FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37025

FusionGeneSummary for TAB2_PPP1R14C

check button Fusion gene summary
Fusion gene informationFusion gene name: TAB2_PPP1R14C
Fusion gene ID: 37025
HgeneTgene
Gene symbol

TAB2

PPP1R14C

Gene ID

23118

81706

Gene nameTGF-beta activated kinase 1 (MAP3K7) binding protein 2protein phosphatase 1 regulatory inhibitor subunit 14C
SynonymsCHTD2|MAP3K7IP2|TAB-2CPI17-like|KEPI|NY-BR-81
Cytomap

6q25.1

6q25.1

Type of geneprotein-codingprotein-coding
DescriptionTGF-beta-activated kinase 1 and MAP3K7-binding protein 2TAK1-binding protein 2mitogen-activated protein kinase kinase kinase 7-interacting protein 2protein phosphatase 1 regulatory subunit 14CPKC-potentiated PP1 inhibitory proteinkinase C-enhanced PP1 inhibitorkinase-enhanced PP1 inhibitorserologically defined breast cancer antigen NY-BR-81
Modification date2018052220180523
UniProtAcc

Q9NYJ8

Q8TAE6

Ensembl transtripts involved in fusion geneENST00000536230, ENST00000392282, 
ENST00000538427, ENST00000367456, 
ENST00000461481, ENST00000286332, 
ENST00000361131, 
Fusion gene scores* DoF score11 X 9 X 5=4953 X 2 X 3=18
# samples 103
** MAII scorelog2(10/495*10)=-2.30742852519225
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TAB2 [Title/Abstract] AND PPP1R14C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTAB2

GO:0045860

positive regulation of protein kinase activity

11460167


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-ZF-AA51-01ATAB2chr6

149718900

+PPP1R14Cchr6

150535880

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000536230ENST00000361131TAB2chr6

149718900

+PPP1R14Cchr6

150535880

+
intron-3CDSENST00000392282ENST00000361131TAB2chr6

149718900

+PPP1R14Cchr6

150535880

+
In-frameENST00000538427ENST00000361131TAB2chr6

149718900

+PPP1R14Cchr6

150535880

+
In-frameENST00000367456ENST00000361131TAB2chr6

149718900

+PPP1R14Cchr6

150535880

+
intron-3CDSENST00000461481ENST00000361131TAB2chr6

149718900

+PPP1R14Cchr6

150535880

+
In-frameENST00000286332ENST00000361131TAB2chr6

149718900

+PPP1R14Cchr6

150535880

+

Top

FusionProtFeatures for TAB2_PPP1R14C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAB2

Q9NYJ8

PPP1R14C

Q8TAE6

Adapter linking MAP3K7/TAK1 and TRAF6. Promotes MAP3K7activation in the IL1 signaling pathway. The binding of 'Lys-63'-linked polyubiquitin chains to TAB2 promotes autophosphorylationof MAP3K7 at 'Thr-187'. Involved in heart development.{ECO:0000269|PubMed:10882101, ECO:0000269|PubMed:11460167,ECO:0000269|PubMed:20493459}. Inhibitor of the PP1 regulatory subunit PPP1CA.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAB2chr6:149718900chr6:150535880ENST00000286332+368_51588694DomainCUE
HgeneTAB2chr6:149718900chr6:150535880ENST00000367456+588_51588694DomainCUE
HgeneTAB2chr6:149718900chr6:150535880ENST00000538427+588_51588694DomainCUE
TgenePPP1R14Cchr6:149718900chr6:150535880ENST00000361131+04102_105102166Compositional biasNote=Poly-Glu

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAB2chr6:149718900chr6:150535880ENST00000286332+36532_619588694Coiled coilOntology_term=ECO:0000255
HgeneTAB2chr6:149718900chr6:150535880ENST00000367456+58532_619588694Coiled coilOntology_term=ECO:0000255
HgeneTAB2chr6:149718900chr6:150535880ENST00000392282+14532_619-60537Coiled coilOntology_term=ECO:0000255
HgeneTAB2chr6:149718900chr6:150535880ENST00000538427+58532_619588694Coiled coilOntology_term=ECO:0000255
HgeneTAB2chr6:149718900chr6:150535880ENST00000392282+148_51-60537DomainCUE
HgeneTAB2chr6:149718900chr6:150535880ENST00000286332+36663_693588694Zinc fingerRanBP2-type
HgeneTAB2chr6:149718900chr6:150535880ENST00000367456+58663_693588694Zinc fingerRanBP2-type
HgeneTAB2chr6:149718900chr6:150535880ENST00000392282+14663_693-60537Zinc fingerRanBP2-type
HgeneTAB2chr6:149718900chr6:150535880ENST00000538427+58663_693588694Zinc fingerRanBP2-type
TgenePPP1R14Cchr6:149718900chr6:150535880ENST00000361131+0451_56102166Compositional biasNote=Poly-Ala
TgenePPP1R14Cchr6:149718900chr6:150535880ENST00000361131+0458_64102166Compositional biasNote=Poly-Gln


