FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37085

FusionGeneSummary for TAF1B_SGCZ

check button Fusion gene summary
Fusion gene informationFusion gene name: TAF1B_SGCZ
Fusion gene ID: 37085
HgeneTgene
Gene symbol

TAF1B

SGCZ

Gene ID

9014

137868

Gene nameTATA-box binding protein associated factor, RNA polymerase I subunit Bsarcoglycan zeta
SynonymsMGC:9349|RAF1B|RAFI63|SL1|TAFI63ZSG1
Cytomap

2p25.1

8p22

Type of geneprotein-codingprotein-coding
DescriptionTATA box-binding protein-associated factor RNA polymerase I subunit BRNA polymerase I-specific TBP-associated factor 63 kDaSL1, 63kD subunitTATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDTATA box binding protein (TBP)-assoczeta-sarcoglycanzeta-SG
Modification date2018052320180523
UniProtAcc

Q53T94

Q96LD1

Ensembl transtripts involved in fusion geneENST00000263663, ENST00000402170, 
ENST00000396242, 
ENST00000382080, 
ENST00000421524, 
Fusion gene scores* DoF score2 X 1 X 2=45 X 4 X 5=100
# samples 25
** MAII scorelog2(2/4*10)=2.32192809488736log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TAF1B [Title/Abstract] AND SGCZ [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTAF1B

GO:0001188

RNA polymerase I transcriptional preinitiation complex assembly

21921199


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVMESOTCGA-TS-A8AY-01ATAF1Bchr2

9985447

+SGCZchr8

14412435

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000263663ENST00000382080TAF1Bchr2

9985447

+SGCZchr8

14412435

-
In-frameENST00000263663ENST00000421524TAF1Bchr2

9985447

+SGCZchr8

14412435

-
3UTR-3CDSENST00000402170ENST00000382080TAF1Bchr2

9985447

+SGCZchr8

14412435

-
3UTR-3CDSENST00000402170ENST00000421524TAF1Bchr2

9985447

+SGCZchr8

14412435

-
5UTR-3CDSENST00000396242ENST00000382080TAF1Bchr2

9985447

+SGCZchr8

14412435

-
5UTR-3CDSENST00000396242ENST00000421524TAF1Bchr2

9985447

+SGCZchr8

14412435

-

Top

FusionProtFeatures for TAF1B_SGCZ


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAF1B

Q53T94

SGCZ

Q96LD1

Component of RNA polymerase I core factor complex thatacts as a GTF2B/TFIIB-like factor and plays a key role in multiplesteps during transcription initiation such as pre-initiationcomplex (PIC) assembly and postpolymerase recruitment events inpolymerase I (Pol I) transcription. Binds rDNA promoters and playsa role in Pol I recruitment as a component of the SL1/TIF-IBcomplex and, possibly, directly through its interaction with RRN3.{ECO:0000269|PubMed:15970593, ECO:0000269|PubMed:21921198,ECO:0000269|PubMed:21921199, ECO:0000269|PubMed:7491500,ECO:0000269|PubMed:7801123, ECO:0000269|PubMed:7801130}. Component of the sarcoglycan complex, a subcomplex ofthe dystrophin-glycoprotein complex which forms a link between theF-actin cytoskeleton and the extracellular matrix. May play a rolein the maintenance of striated muscle membrane stability (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000263663+2154_3939589Zinc fingerNote=RRN7-type
TgeneSGCZchr2:9985447chr8:14412435ENST00000382080-08252_26313313Compositional biasNote=Poly-Ser
TgeneSGCZchr2:9985447chr8:14412435ENST00000382080-0859_29913313Topological domainExtracellular
TgeneSGCZchr2:9985447chr8:14412435ENST00000382080-0838_5813313TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000263663+215262_37239589RegionNote=C-terminal cyclin fold
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000263663+21540_6839589RegionNote=B-reader
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000263663+21569_7339589RegionNote=B-linker
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000263663+21574_26139589RegionNote=N-terminal cyclin fold
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000396242+215262_372-208334RegionNote=C-terminal cyclin fold
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000396242+21540_68-208334RegionNote=B-reader
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000396242+21569_73-208334RegionNote=B-linker
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000396242+21574_261-208334RegionNote=N-terminal cyclin fold
HgeneTAF1Bchr2:9985447chr8:14412435ENST00000396242+2154_39-208334Zinc fingerNote=RRN7-type
TgeneSGCZchr2:9985447chr8:14412435ENST00000382080-081_3713313Topological domainCytoplasmic


