCTLREHTAWLVMETCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPAN
SFVGTPTWMAPEVILAMDEGQTDGKVDVWSLGITCIELAERKPPLFNMNAMSALTHIAQNESPTLQSNEWSDTFRNFVDSCLQKIPQDRP
TSEELLKHIFVLRERPETVLIDLIQRTKDAVRELDNLQTRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQVSRHKSHTRNREHFATIRTASLVTRQ
MQEHEQDSELREQMSGTKRMRRQHQKQLMTLENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHI
QAQQKKELNSFLESQKRETKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRMLLGRHNLE
QDLVREGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDE
ETQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITF
SKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSE

>In-frame_TAOK1_ENST00000261716_chr17_27844674_+_VMP1_ENST00000537567_chr17_57842332_+_905aa
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVTFARDVRTNEVVAIKKMSTSGKQSTEKWQDIIKEVKFLQRIKHPNSIE
YKGCTLREHTAWLVMETCLGSASDLLEVHKKPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPAN
SFVGTPTWMAPEVILAMDEGQTDGKVDVWSLGITCIELAERKPPLFNMNAMSALTHIAQNESPTLQSNEWSDTFRNFVDSCLQKIPQDRP
TSEELLKHIFVLRERPETVLIDLIQRTKDAVRELDNLQTRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQVSRHKSHTRNREHFATIRTASLVTRQ
MQEHEQDSELREQMSGTKRMRRQHQKQLMTLENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHI
QAQQKKELNSFLESQKRETKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRMLLGRHNLE
QDLVREGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDE
ETQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITF
SKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAOK1_ENST00000261716_chr17_27844674_+_VMP1_ENST00000262291_chr17_57842332_+_2715nt
ATGCCATCAACTAACAGAGCAGGCAGCCTGAAGGACCCTGAAATTGCAGAGCTCTTCTTCAAAGAAGATCCAGAGAAGCTCTTCACAGAT
CTCAGAGAAATTGGCCATGGAAGCTTTGGAGCAGTGTATTTTGCACGAGATGTGCGTACCAATGAAGTGGTGGCCATCAAGAAAATGTCT
TATAGTGGAAAGCAGTCTACTGAGAAATGGCAGGATATTATTAAGGAAGTCAAGTTTCTACAAAGAATAAAACATCCCAACAGTATAGAA
TACAAAGGCTGTTATTTACGTGAACACACAGCATGGCTTGTAATGGAATATTGTTTAGGATCTGCTTCGGATTTACTAGAAGTTCACAAA
AAGCCATTACAAGAAGTGGAAATAGCAGCAATTACACATGGTGCTCTTCAGGGATTAGCCTACTTACATTCTCATACTATGATTCATAGA
GATATCAAAGCAGGAAATATCCTTCTGACAGAACCAGGCCAGGTGAAACTTGCTGACTTTGGCTCTGCTTCCATGGCATCACCTGCCAAT
TCCTTTGTGGGAACGCCGTATTGGATGGCCCCAGAAGTAATTTTAGCCATGGATGAAGGACAATATGATGGCAAAGTAGATGTGTGGTCT
CTTGGAATAACATGTATTGAACTAGCGGAAAGGAAGCCTCCTTTATTTAATATGAATGCAATGAGTGCCTTATATCACATAGCCCAAAAT
GAATCCCCTACACTACAGTCTAATGAATGGTCTGATTATTTTCGCAACTTTGTAGATTCTTGCCTCCAGAAAATCCCTCAAGATCGACCT
ACATCAGAGGAACTTTTAAAGCACATATTTGTTCTTCGGGAGCGCCCTGAAACCGTGTTAATAGATCTCATTCAGAGGACAAAGGATGCA
GTAAGAGAGCTGGACAATCTGCAGTATCGAAAGATGAAGAAACTCCTTTTCCAGGAGGCACATAATGGACCAGCAGTAGAAGCACAGGAA
GAAGAAGAGGAACAAGATCATGGTGTTGGCCGGACAGGAACAGTTAATAGTGTTGGAAGTAATCAATCCATTCCCAGCATGTCCATCAGT