Top

FusionGeneSequence for TAB2_PPP1R14C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAB2_ENST00000536230_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_620aa
MQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELF
QQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNS
IYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSSG
SSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVYIAASPPNTDELMSRSQPKVYISAN
AATGDEQVMRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVS
PTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNL

>In-frame_TAB2_ENST00000538427_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_652aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHH
GREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSS
QQPNQQGHQTSHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATS
PRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFI

>In-frame_TAB2_ENST00000367456_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_652aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHH
GREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSS
QQPNQQGHQTSHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATS
PRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFI

>In-frame_TAB2_ENST00000286332_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_652aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHH
GREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSS
QQPNQQGHQTSHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATS
PRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAB2_ENST00000536230_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_1860nt
ATGCAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCAGGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTGAATTTT
TCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCTCAACTTGGACTTGCAATCACAGAACATTTACCACCATGGAAGA
GAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAGTGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAACTATTT
CAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAATGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAATTCAGCA
CCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTCTCAACAAACTCCCAGATTTAATCCCATTATGGTAACTTTAGCC
CCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACATGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGAAATTCT
ATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACAGACACAACAGCATTCTGGCTGGGTATCTCAGTTTAATCCCATG
AACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTACTTGTCCTGCATCTAATCCTCTGTCACATACCTCATCTCAACAG
CCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAGTTCACCTACTACTTCACAACCACCAACCATTCATTCATCTGGT
AGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTCAACAGGACCTCGAAAAAACCAGATTGAAATCAAACTTGAACCC
CCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAACCTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTAAACAGA
AATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGAGCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCAGCGAAT
GCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTTCATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGGAACATG
TCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCCCAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCTCCTCGA
GTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGTCTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTGGTGTCC
CCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGTAGAAACCGAGAATATTCAGCACCTCACGGACCCTACATTAGCA
CATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGATGATGCTGCCTACACACAAGCTCTTTTGGTACACCAGAAGGCC
AGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCTGGATAAATTAAAATCTGAGGTTAATGAAATGGAAAATAATCTA
ACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTCCGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGATGATCTT
CTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGCTCTTGTAGACTGCTACAAACCAACAGAGGAATTTATCAAAGAG

>In-frame_TAB2_ENST00000538427_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_1956nt
ATGGCCCAAGGAAGCCACCAAATTGATTTTCAGGTTTTACATGACCTGCGACAAAAATTCCCTGAAGTACCTGAAGTTGTTGTATCCAGG
TGCATGTTACAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCAGGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTG
AATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCTCAACTTGGACTTGCAATCACAGAACATTTACCACCAT
GGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAGTGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAA
CTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAATGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAAT
TCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTCTCAACAAACTCCCAGATTTAATCCCATTATGGTAACT
TTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACATGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGA
AATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACAGACACAACAGCATTCTGGCTGGGTATCTCAGTTTAAT
CCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTACTTGTCCTGCATCTAATCCTCTGTCACATACCTCATCT
CAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAGTTCACCTACTACTTCACAACCACCAACCATTCATTCA
TCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTCAACAGGACCTCGAAAAAACCAGATTGAAATCAAACTT
GAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAACCTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTA
AACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGAGCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCA
GCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTTCATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGG
AACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCCCAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCT
CCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGTCTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTG
GTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGTAGAAACCGAGAATATTCAGCACCTCACGGACCCTACA
TTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGATGATGCTGCCTACACACAAGCTCTTTTGGTACACCAG
AAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCTGGATAAATTAAAATCTGAGGTTAATGAAATGGAAAAT
AATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTCCGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGAT
GATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGCTCTTGTAGACTGCTACAAACCAACAGAGGAATTTATC

>In-frame_TAB2_ENST00000367456_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_1956nt
ATGGCCCAAGGAAGCCACCAAATTGATTTTCAGGTTTTACATGACCTGCGACAAAAATTCCCTGAAGTACCTGAAGTTGTTGTATCCAGG
TGCATGTTACAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCAGGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTG
AATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCTCAACTTGGACTTGCAATCACAGAACATTTACCACCAT
GGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAGTGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAA
CTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAATGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAAT
TCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTCTCAACAAACTCCCAGATTTAATCCCATTATGGTAACT
TTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACATGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGA
AATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACAGACACAACAGCATTCTGGCTGGGTATCTCAGTTTAAT
CCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTACTTGTCCTGCATCTAATCCTCTGTCACATACCTCATCT
CAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAGTTCACCTACTACTTCACAACCACCAACCATTCATTCA
TCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTCAACAGGACCTCGAAAAAACCAGATTGAAATCAAACTT
GAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAACCTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTA
AACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGAGCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCA
GCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTTCATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGG
AACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCCCAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCT
CCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGTCTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTG
GTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGTAGAAACCGAGAATATTCAGCACCTCACGGACCCTACA
TTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGATGATGCTGCCTACACACAAGCTCTTTTGGTACACCAG
AAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCTGGATAAATTAAAATCTGAGGTTAATGAAATGGAAAAT
AATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTCCGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGAT
GATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGCTCTTGTAGACTGCTACAAACCAACAGAGGAATTTATC