Top

FusionGeneSequence for TAF1B_SGCZ


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAF1B_ENST00000263663_chr2_9985447_+_SGCZ_ENST00000382080_chr8_14412435_-_339aa
MDLEEAEEFKERCTQCAAVSWGLTDEGKTTCTSCHNVTEMTREQYILATQQNNLPRTENAQLYPVGITGWRKRCLYFFVLLLLVTMIVNL
AMTIWILKVMNFTVDGMGNLRVTKKGIRLEGISEFLLPLTVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFE
VRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQS

>In-frame_TAF1B_ENST00000263663_chr2_9985447_+_SGCZ_ENST00000421524_chr8_14412435_-_39aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAF1B_ENST00000263663_chr2_9985447_+_SGCZ_ENST00000382080_chr8_14412435_-_1017nt
ATGGACCTCGAGGAGGCGGAAGAGTTTAAAGAACGCTGTACTCAGTGTGCTGCTGTCTCATGGGGTCTTACTGATGAAGGCAAATATTAT
TGCACTTCTTGCCACAATGTTACAGAGATGACACGAGAACAATACATACTAGCAACCCAACAGAATAACCTGCCAAGGACTGAGAATGCA
CAACTTTACCCAGTGGGAATTTATGGATGGCGAAAGAGGTGCTTATACTTCTTTGTCCTTCTGCTGTTGGTTACCATGATAGTTAACTTA
GCCATGACAATATGGATATTGAAAGTTATGAATTTCACTGTGGATGGTATGGGAAATCTGAGAGTCACCAAGAAGGGAATCCGACTTGAA
GGTATATCTGAGTTTCTACTTCCATTGTATGTGAAAGAAATTCATTCTCGAAAGGATAGTCCGCTGGTCTTACAGTCTGACAGGAATGTC
ACAGTGAATGCAAGAAATCACATGGGGCAGTTAACCGGACAGCTGACCATAGGAGCTGATGCTGTGGAAGCTCAGTGTAAAAGATTTGAA
GTGAGAGCCAGTGAAGATGGCAGGGTGCTGTTTTCTGCAGATGAAGATGAGATTACCATTGGGGCTGAAAAGCTGAAAGTTACAGGCACT
GAAGGAGCCGTATTTGGGCACTCTGTGGAGACGCCGCACATCAGAGCAGAGCCATCCCAAGATCTCAGGCTTGAATCACCCACCAGATCC
TTGATCATGGAAGCTCCCCGTGGGGTCCAGGTGAGTGCTGCTGCAGGAGACTTCAAGGCCACCTGCAGGAAGGAGCTCCATCTGCAATCT
ACAGAAGGGGAGATATTTTTAAATGCAGAGACAATCAAGCTGGGAAATCTACCAACTGGCTCCTTCTCATCTTCTTCACCCAGCTCCTCA
AGTTCTCGACAGACAGTGTATGAACTCTGCGTCTGCCCCAATGGCAAACTTTACCTTTCTCCAGCAGGAGTAGGTTCCACTTGTCAGTCC

