FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37205

FusionGeneSummary for TANK_SLC38A6

check button Fusion gene summary
Fusion gene informationFusion gene name: TANK_SLC38A6
Fusion gene ID: 37205
HgeneTgene
Gene symbol

TANK

SLC38A6

Gene ID

10010

145389

Gene nameTRAF family member associated NFKB activatorsolute carrier family 38 member 6
SynonymsI-TRAF|ITRAF|TRAF2NAT-1|SNAT6
Cytomap

2q24.2

14q23.1

Type of geneprotein-codingprotein-coding
DescriptionTRAF family member-associated NF-kappa-B activatorTRAF-interacting proteinprobable sodium-coupled neutral amino acid transporter 6N system amino acid transporter NAT-1N-system amino acid transporter 1Na(+)-coupled neutral amino acid transporter 6
Modification date2018052320180523
UniProtAcc

Q92844

Q8IZM9

Ensembl transtripts involved in fusion geneENST00000259075, ENST00000457476, 
ENST00000392749, ENST00000461338, 
ENST00000402568, ENST00000406287, 
ENST00000405852, ENST00000403609, 
ENST00000354886, ENST00000267488, 
ENST00000456840, ENST00000554304, 
Fusion gene scores* DoF score3 X 2 X 2=121 X 1 X 1=1
# samples 21
** MAII scorelog2(2/12*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: TANK [Title/Abstract] AND SLC38A6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-56-6545-01ATANKchr2

162036272

+SLC38A6chr14

61449226

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000259075ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000259075ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000259075ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000259075ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000457476ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000457476ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000457476ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000457476ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000392749ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000392749ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000392749ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000392749ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
intron-3CDSENST00000461338ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
intron-3CDSENST00000461338ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
intron-3CDSENST00000461338ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
intron-3UTRENST00000461338ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000402568ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000402568ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000402568ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000402568ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000406287ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000406287ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000406287ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000406287ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000405852ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000405852ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000405852ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000405852ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000403609ENST00000354886TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000403609ENST00000267488TANKchr2

162036272

+SLC38A6chr14

61449226

+
In-frameENST00000403609ENST00000456840TANKchr2

162036272

+SLC38A6chr14

61449226

+
5CDS-3UTRENST00000403609ENST00000554304TANKchr2

162036272

+SLC38A6chr14

61449226

+

Top

FusionProtFeatures for TANK_SLC38A6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TANK

Q92844

SLC38A6

Q8IZM9

Adapter protein involved in I-kappa-B-kinase (IKK)regulation which constitutively binds TBK1 and IKBKE playing arole in antiviral innate immunity. Acts as a regulator of TRAFfunction by maintaining them in a latent state. Blocks TRAF2binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation.Negatively regulates NF-kappaB signaling and cell survival uponDNA damage (PubMed:25861989). Plays a role as an adapter toassemble ZC3H12A, USP10 in a deubiquitination complex which playsa negative feedback response to attenuate NF-kappaB activationthrough the deubiquitination of IKBKG or TRAF6 in response tointerleukin-1-beta (IL1B) stimulation or upon DNA damage(PubMed:25861989). Promotes UBP10-induced deubiquitination ofTRAF6 in response to DNA damage (PubMed:25861989). May controlnegatively TRAF2-mediated NF-kappa-B activation signaled by CD40,TNFR1 and TNFR2. {ECO:0000269|PubMed:12133833,ECO:0000269|PubMed:21931631, ECO:0000269|PubMed:25861989}. Probable sodium-dependent amino acid/proton antiporter,could be a neuronal transporter for glutamate.{ECO:0000250|UniProtKB:G3UVW3}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016111_13135457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016170_19035457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016191_21135457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016250_27035457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016288_30835457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016327_34735457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016371_39135457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016394_41435457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+01642_6235457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+016431_45135457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000267488+01685_10535457TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017111_13135522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017170_19035522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017191_21135522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017250_27035522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017288_30835522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017327_34735522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017371_39135522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017394_41435522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+01742_6235522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+017431_45135522TransmembraneHelical
TgeneSLC38A6chr2:162036272chr14:61449226ENST00000354886+01785_10535522TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTANKchr2:162036272chr14:61449226ENST00000259075+2822_6233426Coiled coilOntology_term=ECO:0000255
HgeneTANKchr2:162036272chr14:61449226ENST00000392749+2822_6233426Coiled coilOntology_term=ECO:0000255
HgeneTANKchr2:162036272chr14:61449226ENST00000403609+1322_6233120Coiled coilOntology_term=ECO:0000255
HgeneTANKchr2:162036272chr14:61449226ENST00000457476+2422_6233120Coiled coilOntology_term=ECO:0000255
HgeneTANKchr2:162036272chr14:61449226ENST00000259075+28394_42033426Zinc fingerNote=C2H2-type
HgeneTANKchr2:162036272chr14:61449226ENST00000392749+28394_42033426Zinc fingerNote=C2H2-type
HgeneTANKchr2:162036272chr14:61449226ENST00000403609+13394_42033120Zinc fingerNote=C2H2-type
HgeneTANKchr2:162036272chr14:61449226ENST00000457476+24394_42033120Zinc fingerNote=C2H2-type


