FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37008

FusionGeneSummary for SZRD1_PRDM2

check button Fusion gene summary
Fusion gene informationFusion gene name: SZRD1_PRDM2
Fusion gene ID: 37008
HgeneTgene
Gene symbol

SZRD1

PRDM2

Gene ID

26099

7799

Gene nameSUZ RNA binding domain containing 1PR/SET domain 2
SynonymsC1orf144HUMHOXY1|KMT8|KMT8A|MTB-ZF|RIZ|RIZ1|RIZ2
Cytomap

1p36.13

1p36.21

Type of geneprotein-codingprotein-coding
DescriptionSUZ domain-containing protein 1UPF0485 protein C1orf144putative MAPK activating protein PM20,PM21putative MAPK-activating protein PM18/PM20/PM22PR domain zinc finger protein 2GATA-3 binding protein G3BMTE-binding proteinPR domain 2PR domain containing 2, with ZNF domainPR domain-containing protein 2lysine N-methyltransferase 8retinoblastoma protein-binding zinc finger proteinretinoblastom
Modification date2018051920180523
UniProtAcc

Q7Z422

Q13029

Ensembl transtripts involved in fusion geneENST00000401088, ENST00000471507, 
ENST00000401089, ENST00000375590, 
ENST00000492354, ENST00000472461, 
ENST00000376048, ENST00000311066, 
ENST00000235372, ENST00000502727, 
ENST00000413440, ENST00000343137, 
ENST00000503842, ENST00000505823, 
Fusion gene scores* DoF score2 X 2 X 2=84 X 4 X 3=48
# samples 25
** MAII scorelog2(2/8*10)=1.32192809488736log2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SZRD1 [Title/Abstract] AND PRDM2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePRDM2

GO:0045944

positive regulation of transcription by RNA polymerase II

8654390


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-VQ-A8PM-01ASZRD1chr1

16693803

+PRDM2chr1

14075856

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000401088ENST00000376048SZRD1chr1

16693803

+PRDM2chr1

14075856

+
In-frameENST00000401088ENST00000311066SZRD1chr1

16693803

+PRDM2chr1

14075856

+
In-frameENST00000401088ENST00000235372SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-3UTRENST00000401088ENST00000502727SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401088ENST00000413440SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401088ENST00000343137SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401088ENST00000503842SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401088ENST00000505823SZRD1chr1

16693803

+PRDM2chr1

14075856

+
In-frameENST00000471507ENST00000376048SZRD1chr1

16693803

+PRDM2chr1

14075856

+
In-frameENST00000471507ENST00000311066SZRD1chr1

16693803

+PRDM2chr1

14075856

+
In-frameENST00000471507ENST00000235372SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-3UTRENST00000471507ENST00000502727SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000471507ENST00000413440SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000471507ENST00000343137SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000471507ENST00000503842SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000471507ENST00000505823SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000401089ENST00000376048SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000401089ENST00000311066SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000401089ENST00000235372SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-3UTRENST00000401089ENST00000502727SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401089ENST00000413440SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401089ENST00000343137SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401089ENST00000503842SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000401089ENST00000505823SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000375590ENST00000376048SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000375590ENST00000311066SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000375590ENST00000235372SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-3UTRENST00000375590ENST00000502727SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000375590ENST00000413440SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000375590ENST00000343137SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000375590ENST00000503842SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000375590ENST00000505823SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000492354ENST00000376048SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000492354ENST00000311066SZRD1chr1

16693803

+PRDM2chr1

14075856

+
Frame-shitENST00000492354ENST00000235372SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-3UTRENST00000492354ENST00000502727SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000492354ENST00000413440SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000492354ENST00000343137SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000492354ENST00000503842SZRD1chr1

16693803

+PRDM2chr1

14075856

+
5CDS-intronENST00000492354ENST00000505823SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-3CDSENST00000472461ENST00000376048SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-3CDSENST00000472461ENST00000311066SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-3CDSENST00000472461ENST00000235372SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-3UTRENST00000472461ENST00000502727SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-intronENST00000472461ENST00000413440SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-intronENST00000472461ENST00000343137SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-intronENST00000472461ENST00000503842SZRD1chr1

16693803

+PRDM2chr1

14075856

+
intron-intronENST00000472461ENST00000505823SZRD1chr1

16693803

+PRDM2chr1

14075856

+

Top

FusionProtFeatures for SZRD1_PRDM2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SZRD1