>In-frame_TAF1B_ENST00000263663_chr2_9985447_+_SGCZ_ENST00000421524_chr8_14412435_-_117nt
ATGGACCTCGAGGAGGCGGAAGAGTTTAAAGAACGCTGTACTCAGTGTGCTGCTGTCTCATGGGGTCTTACTGATGAAGGCAAATATTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAF1B_ENST00000263663_chr2_9985447_+_SGCZ_ENST00000382080_chr8_14412435_-_1784nt
GTCCGCGAGGGGTCTGCGAGCTTTGCGGAGCCTCGCCCCCGAGCGCGCGGTTTCCCTGCCGCGCAGGCGCACGGAATCCTAGGCGCGGAT
CTCGCGTTTCCGGCCGGAAGCTTCTCCAGCCTTTCCCGGAAGCTGCGCTCGCTACCCGGGTAACGGGTCCCGGCTGTGGAAGCTCCCGCG
GCGCCGCGATGGACCTCGAGGAGGCGGAAGAGTTTAAAGAACGCTGTACTCAGTGTGCTGCTGTCTCATGGGGTCTTACTGATGAAGGCA
AATATTATTGCACTTCTTGCCACAATGTTACAGAGATGACACGAGAACAATACATACTAGCAACCCAACAGAATAACCTGCCAAGGACTG
AGAATGCACAACTTTACCCAGTGGGAATTTATGGATGGCGAAAGAGGTGCTTATACTTCTTTGTCCTTCTGCTGTTGGTTACCATGATAG
TTAACTTAGCCATGACAATATGGATATTGAAAGTTATGAATTTCACTGTGGATGGTATGGGAAATCTGAGAGTCACCAAGAAGGGAATCC
GACTTGAAGGTATATCTGAGTTTCTACTTCCATTGTATGTGAAAGAAATTCATTCTCGAAAGGATAGTCCGCTGGTCTTACAGTCTGACA
GGAATGTCACAGTGAATGCAAGAAATCACATGGGGCAGTTAACCGGACAGCTGACCATAGGAGCTGATGCTGTGGAAGCTCAGTGTAAAA
GATTTGAAGTGAGAGCCAGTGAAGATGGCAGGGTGCTGTTTTCTGCAGATGAAGATGAGATTACCATTGGGGCTGAAAAGCTGAAAGTTA
CAGGCACTGAAGGAGCCGTATTTGGGCACTCTGTGGAGACGCCGCACATCAGAGCAGAGCCATCCCAAGATCTCAGGCTTGAATCACCCA
CCAGATCCTTGATCATGGAAGCTCCCCGTGGGGTCCAGGTGAGTGCTGCTGCAGGAGACTTCAAGGCCACCTGCAGGAAGGAGCTCCATC
TGCAATCTACAGAAGGGGAGATATTTTTAAATGCAGAGACAATCAAGCTGGGAAATCTACCAACTGGCTCCTTCTCATCTTCTTCACCCA
GCTCCTCAAGTTCTCGACAGACAGTGTATGAACTCTGCGTCTGCCCCAATGGCAAACTTTACCTTTCTCCAGCAGGAGTAGGTTCCACTT
GTCAGTCCAGTAGCAACATCTGCCTGTGGAGCTGAAGTGACTGATTTCTCCTCACACCAGAATAGCCTTTTGTTCCTGTCCGTCTGCTTC
ACAGTTCTGCTCGGTTTCCCTTGTGATCAGTCCAGAGCTTCTTCGAATGGTCCACAGAGCAACTTCCAGTGTGAGCAGGGATTCGCCACC
ACCTTCTCTTGTGATTTACTGTACTGCTCAACACAGAGGGTGTGATTGACACAGCAGTGGAAAAAGCGTCGTCAGCAGGAAAACTGGATC
ATGACTTTTGCTCGAAAGGGAGAATAACATAGGTGCCTTTGCTACGCGAAGTGAAGCACACAGTTTTAGATTTTTGCAGGACCTGGATAT
GAACTGCACATATATACATTACATAAATGAAATTCCCAGTATCCAATGGCAAGATGAAATGGTTAACCCTGTAAGAAAACTTATTCTACA
TTCTGAAAGCACAATTTTCCATTCATCTTTTTGGATGTAAACTTTTATCCCCGACTTTTAAAATTTTAAAGCATTATGTAATGCTTGCTT