>In-frame_TAB2_ENST00000286332_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_1956nt
ATGGCCCAAGGAAGCCACCAAATTGATTTTCAGGTTTTACATGACCTGCGACAAAAATTCCCTGAAGTACCTGAAGTTGTTGTATCCAGG
TGCATGTTACAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCAGGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTG
AATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCTCAACTTGGACTTGCAATCACAGAACATTTACCACCAT
GGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAGTGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAA
CTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAATGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAAT
TCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTCTCAACAAACTCCCAGATTTAATCCCATTATGGTAACT
TTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACATGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGA
AATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACAGACACAACAGCATTCTGGCTGGGTATCTCAGTTTAAT
CCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTACTTGTCCTGCATCTAATCCTCTGTCACATACCTCATCT
CAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAGTTCACCTACTACTTCACAACCACCAACCATTCATTCA
TCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTCAACAGGACCTCGAAAAAACCAGATTGAAATCAAACTT
GAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAACCTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTA
AACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGAGCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCA
GCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTTCATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGG
AACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCCCAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCT
CCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGTCTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTG
GTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGTAGAAACCGAGAATATTCAGCACCTCACGGACCCTACA
TTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGATGATGCTGCCTACACACAAGCTCTTTTGGTACACCAG
AAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCTGGATAAATTAAAATCTGAGGTTAATGAAATGGAAAAT
AATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTCCGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGAT
GATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGCTCTTGTAGACTGCTACAAACCAACAGAGGAATTTATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAB2_ENST00000536230_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_3527nt
AGTGAGGTGAACTCCTTCAGGGCCACAGGCTGTAAAGATCTAAACACCATCTGATCCAGTTTCAATATGACTGCCTGGATGAAGAAGGAT
TTGAGACTAAGTTTATTCCTCCAAAGCAAACCAACTGAGAATGCAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCAGGA
GAGTACAAGATATCTTTATGGTGAAGGAGACTTGAATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCTCAA
CTTGGACTTGCAATCACAGAACATTTACCACCATGGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAGTGA
TGGACAACTTCAAGGTGGCCAGTCCAATAGTGAACTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAATGT
TTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAATTCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTCTCA
ACAAACTCCCAGATTTAATCCCATTATGGTAACTTTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACATGG
TGTACCTCCACCTGTACTTAACAGTCCACAGGGAAATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACAGAC
ACAACAGCATTCTGGCTGGGTATCTCAGTTTAATCCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTACTTG
TCCTGCATCTAATCCTCTGTCACATACCTCATCTCAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAGTTC
ACCTACTACTTCACAACCACCAACCATTCATTCATCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTCAAC
AGGACCTCGAAAAAACCAGATTGAAATCAAACTTGAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAACCTC
CAGCACTTCCTCTTCAGTCAATAGCCAGACCTTAAACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGAGCT
GATGTCCCGTAGTCAACCTAAGGTCTATATTTCAGCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTTCAT
ATCCACAAACTCTGGAGCATCTGCTGCCTCCAGGAACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCCCAA
AAGTCGAGCAATAGGCAATAACTCTGCAACCTCTCCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGTCTC
TCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTGGTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGTAGA
AACCGAGAATATTCAGCACCTCACGGACCCTACATTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGATGA
TGCTGCCTACACACAAGCTCTTTTGGTACACCAGAAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCTGGA
TAAATTAAAATCTGAGGTTAATGAAATGGAAAATAATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTCCGA
AGAAGAAATGCCAGAGGTAGAAATTGACATTGATGATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGCTCT
TGTAGACTGCTACAAACCAACAGAGGAATTTATCAAAGAGCTGCTTTCTCGGATAAGAGGCATGAGGAAACTGAGCCCTCCGCAGAAGAA
GAGTGTATGATTCTGGAACAGGGTGAAACTCTCCCAGAGACGAAGAAAGAGTCCTGGGATTTGTACTTCATGAAGACTTTTGTGAAAGAA
TAGGTGTCCTTATGAACAACGTTTTTGTTTTTTTTTTTTTCTTTTTTGGTGTGAAGGTGGGGGGGTCTATTAGACATTTATTCAAGAGCG
TTCTTTTTTTGGTTTTAAAGGTTTTTGTTAATGTAATATTTTAATAGCAAAGATATCATGACTCTAGCCACAGCCTAACCAAGGATTATC
AAAGGAGGTGGACACTCAAGGAAGGGCCACGCCAGGCTGCGTTTCCTGCAAGGACTCAGATGTTCAGTACCTTATGATACAGGGAAGATA
GTTTTCTTACAAGTAGTTTGGTAATATTTTTTTTCTTAAGTTGTACATTTGACTCAGCTGTCAAATTTCTCACACTTGTATATATCTACA
CACAACTAAGTTAAAATGTTGATGTGAGTTTTATTTCACATGGATGGAATAAACTTGTGGTTGTCCTTTAACTGGAGGTCCCAGCACATG
TGTTTTCAAGAGGCCACTAGGCATTCTTCACTGAGTGCTGCTGACTTCAACGTTCACTTTATGCACCAAAGTGAAAGAATTCAGTGTATC
CGTTATTTTAATGCACTACACCACAGAAATGTTAAGTTGGTCAAGGGCTTAATTTATGGAATTTCTATTATTTCATTGGTTGGGATGCTT
TGCCAGGTCATGTGCTTATTGTCTCATTTTGTAGTCTTTTAAAGTTGTATGAACCCTTAATTTGAAGAACTAACTTGATTTCTAGAGAAA
TATCCACACTATCTCAGTGGTATTTTGCATTGGAAAAAGGAAGCACTGTGTAGCAGTGAATTGTCTGCTTTCCACCGAGTACTGTGTTTA
TTCTCTCTCCAGGAAAGCAGATCAAAAGAAAGTTAGCAGATCGAGTGTCTTCTTCCTTAGAAATAGGTTCTGGTAGCTTCTGTGCCTGGG
TAGTATCAGACCAGTGGGAGTAAACCGAGTGTTAAGTGTCAAGGTGAGAAAGCCTCACATTCTCTCAAGACAGTTGCTCTAGGAGCTGAG
TTGCTGGTTTGGAAGTGTGGAGATTGCATTTCTGGCTTCTCTCAATGGCTTGTGTTGAGGACTCTGGGTGCTCCTGGCCCTAATTGTGCA
CCCTGATCCCCGTGCTTGGAGCTAGGCCTGGTGGCGTGCTCTAGCCCTCTCAGTTACCAGCTCTTTGGAGAAGGATCAAAATTCAGATGG
AATGTGGGATGGGTAATAGGTGAGAGTAGAAACCCTTCCCTCCAGGAGGCCCCCGCTGACTCCCACAGAAACCCACCTACCATAAGATGT
CTTCAGGTGGCCTTGTCCAAGGATGGGGGTCAGGCATTTTATATCAAGGGTGCTCTGAACATATTTTATTTTTTAAAAAAACTATGTTTG
TGAATTTTGCGTATACTGGCAAGCTTTTGAAAATGTATTTAATTTTGTATTGTTTACCAATGATTTATTTACAAGATATTTACTCAAATA