GCCAGCAGCCAAAGCAGTAGTGTTAACAGTCTTCCAGATGTCTCAGATGACAAGAGTGAGCTAGACATGATGGAGGGAGACCACACAGTG
ATGTCTAACAGTTCTGTTATCCATTTAAAACCAGAGGAAGAAAATTACAGAGAAGAGGGAGATCCTAGAACAAGAGCATCAGATCCACAA
TCTCCACCCCAAGTATCTCGTCACAAATCACACTATCGTAATCGAGAACACTTTGCTACTATACGGACAGCATCACTGGTTACGAGGCAA
ATGCAAGAACATGAGCAGGACTCTGAGCTTAGAGAACAAATGTCTGGCTATAAGCGAATGAGGCGACAACATCAAAAGCAACTGATGACT
CTGGAAAACAAGCTAAAGGCTGAGATGGATGAACATCGCCTCAGATTAGACAAAGATCTTGAAACTCAGCGTAACAATTTTGCTGCAGAA
ATGGAGAAACTTATCAAGAAACACCAGGCTGCCATGGAGAAAGAGGCTAAAGTGATGTCCAATGAAGAGAAAAAATTTCAGCAACATATT
CAGGCCCAACAGAAGAAAGAACTGAATAGTTTTCTCGAGTCCCAGAAAAGAGAGTATAAACTTCGAAAAGAGCAGCTTAAAGAGGAGCTA
AATGAAAACCAGAGTACCCCCAAAAAAGAAAAACAGGAGTGGCTTTCAAAGCAGAAGGAGAATATACAGCATTTCCAAGCAGAAGAAGAA
GCTAACCTTCTTCGACGTCAAAGACAATACCTAGAGCTGGAATGCCGTCGCTTCAAGAGAAGAATGTTACTTGGGCGTCATAACTTAGAG
CAGGACCTTGTCAGGGAGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTAT
CCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGC
ATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAA
GAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTA
CAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTG
GTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTC
AGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTG
GAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTC
GTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAG

>In-frame_TAOK1_ENST00000261716_chr17_27844674_+_VMP1_ENST00000537567_chr17_57842332_+_2715nt
ATGCCATCAACTAACAGAGCAGGCAGCCTGAAGGACCCTGAAATTGCAGAGCTCTTCTTCAAAGAAGATCCAGAGAAGCTCTTCACAGAT
CTCAGAGAAATTGGCCATGGAAGCTTTGGAGCAGTGTATTTTGCACGAGATGTGCGTACCAATGAAGTGGTGGCCATCAAGAAAATGTCT
TATAGTGGAAAGCAGTCTACTGAGAAATGGCAGGATATTATTAAGGAAGTCAAGTTTCTACAAAGAATAAAACATCCCAACAGTATAGAA
TACAAAGGCTGTTATTTACGTGAACACACAGCATGGCTTGTAATGGAATATTGTTTAGGATCTGCTTCGGATTTACTAGAAGTTCACAAA
AAGCCATTACAAGAAGTGGAAATAGCAGCAATTACACATGGTGCTCTTCAGGGATTAGCCTACTTACATTCTCATACTATGATTCATAGA
GATATCAAAGCAGGAAATATCCTTCTGACAGAACCAGGCCAGGTGAAACTTGCTGACTTTGGCTCTGCTTCCATGGCATCACCTGCCAAT
TCCTTTGTGGGAACGCCGTATTGGATGGCCCCAGAAGTAATTTTAGCCATGGATGAAGGACAATATGATGGCAAAGTAGATGTGTGGTCT
CTTGGAATAACATGTATTGAACTAGCGGAAAGGAAGCCTCCTTTATTTAATATGAATGCAATGAGTGCCTTATATCACATAGCCCAAAAT
GAATCCCCTACACTACAGTCTAATGAATGGTCTGATTATTTTCGCAACTTTGTAGATTCTTGCCTCCAGAAAATCCCTCAAGATCGACCT
ACATCAGAGGAACTTTTAAAGCACATATTTGTTCTTCGGGAGCGCCCTGAAACCGTGTTAATAGATCTCATTCAGAGGACAAAGGATGCA
GTAAGAGAGCTGGACAATCTGCAGTATCGAAAGATGAAGAAACTCCTTTTCCAGGAGGCACATAATGGACCAGCAGTAGAAGCACAGGAA
GAAGAAGAGGAACAAGATCATGGTGTTGGCCGGACAGGAACAGTTAATAGTGTTGGAAGTAATCAATCCATTCCCAGCATGTCCATCAGT
GCCAGCAGCCAAAGCAGTAGTGTTAACAGTCTTCCAGATGTCTCAGATGACAAGAGTGAGCTAGACATGATGGAGGGAGACCACACAGTG
ATGTCTAACAGTTCTGTTATCCATTTAAAACCAGAGGAAGAAAATTACAGAGAAGAGGGAGATCCTAGAACAAGAGCATCAGATCCACAA