Q7Z422

PRDM2

Q13029

S-adenosyl-L-methionine-dependent histonemethyltransferase that specifically methylates 'Lys-9' of histoneH3. May function as a DNA-binding transcription factor. Binds tothe macrophage-specific TPA-responsive element (MTE) of the HMOX1(heme oxygenase 1) gene and may act as a transcriptional activatorof this gene. {ECO:0000269|PubMed:14633678}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101052_10741282095Compositional biasNote=Poly-Ser
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101361_14471282095Compositional biasNote=Arg/Lys-rich (basic)
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410268_2961282095Compositional biasNote=Asp/Glu-rich (acidic)
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410933_10491282095Compositional biasNote=Pro-rich
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491052_10741281683Compositional biasNote=Poly-Ser
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491361_14471281683Compositional biasNote=Arg/Lys-rich (basic)
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49268_2961281683Compositional biasNote=Asp/Glu-rich (acidic)
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49933_10491281683Compositional biasNote=Pro-rich
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481052_1074128227Compositional biasNote=Poly-Ser
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481361_1447128227Compositional biasNote=Arg/Lys-rich (basic)
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48268_296128227Compositional biasNote=Asp/Glu-rich (acidic)
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48933_1049128227Compositional biasNote=Pro-rich
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101028_10521282095MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410970_9791282095MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410985_9981282095MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491028_10521281683MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49970_9791281683MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49985_9981281683MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481028_1052128227MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48970_979128227MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48985_998128227MotifSH3-binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410294_3161282095RegionNote=Retinoblastoma protein binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49294_3161281683RegionNote=Retinoblastoma protein binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48294_316128227RegionNote=Retinoblastoma protein binding
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101134_11561282095Zinc fingerC2H2-type 4
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101162_11851282095Zinc fingerC2H2-type 5
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101191_12141282095Zinc fingerC2H2-type 6
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101333_13551282095Zinc fingerC2H2-type 7%3B atypical
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+4101455_14781282095Zinc fingerC2H2-type 8%3B atypical
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410360_3821282095Zinc fingerC2H2-type 1
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410390_4121282095Zinc fingerC2H2-type 2
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+410483_5061282095Zinc fingerC2H2-type 3
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491134_11561281683Zinc fingerC2H2-type 4
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491162_11851281683Zinc fingerC2H2-type 5
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491191_12141281683Zinc fingerC2H2-type 6
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491333_13551281683Zinc fingerC2H2-type 7%3B atypical
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+491455_14781281683Zinc fingerC2H2-type 8%3B atypical
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49360_3821281683Zinc fingerC2H2-type 1
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49390_4121281683Zinc fingerC2H2-type 2
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+49483_5061281683Zinc fingerC2H2-type 3
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481134_1156128227Zinc fingerC2H2-type 4
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481162_1185128227Zinc fingerC2H2-type 5
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481191_1214128227Zinc fingerC2H2-type 6
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481333_1355128227Zinc fingerC2H2-type 7%3B atypical
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+481455_1478128227Zinc fingerC2H2-type 8%3B atypical
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48360_382128227Zinc fingerC2H2-type 1
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48390_412128227Zinc fingerC2H2-type 2
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+48483_506128227Zinc fingerC2H2-type 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSZRD1chr1:16693803chr1:14075856ENST00000401088+1442_10717153DomainSUZ
HgeneSZRD1chr1:16693803chr1:14075856ENST00000401089+1342_10714134DomainSUZ
HgeneSZRD1chr1:16693803chr1:14075856ENST00000492354+1342_10714133DomainSUZ
TgenePRDM2chr1:16693803chr1:14075856ENST00000235372+41028_1411282095DomainSET
TgenePRDM2chr1:16693803chr1:14075856ENST00000311066+4928_1411281683DomainSET
TgenePRDM2chr1:16693803chr1:14075856ENST00000376048+4828_141128227DomainSET


Top

FusionGeneSequence for SZRD1_PRDM2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000376048_chr1_14075856_+_116aa
MEDEEVAESWEEAADSGPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQP

>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000311066_chr1_14075856_+_1572aa
MEDEEVAESWEEAADSGPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSAN
MRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEEEEDDDDDELED
EGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEANGDVFETFMFPCQHCERKFTTKQGLERHMHI
HISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKPSQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSS
VVEENGEVKELHPCKTCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVTVPSTEPEEEGEADDVYIMDISSN
ISENLNYTIDGKIQTNNNTSNCDVIEMESASADLTGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLGSTNSEAKKRRTASPPALPKIK
AETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVTLSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPP
SSPQHSPALRDFGKPSDGKAAWTDAGLTSKKSKLESHSDSPAWSLSGRDERETVSPPCFDETKMSKEWTASSAFSSVCNQQPLDLSSGVK
QKAEGTGKTPVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNETNGIDLPVENPADGTRSPSPCKSLEA
QPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVLTVATPPPPLLPTVPLPAPSSSASPHPCPSPL
SNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPTLSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFK
QEELENEGLKPREEPQSAAEQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNIF
VCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEEELNDSSEELYTTIKIMASGIK
TKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPV
PLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCN
REFTYIGSLNKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSGPTQVPLPSSSF
RSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRSLHVRVQKSKAVLQSKSTLASKKRTDRFNIKS

>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000235372_chr1_14075856_+_1608aa
MEDEEVAESWEEAADSGPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSAN
MRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEEEEDDDDDELED
EGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEANGDVFETFMFPCQHCERKFTTKQGLERHMHI
HISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKPSQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSS
VVEENGEVKELHPCKTCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVTVPSTEPEEEGEADDVYIMDISSN
ISENLNYTIDGKIQTNNNTSNCDVIEMESASADLTGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLGSTNSEAKKRRTASPPALPKIK
AETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVTLSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPP
SSPQHSPALRDFGKPSDGKAAWTDAGLTSKKSKLESHSDSPAWSLSGRDERETVSPPCFDETKMSKEWTASSAFSSVCNQQPLDLSSGVK
QKAEGTGKTPVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNETNGIDLPVENPADGTRSPSPCKSLEA
QPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVLTVATPPPPLLPTVPLPAPSSSASPHPCPSPL
SNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPTLSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFK
QEELENEGLKPREEPQSAAEQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNIF
VCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEEELNDSSEELYTTIKIMASGIK
TKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPV
PLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCN
REFTYIGSLNKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSGPTQVPLPSSSF
RSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRSLHVRVQKSKAVLQSKSTLASKKRTDRFNIKS

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000376048_chr1_14075856_+_116aa
MEDEEVAESWEEAADSGPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQP

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000311066_chr1_14075856_+_1572aa
MEDEEVAESWEEAADSGPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSAN
MRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEEEEDDDDDELED
EGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEANGDVFETFMFPCQHCERKFTTKQGLERHMHI
HISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKPSQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSS
VVEENGEVKELHPCKTCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVTVPSTEPEEEGEADDVYIMDISSN
ISENLNYTIDGKIQTNNNTSNCDVIEMESASADLTGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLGSTNSEAKKRRTASPPALPKIK
AETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVTLSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPP
SSPQHSPALRDFGKPSDGKAAWTDAGLTSKKSKLESHSDSPAWSLSGRDERETVSPPCFDETKMSKEWTASSAFSSVCNQQPLDLSSGVK
QKAEGTGKTPVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNETNGIDLPVENPADGTRSPSPCKSLEA
QPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVLTVATPPPPLLPTVPLPAPSSSASPHPCPSPL
SNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPTLSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFK
QEELENEGLKPREEPQSAAEQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNIF
VCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEEELNDSSEELYTTIKIMASGIK
TKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPV
PLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCN
REFTYIGSLNKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSGPTQVPLPSSSF
RSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRSLHVRVQKSKAVLQSKSTLASKKRTDRFNIKS

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000235372_chr1_14075856_+_1608aa
MEDEEVAESWEEAADSGPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSAN
MRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEEEEDDDDDELED
EGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEANGDVFETFMFPCQHCERKFTTKQGLERHMHI
HISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKPSQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSS
VVEENGEVKELHPCKTCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVTVPSTEPEEEGEADDVYIMDISSN
ISENLNYTIDGKIQTNNNTSNCDVIEMESASADLTGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLGSTNSEAKKRRTASPPALPKIK
AETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVTLSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPP
SSPQHSPALRDFGKPSDGKAAWTDAGLTSKKSKLESHSDSPAWSLSGRDERETVSPPCFDETKMSKEWTASSAFSSVCNQQPLDLSSGVK
QKAEGTGKTPVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNETNGIDLPVENPADGTRSPSPCKSLEA
QPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVLTVATPPPPLLPTVPLPAPSSSASPHPCPSPL
SNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPTLSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFK
QEELENEGLKPREEPQSAAEQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNIF
VCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEEELNDSSEELYTTIKIMASGIK
TKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPV
PLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCN
REFTYIGSLNKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSGPTQVPLPSSSF
RSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRSLHVRVQKSKAVLQSKSTLASKKRTDRFNIKS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000376048_chr1_14075856_+_348nt
ATGGAAGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAAT
GGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGCT
ACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGGAAGGTCAAAGCTCCAGCTGCAGCCC