>In-frame_TAB2_ENST00000538427_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_3899nt
ATCGAGCGCCTAGGAGAGCCCCGGGTGGGGGAGGGCGCAAGGGGCTCGGGAGGGCCCCTCCCTGCGTCGGCGCCCCTGACCCGCCCCCAG
GCATGTGTGAGGTGGGGGCGGGGGAGGAAAAATCTCCTTTTGGCTCTAGTTTACTCTAGTTTCTCTTCTGCTTTCAAGGCTCCAGACCCA
GTTCCTGGACCTGCCCTGGAAAAGAAGTATCCCGTAGAGATGAGCTCACTGCAGTTACTTAATTAACAATTTGTAAGCTGCAAAAATGGC
AATGGGCCAACCAAGAACAGCTACAATTTGAATTTTTCTATTTCCAGAAAATGCTTGGACAGAAGAGATGAGTACTATTTCCACTAAGGC
CTAGAATTGCCTACTGTACAAATAGTCCTGATCAGGCAATATACGAATGGCCCAAGGAAGCCACCAAATTGATTTTCAGGTTTTACATGA
CCTGCGACAAAAATTCCCTGAAGTACCTGAAGTTGTTGTATCCAGGTGCATGTTACAGAATAATAATAACCTGGATGCCTGCTGTGCTGT
TCTCTCTCAGGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTGAATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACAT
GACTTCTCTCAACTTGGACTTGCAATCACAGAACATTTACCACCATGGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCA
CAGCATTAGTGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAACTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCA
AGGCTTTAATGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAATTCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATC
TAGCCTTTCTCAACAAACTCCCAGATTTAATCCCATTATGGTAACTTTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTT
GCACATACATGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGAAATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTAC
AACTCGACAGACACAACAGCATTCTGGCTGGGTATCTCAGTTTAATCCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCC
CTGGACTACTTGTCCTGCATCTAATCCTCTGTCACATACCTCATCTCAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACAT
GCCAATCAGTTCACCTACTACTTCACAACCACCAACCATTCATTCATCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCA
GAATATTTCAACAGGACCTCGAAAAAACCAGATTGAAATCAAACTTGAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGG
ACCTCGAACCTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTAAACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAA
TACGGATGAGCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCAGCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCC
CACACTCTTCATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGGAACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCA
CCATCCTCCCAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCTCCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAA
AATTACAGTCTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTGGTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGA
TCATTATGTAGAAACCGAGAATATTCAGCACCTCACGGACCCTACATTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTAT
GGGATCTGATGATGCTGCCTACACACAAGCTCTTTTGGTACACCAGAAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAA
GAAAAAGCTGGATAAATTAAAATCTGAGGTTAATGAAATGGAAAATAATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCA
GATACCTTCCGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGATGATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATT
ACAGGAAGCTCTTGTAGACTGCTACAAACCAACAGAGGAATTTATCAAAGAGCTGCTTTCTCGGATAAGAGGCATGAGGAAACTGAGCCC
TCCGCAGAAGAAGAGTGTATGATTCTGGAACAGGGTGAAACTCTCCCAGAGACGAAGAAAGAGTCCTGGGATTTGTACTTCATGAAGACT
TTTGTGAAAGAATAGGTGTCCTTATGAACAACGTTTTTGTTTTTTTTTTTTTCTTTTTTGGTGTGAAGGTGGGGGGGTCTATTAGACATT
TATTCAAGAGCGTTCTTTTTTTGGTTTTAAAGGTTTTTGTTAATGTAATATTTTAATAGCAAAGATATCATGACTCTAGCCACAGCCTAA
CCAAGGATTATCAAAGGAGGTGGACACTCAAGGAAGGGCCACGCCAGGCTGCGTTTCCTGCAAGGACTCAGATGTTCAGTACCTTATGAT
ACAGGGAAGATAGTTTTCTTACAAGTAGTTTGGTAATATTTTTTTTCTTAAGTTGTACATTTGACTCAGCTGTCAAATTTCTCACACTTG
TATATATCTACACACAACTAAGTTAAAATGTTGATGTGAGTTTTATTTCACATGGATGGAATAAACTTGTGGTTGTCCTTTAACTGGAGG
TCCCAGCACATGTGTTTTCAAGAGGCCACTAGGCATTCTTCACTGAGTGCTGCTGACTTCAACGTTCACTTTATGCACCAAAGTGAAAGA
ATTCAGTGTATCCGTTATTTTAATGCACTACACCACAGAAATGTTAAGTTGGTCAAGGGCTTAATTTATGGAATTTCTATTATTTCATTG
GTTGGGATGCTTTGCCAGGTCATGTGCTTATTGTCTCATTTTGTAGTCTTTTAAAGTTGTATGAACCCTTAATTTGAAGAACTAACTTGA
TTTCTAGAGAAATATCCACACTATCTCAGTGGTATTTTGCATTGGAAAAAGGAAGCACTGTGTAGCAGTGAATTGTCTGCTTTCCACCGA
GTACTGTGTTTATTCTCTCTCCAGGAAAGCAGATCAAAAGAAAGTTAGCAGATCGAGTGTCTTCTTCCTTAGAAATAGGTTCTGGTAGCT
TCTGTGCCTGGGTAGTATCAGACCAGTGGGAGTAAACCGAGTGTTAAGTGTCAAGGTGAGAAAGCCTCACATTCTCTCAAGACAGTTGCT
CTAGGAGCTGAGTTGCTGGTTTGGAAGTGTGGAGATTGCATTTCTGGCTTCTCTCAATGGCTTGTGTTGAGGACTCTGGGTGCTCCTGGC
CCTAATTGTGCACCCTGATCCCCGTGCTTGGAGCTAGGCCTGGTGGCGTGCTCTAGCCCTCTCAGTTACCAGCTCTTTGGAGAAGGATCA
AAATTCAGATGGAATGTGGGATGGGTAATAGGTGAGAGTAGAAACCCTTCCCTCCAGGAGGCCCCCGCTGACTCCCACAGAAACCCACCT
ACCATAAGATGTCTTCAGGTGGCCTTGTCCAAGGATGGGGGTCAGGCATTTTATATCAAGGGTGCTCTGAACATATTTTATTTTTTAAAA
AAACTATGTTTGTGAATTTTGCGTATACTGGCAAGCTTTTGAAAATGTATTTAATTTTGTATTGTTTACCAATGATTTATTTACAAGATA