Top

FusionGeneSequence for TANK_SLC38A6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_520aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_455aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGAFVLLIFGILVGNFSLALIIFD

>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_509aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_520aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_455aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGAFVLLIFGILVGNFSLALIIFD

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_509aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_520aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_455aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGAFVLLIFGILVGNFSLALIIFD

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_509aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_578aa
MLLTSYNKGEMVVKEVKKRREIEGKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVV
AGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKW
SIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISALFGY
LTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNV
FGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCLPDSSNPPTSASRVAETTGRDTMEMCTQRKGHA

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_513aa
MLLTSYNKGEMVVKEVKKRREIEGKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVV
AGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKW
SIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISALFGY
LTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNV

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_567aa
MLLTSYNKGEMVVKEVKKRREIEGKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVV
AGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKW
SIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISALFGY
LTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNV
FGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCLPDSSNPPTSASRVAETTEKEEIPWRCAPRGKA

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_578aa
MLLTSYNKGEMVVKEVKKRREIEGKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVV
AGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKW
SIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISALFGY
LTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNV
FGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCLPDSSNPPTSASRVAETTGRDTMEMCTQRKGHA

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_513aa
MLLTSYNKGEMVVKEVKKRREIEGKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVV
AGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKW
SIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISALFGY
LTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNV

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_567aa
MLLTSYNKGEMVVKEVKKRREIEGKENDLPSYRGWNTHPNERPVIYSILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVV
AGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKW
SIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISALFGY
LTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNV
FGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCLPDSSNPPTSASRVAETTEKEEIPWRCAPRGKA

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_520aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_455aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGAFVLLIFGILVGNFSLALIIFD

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_509aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_520aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_455aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGAFVLLIFGILVGNFSLALIIFD

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_509aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYS
VHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPL
ALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCE
LQSPSKKRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFFSN
FPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSREDFLSWKKLGGLILSHRLACSGVISAHCNLCL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1560nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGC
CACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCAC

>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1365nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGAT

>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1527nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGA

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1560nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGC
CACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCAC

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1365nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGAT

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1527nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGA

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1560nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGC
CACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCAC

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1365nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGAT

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1527nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGA

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1734nt
ATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCT
TCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGAT
AAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAA
AAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTT
GGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCAT
CTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTG
GCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTT
TTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTT
CTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGG
TCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCAT
TTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAA
AGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTAC
CTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTA
TGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCA
TTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTA
TTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTG
TCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGAC
TCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCA
AGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCA

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1539nt
ATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCT
TCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGAT
AAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAA
AAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTT
GGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCAT
CTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTG
GCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTT
TTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTT
CTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGG
TCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCAT
TTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAA
AGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTAC
CTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTA
TGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCA
TTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTA
TTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTG
TCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATT

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1701nt
ATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCT
TCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGAT
AAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAA
AAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTT
GGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCAT
CTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTG
GCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTT
TTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTT
CTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGG
TCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCAT
TTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAA
AGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTAC
CTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTA
TGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCA
TTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTA
TTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTG
TCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGAC
TCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCC

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1734nt
ATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCT
TCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGAT
AAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAA
AAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTT
GGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCAT
CTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTG
GCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTT
TTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTT
CTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGG
TCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCAT
TTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAA
AGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTAC
CTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTA
TGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCA
TTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTA
TTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTG
TCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGAC
TCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCA
AGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCA

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1539nt
ATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCT
TCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGAT
AAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAA
AAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTT
GGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCAT
CTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTG
GCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTT
TTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTT
CTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGG
TCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCAT
TTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAA
AGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTAC
CTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTA
TGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCA
TTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTA
TTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTG
TCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATT

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1701nt
ATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTAAAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCT
TCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGAT
AAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAA
AAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTT
GGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCAT
CTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTG
GCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTT
TTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTT
CTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGG
TCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCAT
TTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAA
AGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTAC
CTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTA
TGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCA
TTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTA
TTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTG
TCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGAC
TCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCC

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1560nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGC
CACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCAC

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1365nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGAT

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1527nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGA

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1560nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGC
CACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCAC

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1365nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGAT

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1527nt
ATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTA
CAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGC
ATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCA
GTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTG
GTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCA
GAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTT
GCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAA
AAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTC
TTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAA
CTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTT
GGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTG
AAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAAT
TTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGA
AATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGAT
TTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTC
CCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1785nt
TTTCTCAGTGGAAGTTCCCACTTCAACATAAGGGAGAGCTCTGGACAGTTTGAGCAGCATTGTTAGAGCCTGTGGAAAACACTTTACAAC
TGTGTAACTGTCTTCATCTTTACAGAGGAATAGTCTACAAAGGAAGACTTGTAACCTGGAGAAGAGACCTGTCATTTACTCCATCCTTTA
TAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGA
TAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTT
GATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGAC
AGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTT
TGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAA
AACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCAT
ATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTT
CTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGT
TACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATAC
CTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCT
CATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATC
ACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGC
TGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACT
TGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATT
TTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGAT
CTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCAT
GGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAA

>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1771nt
TTTCTCAGTGGAAGTTCCCACTTCAACATAAGGGAGAGCTCTGGACAGTTTGAGCAGCATTGTTAGAGCCTGTGGAAAACACTTTACAAC
TGTGTAACTGTCTTCATCTTTACAGAGGAATAGTCTACAAAGGAAGACTTGTAACCTGGAGAAGAGACCTGTCATTTACTCCATCCTTTA
TAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGA
TAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTT
GATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGAC
AGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTT
TGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAA
AACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCAT
ATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTT
CTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGT
TACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATAC
CTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCT
CATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATC
ACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGC
TGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACT
TGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATT
TTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTT
TAGTTTAGCACTCATCATTTTTGATTGGATTAATAAATAAAAGAAATATTTTCCTACTTCTTACAAGAATAATATACCCCTAGTTGCAAG
AATGAATTATTCCGGAAGACACCCTGGATGAAAAATAACATTTTAATAAAAATTATTAACAGAAAAGCAGAACAAAATGGCAGTGGGTAT

>In-frame_TANK_ENST00000259075_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1790nt
TTTCTCAGTGGAAGTTCCCACTTCAACATAAGGGAGAGCTCTGGACAGTTTGAGCAGCATTGTTAGAGCCTGTGGAAAACACTTTACAAC
TGTGTAACTGTCTTCATCTTTACAGAGGAATAGTCTACAAAGGAAGACTTGTAACCTGGAGAAGAGACCTGTCATTTACTCCATCCTTTA
TAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGA
TAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTT
GATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGAC
AGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTT
TGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAA
AACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCAT
ATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTT
CTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGT
TACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATAC
CTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCT
CATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATC
ACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGC
TGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACT
TGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATT
TTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGAT
CTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGAT
ACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGA

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1738nt
GTTTGAGCAGCATTGTTAGAGCCTGTGGAAAACACTTTACAACTGTGTAACTGTCTTCATCTTTACAGAGGAATAGTCTACAAAGGAAGA
CTTGTAACCTGGAGAAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGC
AACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGAC
AGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTT
TGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGT
GTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAA
TTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATA
GTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCT
TTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTC
TGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTG
CTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAA
GAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACA
AAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTG
TGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCC
ATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTG
CCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTG
GGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCA
CCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAG
GCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGA

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1724nt
GTTTGAGCAGCATTGTTAGAGCCTGTGGAAAACACTTTACAACTGTGTAACTGTCTTCATCTTTACAGAGGAATAGTCTACAAAGGAAGA
CTTGTAACCTGGAGAAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGC
AACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGAC
AGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTT
TGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGT
GTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAA
TTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATA
GTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCT
TTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTC
TGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTG
CTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAA
GAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACA
AAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTG
TGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCC
ATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTG
CCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTG
GGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATTAATAAATAAAAGAAAT
ATTTTCCTACTTCTTACAAGAATAATATACCCCTAGTTGCAAGAATGAATTATTCCGGAAGACACCCTGGATGAAAAATAACATTTTAAT
AAAAATTATTAACAGAAAAGCAGAACAAAATGGCAGTGGGTATGGGGAAGTAAGAGTGTGGCAGTTTTAATCAAAAAAAGAAACAAACTC

>In-frame_TANK_ENST00000457476_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1743nt
GTTTGAGCAGCATTGTTAGAGCCTGTGGAAAACACTTTACAACTGTGTAACTGTCTTCATCTTTACAGAGGAATAGTCTACAAAGGAAGA
CTTGTAACCTGGAGAAGAGACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGC
AACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGAC
AGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTT
TGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGT
GTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAA
TTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATA
GTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCT
TTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTC
TGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTG
CTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAA
GAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACA
AAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTG
TGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCC
ATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTG
CCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTG
GGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCA
CCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCA
AGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAAC

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1819nt
AGAAGAGCCCTGGGCTGGGTGGGGCAGGGCGGAAGGGCCCTGGCCTTGTTGGGTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACT
GCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGGCGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAG
CGTGAACTGTACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATA
AAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCC
CAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATA
CCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGA
CAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATA
TTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATT
GGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCT
ACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAA
ATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCT
TACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGA
ATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGT
CAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGA
CAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGA
TCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACAT
CAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCA
TTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCT
CCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTT
TACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAA

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1805nt
AGAAGAGCCCTGGGCTGGGTGGGGCAGGGCGGAAGGGCCCTGGCCTTGTTGGGTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACT
GCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGGCGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAG
CGTGAACTGTACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATA
AAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCC
CAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATA
CCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGA
CAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATA
TTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATT
GGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCT
ACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAA
ATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCT
TACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGA
ATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGT
CAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGA
CAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGA
TCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACAT
CAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGCATTCG
TTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATTAATAAATAAAAGAAATATTTTCCTA
CTTCTTACAAGAATAATATACCCCTAGTTGCAAGAATGAATTATTCCGGAAGACACCCTGGATGAAAAATAACATTTTAATAAAAATTAT
TAACAGAAAAGCAGAACAAAATGGCAGTGGGTATGGGGAAGTAAGAGTGTGGCAGTTTTAATCAAAAAAAGAAACAAACTCGAAATGCTC

>In-frame_TANK_ENST00000392749_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1824nt
AGAAGAGCCCTGGGCTGGGTGGGGCAGGGCGGAAGGGCCCTGGCCTTGTTGGGTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACT
GCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGGCGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAG
CGTGAACTGTACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATA
AAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCC
CAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATA
CCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGA
CAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATA
TTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATT
GGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCT
ACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAA
ATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCT
TACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGA
ATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGT
CAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGA
CAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGA
TCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACAT
CAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCA
TTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCT
CCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAA
CTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAA

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1895nt
GTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACTGCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGG
CGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTGTGAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTA
AAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCT
GTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCC
TTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTT
GGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGA
TTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCT
TATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCA
TCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGA
CAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTA
TCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAA
GGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCT
TTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACA
GCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAA
GGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATC
CACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTC
AATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATT
TTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGG
TTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAG
ACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGA
AGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAATGATGTTGTTTAAT

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1881nt
GTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACTGCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGG
CGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTGTGAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTA
AAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCT
GTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCC
TTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTT
GGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGA
TTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCT
TATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCA
TCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGA
CAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTA
TCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAA
GGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCT
TTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACA
GCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAA
GGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATC
CACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTC
AATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATT
TTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTT
GGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATTAATAAATAAAAGAAATATTTTCCTACTTCTTACAAGAAT
AATATACCCCTAGTTGCAAGAATGAATTATTCCGGAAGACACCCTGGATGAAAAATAACATTTTAATAAAAATTATTAACAGAAAAGCAG