>In-frame_TAF1B_ENST00000263663_chr2_9985447_+_SGCZ_ENST00000421524_chr8_14412435_-_1172nt
GTCCGCGAGGGGTCTGCGAGCTTTGCGGAGCCTCGCCCCCGAGCGCGCGGTTTCCCTGCCGCGCAGGCGCACGGAATCCTAGGCGCGGAT
CTCGCGTTTCCGGCCGGAAGCTTCTCCAGCCTTTCCCGGAAGCTGCGCTCGCTACCCGGGTAACGGGTCCCGGCTGTGGAAGCTCCCGCG
GCGCCGCGATGGACCTCGAGGAGGCGGAAGAGTTTAAAGAACGCTGTACTCAGTGTGCTGCTGTCTCATGGGGTCTTACTGATGAAGGCA
AATATTATTGCACTTCTTGCCACAATGTTACAGAGATGACACGAGAACAATACATACTAGCAACCCAACAGAATAACCTGCCAAGGACTG
AGAATGCACAACTTTACCCAGTGGGAATTTATGGATGGCGAAAGAGGTGCTTATACTTCTTTGTCCTTCTGCTGTTGGTTACCATGATAG
TTAACTTAGCCATGACAATATGGATATTGAAAGTTATGAATTTCACTGTGGATAGTCCGCTGGTCTTACAGTCTGACAGGAATGTCACAG
TGAATGCAAGAAATCACATGGGGCAGTTAACCGGACAGCTGACCATAGGAGCTGATGCTGTGGAAGCTCAGTGTAAAAGATTTGAAGTGA
GAGCCAGTGAAGATGGCAGGGTGCTGTTTTCTGCAGATGAAGATGAGATTACCATTGGGGCTGAAAAGCTGAAAGTTACAGGCACTGAAG
GAGCCGTATTTGGGCACTCTGTGGAGACGCCGCACATCAGAGCAGAGCCATCCCAAGATCTCAGGCTTGAATCACCCACCAGATCCTTGA
TCATGGAAGCTCCCCGTGGGGTCCAGGTGAGTGCTGCTGCAGGAGACTTCAAGGCCACCTGCAGGAAGGAGCTCCATCTGCAATCTACAG
AAGGGGAGATATTTTTAAATGCAGAGACAATCAAGCTGGGAAATCTACCAACTGGCTCCTTCTCATCTTCTTCACCCAGCTCCTCAAGTT
CTCGACAGACAGTGTATGAACTCTGCGTCTGCCCCAATGGCAAACTTTACCTTTCTCCAGCAGGAGTAGGTTCCACTTGTCAGTCCAGTA
GCAACATCTGCCTGTGGAGCTGAAGTGACTGATTTCTCCTCACACCAGAATAGCCTTTTGTTCCTGTCCGTCTGCTTCACAGTTCTGCTC


Top

FusionGenePPI for TAF1B_SGCZ


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAF1BTBP, TAF1A, TAF1C, RRN3, TP53, UBTF, EP300, TAF1D, HIST2H2BE, HIST2H2AC, HIST2H3C, HIST2H4A, THAP7, ESR1, TRB, RXRA, PGR, HIST1H3A, HIST1H4A, HDAC1, NEDD4, NEDD4L, APP, HIST3H3, NAPB, SRPK1, KAT2B, EAF1, NIFK, MPP1, OAZ1, POLR1A, FERMT3, NAF1, BRCA1, TRIM44, ZNF2, RRP8, MECP2SGCZSGCB, HARS, REEP5, GK, ACACA, GNPTAB, RANGRF, ATP5F1, C4orf32, SP3, RTN4, DAGLB, ATP5B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAF1B_SGCZ


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TAF1B_SGCZ


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSGCZC0236733Amphetamine-Related Disorders1CTD_human