>In-frame_TAB2_ENST00000367456_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_4070nt
GAAAAGTTTTAGGCAGCTAGGAATGTGGAGATGTGGGTAGTGGTGGCTGCCAAGCACAGGAAAATGATCATGCTGAACTGTACAAAGGAG
ATTGTCTCTGAACCTTTTCATAGGTTCTGACACTCTATATATGTCATCTTATTTAAAACCCTCTGTATTAAAATGATAAGGATTTGGAGA
CATTGAAATTATATAGAATTTAAATGTATGCATGTTCATATGTTTTTGCCTCTGGCTCATATTTCCAGAATACTTAACAGTATTTTAACA
TTTTGTTTCTTATGATTCTGGTCCTAAAAAATCAAGGACGCTGCTTACTCAGAAAGCTAAAAAACCTGAGCTCCAGACCCAGTTCCTGGA
CCTGCCCTGGAAAAGAAGTATCCCGTAGAGATGAGCTCACTGCAGTTACTTAATTAACAATTTGTAAGCTGCAAAAATGGCAATGGGCCA
ACCAAGAACAGCTACAATTTGAATTTTTCTATTTCCAGAAAATGCTTGGACAGAAGAGATGAGTACTATTTCCACTAAGGCCTAGAATTG
CCTACTGTACAAATAGTCCTGATCAGGCAATATACGAATGGCCCAAGGAAGCCACCAAATTGATTTTCAGGTTTTACATGACCTGCGACA
AAAATTCCCTGAAGTACCTGAAGTTGTTGTATCCAGGTGCATGTTACAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCA
GGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTGAATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCT
CAACTTGGACTTGCAATCACAGAACATTTACCACCATGGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAG
TGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAACTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAA
TGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAATTCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTC
TCAACAAACTCCCAGATTTAATCCCATTATGGTAACTTTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACA
TGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGAAATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACA
GACACAACAGCATTCTGGCTGGGTATCTCAGTTTAATCCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTAC
TTGTCCTGCATCTAATCCTCTGTCACATACCTCATCTCAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAG
TTCACCTACTACTTCACAACCACCAACCATTCATTCATCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTC
AACAGGACCTCGAAAAAACCAGATTGAAATCAAACTTGAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAAC
CTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTAAACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGA
GCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCAGCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTT
CATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGGAACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCC
CAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCTCCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGT
CTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTGGTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGT
AGAAACCGAGAATATTCAGCACCTCACGGACCCTACATTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGA
TGATGCTGCCTACACACAAGCTCTTTTGGTACACCAGAAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCT
GGATAAATTAAAATCTGAGGTTAATGAAATGGAAAATAATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTC
CGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGATGATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGC
TCTTGTAGACTGCTACAAACCAACAGAGGAATTTATCAAAGAGCTGCTTTCTCGGATAAGAGGCATGAGGAAACTGAGCCCTCCGCAGAA
GAAGAGTGTATGATTCTGGAACAGGGTGAAACTCTCCCAGAGACGAAGAAAGAGTCCTGGGATTTGTACTTCATGAAGACTTTTGTGAAA
GAATAGGTGTCCTTATGAACAACGTTTTTGTTTTTTTTTTTTTCTTTTTTGGTGTGAAGGTGGGGGGGTCTATTAGACATTTATTCAAGA
GCGTTCTTTTTTTGGTTTTAAAGGTTTTTGTTAATGTAATATTTTAATAGCAAAGATATCATGACTCTAGCCACAGCCTAACCAAGGATT
ATCAAAGGAGGTGGACACTCAAGGAAGGGCCACGCCAGGCTGCGTTTCCTGCAAGGACTCAGATGTTCAGTACCTTATGATACAGGGAAG
ATAGTTTTCTTACAAGTAGTTTGGTAATATTTTTTTTCTTAAGTTGTACATTTGACTCAGCTGTCAAATTTCTCACACTTGTATATATCT
ACACACAACTAAGTTAAAATGTTGATGTGAGTTTTATTTCACATGGATGGAATAAACTTGTGGTTGTCCTTTAACTGGAGGTCCCAGCAC
ATGTGTTTTCAAGAGGCCACTAGGCATTCTTCACTGAGTGCTGCTGACTTCAACGTTCACTTTATGCACCAAAGTGAAAGAATTCAGTGT
ATCCGTTATTTTAATGCACTACACCACAGAAATGTTAAGTTGGTCAAGGGCTTAATTTATGGAATTTCTATTATTTCATTGGTTGGGATG
CTTTGCCAGGTCATGTGCTTATTGTCTCATTTTGTAGTCTTTTAAAGTTGTATGAACCCTTAATTTGAAGAACTAACTTGATTTCTAGAG
AAATATCCACACTATCTCAGTGGTATTTTGCATTGGAAAAAGGAAGCACTGTGTAGCAGTGAATTGTCTGCTTTCCACCGAGTACTGTGT
TTATTCTCTCTCCAGGAAAGCAGATCAAAAGAAAGTTAGCAGATCGAGTGTCTTCTTCCTTAGAAATAGGTTCTGGTAGCTTCTGTGCCT
GGGTAGTATCAGACCAGTGGGAGTAAACCGAGTGTTAAGTGTCAAGGTGAGAAAGCCTCACATTCTCTCAAGACAGTTGCTCTAGGAGCT
GAGTTGCTGGTTTGGAAGTGTGGAGATTGCATTTCTGGCTTCTCTCAATGGCTTGTGTTGAGGACTCTGGGTGCTCCTGGCCCTAATTGT
GCACCCTGATCCCCGTGCTTGGAGCTAGGCCTGGTGGCGTGCTCTAGCCCTCTCAGTTACCAGCTCTTTGGAGAAGGATCAAAATTCAGA
TGGAATGTGGGATGGGTAATAGGTGAGAGTAGAAACCCTTCCCTCCAGGAGGCCCCCGCTGACTCCCACAGAAACCCACCTACCATAAGA
TGTCTTCAGGTGGCCTTGTCCAAGGATGGGGGTCAGGCATTTTATATCAAGGGTGCTCTGAACATATTTTATTTTTTAAAAAAACTATGT
TTGTGAATTTTGCGTATACTGGCAAGCTTTTGAAAATGTATTTAATTTTGTATTGTTTACCAATGATTTATTTACAAGATATTTACTCAA