>In-frame_TANK_ENST00000402568_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1900nt
GTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACTGCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGG
CGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTGTGAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTA
AAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCT
GTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCC
TTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTT
GGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGA
TTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCT
TATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCA
TCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGA
CAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTA
TCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAA
GGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCT
TTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACA
GCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAA
GGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATC
CACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTC
AATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATT
TTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGG
TTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAG
ACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCA
AGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAATGATGTTGT

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1895nt
GTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACTGCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGG
CGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTGTGAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTA
AAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCT
GTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCC
TTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTT
GGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGA
TTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCT
TATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCA
TCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGA
CAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTA
TCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAA
GGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCT
TTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACA
GCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAA
GGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATC
CACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTC
AATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATT
TTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGG
TTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAG
ACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGA
AGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAATGATGTTGTTTAAT

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1881nt
GTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACTGCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGG
CGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTGTGAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTA
AAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCT
GTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCC
TTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTT
GGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGA
TTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCT
TATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCA
TCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGA
CAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTA
TCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAA
GGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCT
TTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACA
GCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAA
GGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATC
CACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTC
AATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATT
TTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTT
GGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATTAATAAATAAAAGAAATATTTTCCTACTTCTTACAAGAAT
AATATACCCCTAGTTGCAAGAATGAATTATTCCGGAAGACACCCTGGATGAAAAATAACATTTTAATAAAAATTATTAACAGAAAAGCAG

>In-frame_TANK_ENST00000406287_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1900nt
GTGGAGGTGAAGAGTTAATGGCTCCGCGCGCAGGCACTGCCCTCTGAACTGGAACAAAATGCAACTTCCGGTTGGAGTCACTCGGCCAGG
CGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTGTGAGATGCTTTTGACAAGTTATAATAAGGGAGAGATGGTAGTA
AAGGAAGTGAAGAAGCGACGTGAAATTGAAGGAAAAGAAAATGACCTGCCTTCTTACCGCGGTTGGAATACACACCCAAACGAGAGACCT
GTCATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCC
TTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTT
GGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGA
TTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCT
TATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCA
TCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGA
CAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTA
TCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAA
GGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCT
TTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACA
GCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAA
GGTTATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATC
CACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTC
AATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATT
TTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGG
TTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAG
ACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCA
AGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAATGATGTTGT

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1677nt
GGCGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACG
AAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAA
AGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGG
AAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTC
TTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGG
AAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGC
TATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTT
CCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAAT
AATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCC
AAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATA
CTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGC
ACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCAT
GACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTT
CTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGA
CATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAG
AGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCT
CTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAG
GAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGAT

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1663nt
GGCGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACG
AAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAA
AGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGG
AAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTC
TTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGG
AAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGC
TATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTT
CCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAAT
AATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCC
AAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATA
CTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGC
ACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCAT
GACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTT
CTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGA
CATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAG
AGAGGATTTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGAATTTTGGTTGGGAATTTTAGTTTAGCACTCATCAT
TTTTGATTGGATTAATAAATAAAAGAAATATTTTCCTACTTCTTACAAGAATAATATACCCCTAGTTGCAAGAATGAATTATTCCGGAAG
ACACCCTGGATGAAAAATAACATTTTAATAAAAATTATTAACAGAAAAGCAGAACAAAATGGCAGTGGGTATGGGGAAGTAAGAGTGTGG

>In-frame_TANK_ENST00000405852_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1682nt
GGCGCCGGCGACCTGAGGGGAGAGGGAACGCAGCTGAAAGCGTGAACTACCTGTCATTTACTCCATCCTTTATAGTGATGCTACAGGACG
AAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTCCGGCAGGCATGCATGGATAGAGATTCTGCAGTAAA
AGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGG
AAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTC
TTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGGATTACCTGG
AAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTTTTAATTATTAAAACAGAGCTTCCTGCTGC
TATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTT
CCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAAT
AATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATGTTACAGATGATTGTAAGCC
AAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATA
CTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGC
ACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGTTGTTGTCAT
GACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTT
CTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGA
CATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAG
AGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCT
CTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACTACAGAAAAGGAAGAGATACCATGGAGATGTGCACC
CAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACC

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000354886_chr14_61449226_+_1622nt
ATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTC
CGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGT
TTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTT
AGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTAT
GAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCT
TATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAA
ACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCA
TTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGT
TTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTT
TCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCA
ATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGT
TATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCAC
TTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAAT
ATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTT
ATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTG
GCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACT
ACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGGGAAGA
GGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAATGATGTTGTTTAATCAC

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000267488_chr14_61449226_+_1608nt
ATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTC
CGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGT
TTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTT
AGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTAT
GAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCT
TATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAA
ACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCA
TTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGT
TTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTT
TCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCA
ATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGT
TATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCAC
TTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAAT
ATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTT
ATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGCATTCGTTTTGCTCATCTTTGGA
ATTTTGGTTGGGAATTTTAGTTTAGCACTCATCATTTTTGATTGGATTAATAAATAAAAGAAATATTTTCCTACTTCTTACAAGAATAAT
ATACCCCTAGTTGCAAGAATGAATTATTCCGGAAGACACCCTGGATGAAAAATAACATTTTAATAAAAATTATTAACAGAAAAGCAGAAC

>In-frame_TANK_ENST00000403609_chr2_162036272_+_SLC38A6_ENST00000456840_chr14_61449226_+_1627nt
ATTTACTCCATCCTTTATAGTGATGCTACAGGACGAAGAGGAATGGATAAAAACATTGGCGAGCAACTCAATAAAGCGTATGAAGCCTTC
CGGCAGGCATGCATGGATAGAGATTCTGCAGTAAAAGAATTACAGCAAAAGGAACTTCACAGACAGCGATCCCCAGGTGTTTCATTTGGT
TTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTGGCTAATACCGGTGTCTTTGGATTT
AGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCCATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTAT
GAAGATCTTGGACTCTTTGCATTTGGATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCT
TATCTTTTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGTATCTTGATGGACAA
ACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAAAATAGGCTTTCTTGGCTACACAAGTAGTTTATCA
TTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATAATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGT
TTCCAGATTTCAAATGTTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGCTTTT
TCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGAATGCAGAATGTTACCAATACAGCA
ATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGTACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGT
TATAGTAAATACTTATCACATGATGTTGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCAC
TTCCCTGCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCACTCTAGCACTCAAT
ATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGTAGTTGGTGCCAGTACATCAACATGTTTGATTTTT
ATATTCCCAGGACTATTTTATCTTAAACTTAGCAGAGAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTG
GCGTGCAGTGGTGTGATCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGAGACT
ACAGAAAAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGCAACTGTTTACAAGCCAAGG
GAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCCCAACCTCCAGAACTGTGAGCAAATAAATGATGTTGTTTA


Top

FusionGenePPI for TANK_SLC38A6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TANKZC3H12A, TRAF3, TBK1, TRAF2, TRAF1, ITGB1BP1, IKBKG, CHUK, IKBKE, IRF7, IRF3, PLK1, MARCH5, APBA3, BIRC2, TICAM1, HERC2, TAB2, CBLB, CD40, MAP3K14, TANK, APP, BIRC3, HLA-C, LAMC1, AIMP2, COPB1, FBLN1, ATP6V1H, BIK, KPNA2, SMAD3, SDC4, RACGAP1, INPP5K, TP53BP2, SRSF11, CEP63, ZFP36, SUMO2, BBOX1, CEP128, USP10, TRAF6, PBXIP1SLC38A6ELAVL1, TF, NPLOC4, MUCL1, APOB, MTCH2, ZG16B, CYB5A, RBFOX3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTANKchr2:162036272chr14:61449226ENST00000259075+28133_17233426TBK1 and IKBKE
HgeneTANKchr2:162036272chr14:61449226ENST00000392749+28133_17233426TBK1 and IKBKE
HgeneTANKchr2:162036272chr14:61449226ENST00000403609+13133_17233120TBK1 and IKBKE
HgeneTANKchr2:162036272chr14:61449226ENST00000457476+24133_17233120TBK1 and IKBKE


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TANK_SLC38A6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TANK_SLC38A6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTANKC1458155Mammary Neoplasms1CTD_human