TCTCCACCCCAAGTATCTCGTCACAAATCACACTATCGTAATCGAGAACACTTTGCTACTATACGGACAGCATCACTGGTTACGAGGCAA
ATGCAAGAACATGAGCAGGACTCTGAGCTTAGAGAACAAATGTCTGGCTATAAGCGAATGAGGCGACAACATCAAAAGCAACTGATGACT
CTGGAAAACAAGCTAAAGGCTGAGATGGATGAACATCGCCTCAGATTAGACAAAGATCTTGAAACTCAGCGTAACAATTTTGCTGCAGAA
ATGGAGAAACTTATCAAGAAACACCAGGCTGCCATGGAGAAAGAGGCTAAAGTGATGTCCAATGAAGAGAAAAAATTTCAGCAACATATT
CAGGCCCAACAGAAGAAAGAACTGAATAGTTTTCTCGAGTCCCAGAAAAGAGAGTATAAACTTCGAAAAGAGCAGCTTAAAGAGGAGCTA
AATGAAAACCAGAGTACCCCCAAAAAAGAAAAACAGGAGTGGCTTTCAAAGCAGAAGGAGAATATACAGCATTTCCAAGCAGAAGAAGAA
GCTAACCTTCTTCGACGTCAAAGACAATACCTAGAGCTGGAATGCCGTCGCTTCAAGAGAAGAATGTTACTTGGGCGTCATAACTTAGAG
CAGGACCTTGTCAGGGAGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTAT
CCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGC
ATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAA
GAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTA
CAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTG
GTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTC
AGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTG
GAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTC
GTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAOK1_ENST00000261716_chr17_27844674_+_VMP1_ENST00000262291_chr17_57842332_+_4415nt
CTTACCAGGGGTGGTGTTGGTGGCGGAGGGCTGCGCGTGGGCCCGCCCGCCGAGGGGCCGCGGCGGGGGACCGAGAGGGCCTCGGCTGTG
TGAGGACTAGAGGCGGCCGAGGCCCGGGCCGGTTCCCCCGAGGCGGCGACGGAGACGGCTCCCGGCACTTCCCCGCGCCATCTTAACTGA
GCCCAAGCGCTGAGGGCGCCTCCTCGACCCCGGTCGTCCCCTCGCCCCCCCCCCCACCCCCCGCCGCCGCCGCCCCTTGTTGCAGAGCTT
GGGCTGGGCGGCTTGCTGGGGCTCGGGGGTGGGGGGCGGCGATCTGTCGCCGGGCCCCCTCCTCCTCCTCACTCCTCACCCTCCAGGGTA
GCGGCTACCGGAGCGCTGCAGGGGGCTGCGCCTGCCTGCTCCGCCCCAGACCTGTCGGCGAAAGGTAGTTTATGCCAACGTGACTTCATT
CATACAGATGAACCAAGGATCGGGATAGCAGTATAAAATTAGAATCAAGACAGCTGACTGCTCAGCAGGATGCCATCAACTAACAGAGCA
GGCAGCCTGAAGGACCCTGAAATTGCAGAGCTCTTCTTCAAAGAAGATCCAGAGAAGCTCTTCACAGATCTCAGAGAAATTGGCCATGGA
AGCTTTGGAGCAGTGTATTTTGCACGAGATGTGCGTACCAATGAAGTGGTGGCCATCAAGAAAATGTCTTATAGTGGAAAGCAGTCTACT
GAGAAATGGCAGGATATTATTAAGGAAGTCAAGTTTCTACAAAGAATAAAACATCCCAACAGTATAGAATACAAAGGCTGTTATTTACGT
GAACACACAGCATGGCTTGTAATGGAATATTGTTTAGGATCTGCTTCGGATTTACTAGAAGTTCACAAAAAGCCATTACAAGAAGTGGAA
ATAGCAGCAATTACACATGGTGCTCTTCAGGGATTAGCCTACTTACATTCTCATACTATGATTCATAGAGATATCAAAGCAGGAAATATC
CTTCTGACAGAACCAGGCCAGGTGAAACTTGCTGACTTTGGCTCTGCTTCCATGGCATCACCTGCCAATTCCTTTGTGGGAACGCCGTAT
TGGATGGCCCCAGAAGTAATTTTAGCCATGGATGAAGGACAATATGATGGCAAAGTAGATGTGTGGTCTCTTGGAATAACATGTATTGAA
CTAGCGGAAAGGAAGCCTCCTTTATTTAATATGAATGCAATGAGTGCCTTATATCACATAGCCCAAAATGAATCCCCTACACTACAGTCT
AATGAATGGTCTGATTATTTTCGCAACTTTGTAGATTCTTGCCTCCAGAAAATCCCTCAAGATCGACCTACATCAGAGGAACTTTTAAAG
CACATATTTGTTCTTCGGGAGCGCCCTGAAACCGTGTTAATAGATCTCATTCAGAGGACAAAGGATGCAGTAAGAGAGCTGGACAATCTG