>In-frame_TAB2_ENST00000286332_chr6_149718900_+_PPP1R14C_ENST00000361131_chr6_150535880_+_3583nt
GAAAATGCTTGGACAGAAGAGATGAGTACTATTTCCACTAAGGCCTAGAATTGCCTACTGTACAAATAGTCCTGATCAGGCAATATACGA
ATGGCCCAAGGAAGCCACCAAATTGATTTTCAGGTTTTACATGACCTGCGACAAAAATTCCCTGAAGTACCTGAAGTTGTTGTATCCAGG
TGCATGTTACAGAATAATAATAACCTGGATGCCTGCTGTGCTGTTCTCTCTCAGGAGAGTACAAGATATCTTTATGGTGAAGGAGACTTG
AATTTTTCAGATGATTCTGGAATTTCTGGTCTACGCAATCACATGACTTCTCTCAACTTGGACTTGCAATCACAGAACATTTACCACCAT
GGAAGAGAAGGAAGTAGGATGAATGGAAGTAGGACTCTAACGCACAGCATTAGTGATGGACAACTTCAAGGTGGCCAGTCCAATAGTGAA
CTATTTCAGCAGGAGCCACAGACAGCACCAGCTCAAGTTCCTCAAGGCTTTAATGTTTTTGGAATGTCCAGTTCCTCTGGTGCTTCAAAT
TCAGCACCACATCTTGGATTTCACTTAGGCAGCAAAGGAACATCTAGCCTTTCTCAACAAACTCCCAGATTTAATCCCATTATGGTAACT
TTAGCCCCAAATATCCAGACTGGTCGTAATACTCCTACATCTTTGCACATACATGGTGTACCTCCACCTGTACTTAACAGTCCACAGGGA
AATTCTATCTATATTAGGCCTTACATTACAACTCCTGGTGGTACAACTCGACAGACACAACAGCATTCTGGCTGGGTATCTCAGTTTAAT
CCCATGAACCCTCAGCAAGTTTATCAGCCTTCACAGCCTGGTCCCTGGACTACTTGTCCTGCATCTAATCCTCTGTCACATACCTCATCT
CAACAGCCAAATCAGCAAGGCCACCAGACCTCTCATGTCTACATGCCAATCAGTTCACCTACTACTTCACAACCACCAACCATTCATTCA
TCTGGTAGCTCACAGTCTTCTGCCCATAGCCAATATAACATTCAGAATATTTCAACAGGACCTCGAAAAAACCAGATTGAAATCAAACTT
GAACCCCCACAAAGAAATAATTCTTCAAAACTGCGTTCTTCTGGACCTCGAACCTCCAGCACTTCCTCTTCAGTCAATAGCCAGACCTTA
AACAGAAATCAGCCCACTGTTTACATAGCTGCCAGCCCCCCAAATACGGATGAGCTGATGTCCCGTAGTCAACCTAAGGTCTATATTTCA
GCGAATGCTGCCACAGGAGATGAACAGGTCATGCGGAATCAGCCCACACTCTTCATATCCACAAACTCTGGAGCATCTGCTGCCTCCAGG
AACATGTCTGGGCAAGTGAGCATGGGTCCTGCCTTTATTCATCACCATCCTCCCAAAAGTCGAGCAATAGGCAATAACTCTGCAACCTCT
CCTCGAGTGGTAGTCACTCAGCCCAATACGAAATACACTTTCAAAATTACAGTCTCTCCCAATAAGCCCCCTGCAGTTTCACCAGGGGTG
GTGTCCCCTACCTTTGAACTTACAAATCTTCTTAATCATCCTGATCATTATGTAGAAACCGAGAATATTCAGCACCTCACGGACCCTACA
TTAGCACATGTGGATAGAATAAGTGAAACACGGAAACTGAGTATGGGATCTGATGATGCTGCCTACACACAAGCTCTTTTGGTACACCAG
AAGGCCAGAATGGAACGACTTCAAAGAGAACTTGAGATTCAAAAGAAAAAGCTGGATAAATTAAAATCTGAGGTTAATGAAATGGAAAAT
AATCTAACTCGAAGGCGCCTGAAAAGATCAAATTCTATATCCCAGATACCTTCCGAAGAAGAAATGCCAGAGGTAGAAATTGACATTGAT
GATCTTCTTGATGCAGACAGTGATGAAGAGAGAGCTTCAAAATTACAGGAAGCTCTTGTAGACTGCTACAAACCAACAGAGGAATTTATC
AAAGAGCTGCTTTCTCGGATAAGAGGCATGAGGAAACTGAGCCCTCCGCAGAAGAAGAGTGTATGATTCTGGAACAGGGTGAAACTCTCC
CAGAGACGAAGAAAGAGTCCTGGGATTTGTACTTCATGAAGACTTTTGTGAAAGAATAGGTGTCCTTATGAACAACGTTTTTGTTTTTTT
TTTTTTCTTTTTTGGTGTGAAGGTGGGGGGGTCTATTAGACATTTATTCAAGAGCGTTCTTTTTTTGGTTTTAAAGGTTTTTGTTAATGT
AATATTTTAATAGCAAAGATATCATGACTCTAGCCACAGCCTAACCAAGGATTATCAAAGGAGGTGGACACTCAAGGAAGGGCCACGCCA
GGCTGCGTTTCCTGCAAGGACTCAGATGTTCAGTACCTTATGATACAGGGAAGATAGTTTTCTTACAAGTAGTTTGGTAATATTTTTTTT
CTTAAGTTGTACATTTGACTCAGCTGTCAAATTTCTCACACTTGTATATATCTACACACAACTAAGTTAAAATGTTGATGTGAGTTTTAT
TTCACATGGATGGAATAAACTTGTGGTTGTCCTTTAACTGGAGGTCCCAGCACATGTGTTTTCAAGAGGCCACTAGGCATTCTTCACTGA
GTGCTGCTGACTTCAACGTTCACTTTATGCACCAAAGTGAAAGAATTCAGTGTATCCGTTATTTTAATGCACTACACCACAGAAATGTTA
AGTTGGTCAAGGGCTTAATTTATGGAATTTCTATTATTTCATTGGTTGGGATGCTTTGCCAGGTCATGTGCTTATTGTCTCATTTTGTAG
TCTTTTAAAGTTGTATGAACCCTTAATTTGAAGAACTAACTTGATTTCTAGAGAAATATCCACACTATCTCAGTGGTATTTTGCATTGGA
AAAAGGAAGCACTGTGTAGCAGTGAATTGTCTGCTTTCCACCGAGTACTGTGTTTATTCTCTCTCCAGGAAAGCAGATCAAAAGAAAGTT
AGCAGATCGAGTGTCTTCTTCCTTAGAAATAGGTTCTGGTAGCTTCTGTGCCTGGGTAGTATCAGACCAGTGGGAGTAAACCGAGTGTTA
AGTGTCAAGGTGAGAAAGCCTCACATTCTCTCAAGACAGTTGCTCTAGGAGCTGAGTTGCTGGTTTGGAAGTGTGGAGATTGCATTTCTG
GCTTCTCTCAATGGCTTGTGTTGAGGACTCTGGGTGCTCCTGGCCCTAATTGTGCACCCTGATCCCCGTGCTTGGAGCTAGGCCTGGTGG
CGTGCTCTAGCCCTCTCAGTTACCAGCTCTTTGGAGAAGGATCAAAATTCAGATGGAATGTGGGATGGGTAATAGGTGAGAGTAGAAACC
CTTCCCTCCAGGAGGCCCCCGCTGACTCCCACAGAAACCCACCTACCATAAGATGTCTTCAGGTGGCCTTGTCCAAGGATGGGGGTCAGG
CATTTTATATCAAGGGTGCTCTGAACATATTTTATTTTTTAAAAAAACTATGTTTGTGAATTTTGCGTATACTGGCAAGCTTTTGAAAAT