CAGTATCGAAAGATGAAGAAACTCCTTTTCCAGGAGGCACATAATGGACCAGCAGTAGAAGCACAGGAAGAAGAAGAGGAACAAGATCAT
GGTGTTGGCCGGACAGGAACAGTTAATAGTGTTGGAAGTAATCAATCCATTCCCAGCATGTCCATCAGTGCCAGCAGCCAAAGCAGTAGT
GTTAACAGTCTTCCAGATGTCTCAGATGACAAGAGTGAGCTAGACATGATGGAGGGAGACCACACAGTGATGTCTAACAGTTCTGTTATC
CATTTAAAACCAGAGGAAGAAAATTACAGAGAAGAGGGAGATCCTAGAACAAGAGCATCAGATCCACAATCTCCACCCCAAGTATCTCGT
CACAAATCACACTATCGTAATCGAGAACACTTTGCTACTATACGGACAGCATCACTGGTTACGAGGCAAATGCAAGAACATGAGCAGGAC
TCTGAGCTTAGAGAACAAATGTCTGGCTATAAGCGAATGAGGCGACAACATCAAAAGCAACTGATGACTCTGGAAAACAAGCTAAAGGCT
GAGATGGATGAACATCGCCTCAGATTAGACAAAGATCTTGAAACTCAGCGTAACAATTTTGCTGCAGAAATGGAGAAACTTATCAAGAAA
CACCAGGCTGCCATGGAGAAAGAGGCTAAAGTGATGTCCAATGAAGAGAAAAAATTTCAGCAACATATTCAGGCCCAACAGAAGAAAGAA
CTGAATAGTTTTCTCGAGTCCCAGAAAAGAGAGTATAAACTTCGAAAAGAGCAGCTTAAAGAGGAGCTAAATGAAAACCAGAGTACCCCC
AAAAAAGAAAAACAGGAGTGGCTTTCAAAGCAGAAGGAGAATATACAGCATTTCCAAGCAGAAGAAGAAGCTAACCTTCTTCGACGTCAA
AGACAATACCTAGAGCTGGAATGCCGTCGCTTCAAGAGAAGAATGTTACTTGGGCGTCATAACTTAGAGCAGGACCTTGTCAGGGAGGGT
CCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCA
GATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCA
ATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAG
ATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG
AAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACC
TGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTAT
CCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTA
CTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCT
TGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTA
CAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATT
GATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATG
AAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTT
ATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGG
CATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAA
ACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCT
GTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTAT
TCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAAATAAACAATTTTACTTTTT

>In-frame_TAOK1_ENST00000261716_chr17_27844674_+_VMP1_ENST00000537567_chr17_57842332_+_3494nt
CTTACCAGGGGTGGTGTTGGTGGCGGAGGGCTGCGCGTGGGCCCGCCCGCCGAGGGGCCGCGGCGGGGGACCGAGAGGGCCTCGGCTGTG
TGAGGACTAGAGGCGGCCGAGGCCCGGGCCGGTTCCCCCGAGGCGGCGACGGAGACGGCTCCCGGCACTTCCCCGCGCCATCTTAACTGA
GCCCAAGCGCTGAGGGCGCCTCCTCGACCCCGGTCGTCCCCTCGCCCCCCCCCCCACCCCCCGCCGCCGCCGCCCCTTGTTGCAGAGCTT
GGGCTGGGCGGCTTGCTGGGGCTCGGGGGTGGGGGGCGGCGATCTGTCGCCGGGCCCCCTCCTCCTCCTCACTCCTCACCCTCCAGGGTA
GCGGCTACCGGAGCGCTGCAGGGGGCTGCGCCTGCCTGCTCCGCCCCAGACCTGTCGGCGAAAGGTAGTTTATGCCAACGTGACTTCATT
CATACAGATGAACCAAGGATCGGGATAGCAGTATAAAATTAGAATCAAGACAGCTGACTGCTCAGCAGGATGCCATCAACTAACAGAGCA