Top

FusionGenePPI for TAB2_PPP1R14C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAB2CS, TAB1, MAP3K7, TAB3, TAB2, TRAF6, NCOR1, HDAC3, HDAC1, HDAC5, TBL1X, NFKB1, TNFRSF11A, XIAP, TRAF2, NUMBL, RIPK1, IRAK1, TNF, UBC, RIPK2, PPP6C, TRAF3IP1, TIRAP, CHUK, BNIP3P6, TLR3, ERBB4, BECN1, ESR1, RBCK1, TANK, PDLIM7, NR2C2, IKBKG, SMAD7, EDARADD, MAP3K8, NLK, TRIM5, ATG5, ATG13, TGFBR1, AR, TBL1XR1, MBD3, SIN3A, APP, WDR34, BST2, MALT1, HSP90AA1, IKBKB, NPM1, TRIM22, ZBTB16, CST9L, TGM2, VIM, FN1, GTF2I, PPP2CB, YWHAZ, FOSL1, SLC19A3, SIK1, SIK3, TRIM38, UBE2I, PIAS3, RFPL4B, CARD8, C9orf41, CNTROB, XPO1, DBN1, ARRB2, LITAF, MCM2, RNF4, F2R, MAPK14, USP18, CTDSP1, EMILIN1, SCRN1, CCDC102B, MANSC1, IL17RC, CYLD, TNIKPPP1R14CSAP25, VPS35, UBL7, ESR1, HMGCS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTAB2chr6:149718900chr6:150535880ENST00000286332+36675_685588694polyubiquitin
HgeneTAB2chr6:149718900chr6:150535880ENST00000367456+58675_685588694polyubiquitin
HgeneTAB2chr6:149718900chr6:150535880ENST00000392282+14675_685-60537polyubiquitin
HgeneTAB2chr6:149718900chr6:150535880ENST00000538427+58675_685588694polyubiquitin


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAB2_PPP1R14C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TAB2_PPP1R14C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTAB2C3554279CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 21UNIPROT