GGCAGCCTGAAGGACCCTGAAATTGCAGAGCTCTTCTTCAAAGAAGATCCAGAGAAGCTCTTCACAGATCTCAGAGAAATTGGCCATGGA
AGCTTTGGAGCAGTGTATTTTGCACGAGATGTGCGTACCAATGAAGTGGTGGCCATCAAGAAAATGTCTTATAGTGGAAAGCAGTCTACT
GAGAAATGGCAGGATATTATTAAGGAAGTCAAGTTTCTACAAAGAATAAAACATCCCAACAGTATAGAATACAAAGGCTGTTATTTACGT
GAACACACAGCATGGCTTGTAATGGAATATTGTTTAGGATCTGCTTCGGATTTACTAGAAGTTCACAAAAAGCCATTACAAGAAGTGGAA
ATAGCAGCAATTACACATGGTGCTCTTCAGGGATTAGCCTACTTACATTCTCATACTATGATTCATAGAGATATCAAAGCAGGAAATATC
CTTCTGACAGAACCAGGCCAGGTGAAACTTGCTGACTTTGGCTCTGCTTCCATGGCATCACCTGCCAATTCCTTTGTGGGAACGCCGTAT
TGGATGGCCCCAGAAGTAATTTTAGCCATGGATGAAGGACAATATGATGGCAAAGTAGATGTGTGGTCTCTTGGAATAACATGTATTGAA
CTAGCGGAAAGGAAGCCTCCTTTATTTAATATGAATGCAATGAGTGCCTTATATCACATAGCCCAAAATGAATCCCCTACACTACAGTCT
AATGAATGGTCTGATTATTTTCGCAACTTTGTAGATTCTTGCCTCCAGAAAATCCCTCAAGATCGACCTACATCAGAGGAACTTTTAAAG
CACATATTTGTTCTTCGGGAGCGCCCTGAAACCGTGTTAATAGATCTCATTCAGAGGACAAAGGATGCAGTAAGAGAGCTGGACAATCTG
CAGTATCGAAAGATGAAGAAACTCCTTTTCCAGGAGGCACATAATGGACCAGCAGTAGAAGCACAGGAAGAAGAAGAGGAACAAGATCAT
GGTGTTGGCCGGACAGGAACAGTTAATAGTGTTGGAAGTAATCAATCCATTCCCAGCATGTCCATCAGTGCCAGCAGCCAAAGCAGTAGT
GTTAACAGTCTTCCAGATGTCTCAGATGACAAGAGTGAGCTAGACATGATGGAGGGAGACCACACAGTGATGTCTAACAGTTCTGTTATC
CATTTAAAACCAGAGGAAGAAAATTACAGAGAAGAGGGAGATCCTAGAACAAGAGCATCAGATCCACAATCTCCACCCCAAGTATCTCGT
CACAAATCACACTATCGTAATCGAGAACACTTTGCTACTATACGGACAGCATCACTGGTTACGAGGCAAATGCAAGAACATGAGCAGGAC
TCTGAGCTTAGAGAACAAATGTCTGGCTATAAGCGAATGAGGCGACAACATCAAAAGCAACTGATGACTCTGGAAAACAAGCTAAAGGCT
GAGATGGATGAACATCGCCTCAGATTAGACAAAGATCTTGAAACTCAGCGTAACAATTTTGCTGCAGAAATGGAGAAACTTATCAAGAAA
CACCAGGCTGCCATGGAGAAAGAGGCTAAAGTGATGTCCAATGAAGAGAAAAAATTTCAGCAACATATTCAGGCCCAACAGAAGAAAGAA
CTGAATAGTTTTCTCGAGTCCCAGAAAAGAGAGTATAAACTTCGAAAAGAGCAGCTTAAAGAGGAGCTAAATGAAAACCAGAGTACCCCC
AAAAAAGAAAAACAGGAGTGGCTTTCAAAGCAGAAGGAGAATATACAGCATTTCCAAGCAGAAGAAGAAGCTAACCTTCTTCGACGTCAA
AGACAATACCTAGAGCTGGAATGCCGTCGCTTCAAGAGAAGAATGTTACTTGGGCGTCATAACTTAGAGCAGGACCTTGTCAGGGAGGGT
CCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCA
GATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCA
ATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAG
ATGCTGGAACATGCAGAGTCTGCACAAGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG
AAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACC
TGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTAT


Top

FusionGenePPI for TAOK1_VMP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAOK1STK4, CSNK1E, DYNC1I1, GEMIN7, WT1, C8orf33, SRBD1, MAP3K7, STK25, STK26, NTRK1, SNW1, FAM206AVMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAOK1_VMP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TAOK1_VMP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTAOK1C0018781Noise-induced hearing loss1CTD_human