>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000311066_chr1_14075856_+_4716nt
ATGGAAGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAAT
GGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGG
AAGAAAAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAAT
ATGAGAGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCC
AGTCAGGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGT
GAGGTGAATGATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGAC
GAGGGGGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAG
GAACCAAAAACAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAAT
GGTGATGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATC
CATATATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGC
CATGAAGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCT
TCAAAAGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCT
GTCGTAGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCAT
CAGCGTAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCC
CAGGCCACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAAT
ATCTCTGAAAACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCT
TCGGCAGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACA
GAAGATCTTCCTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAG
GCCGAAACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAA
GAGAAAAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATA
GCTAAATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCC
AGTTCTCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAA
AAATCCAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGAT
GAATATAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAA
CAGAAGGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAA
GGCAAGGAATTCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTT
CTTCTCAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCT
CAGCCAGATCCTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTG
CAGACACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACT
GTTGCCACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTC
TCAAATGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATG
TCTGCCGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCT
TCTCCTTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAA
CAGGAGGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAAC
AAAAACTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCC
TTCAAATGTGAATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTT
GTGTGTTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACAT
CACGAGTTTGAAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGAT
CCTTTAGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAG
ACAAAAGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATG
GGGATTGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGT
GTCGACAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTA
CCATTAAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAA
AGGCTTAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAA
GCAATTCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAAT
CGAGAGTTCACTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCT
CATTCATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAG
ATTAAAATGCAAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTC
AGGTCCAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATG
GCCAAAATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTG
CACGTGAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCT
AGAGAGCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCC

>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000235372_chr1_14075856_+_4824nt
ATGGAAGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAAT
GGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGG
AAGAAAAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAAT
ATGAGAGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCC
AGTCAGGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGT
GAGGTGAATGATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGAC
GAGGGGGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAG
GAACCAAAAACAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAAT
GGTGATGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATC
CATATATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGC
CATGAAGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCT
TCAAAAGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCT
GTCGTAGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCAT
CAGCGTAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCC
CAGGCCACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAAT
ATCTCTGAAAACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCT
TCGGCAGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACA
GAAGATCTTCCTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAG
GCCGAAACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAA
GAGAAAAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATA
GCTAAATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCC
AGTTCTCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAA
AAATCCAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGAT
GAATATAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAA
CAGAAGGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAA
GGCAAGGAATTCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTT
CTTCTCAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCT
CAGCCAGATCCTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTG
CAGACACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACT
GTTGCCACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTC
TCAAATGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATG
TCTGCCGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCT
TCTCCTTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAA
CAGGAGGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAAC
AAAAACTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCC
TTCAAATGTGAATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTT
GTGTGTTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACAT
CACGAGTTTGAAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGAT
CCTTTAGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAG
ACAAAAGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATG
GGGATTGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGT
GTCGACAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTA
CCATTAAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAA
AGGCTTAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAA
GCAATTCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAAT
CGAGAGTTCACTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCT
CATTCATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAG
ATTAAAATGCAAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTC
AGGTCCAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATG
GCCAAAATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTG
CACGTGAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCT
AGAGAGCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCC
AAGCAGGAGCTGAAGGACTTCAGCTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGG

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000376048_chr1_14075856_+_348nt
ATGGAAGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAAT
GGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGCT
ACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGGAAGGTCAAAGCTCCAGCTGCAGCCC

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000311066_chr1_14075856_+_4716nt
ATGGAAGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAAT
GGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGG
AAGAAAAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAAT
ATGAGAGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCC
AGTCAGGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGT
GAGGTGAATGATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGAC
GAGGGGGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAG
GAACCAAAAACAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAAT
GGTGATGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATC
CATATATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGC
CATGAAGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCT
TCAAAAGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCT
GTCGTAGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCAT
CAGCGTAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCC
CAGGCCACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAAT
ATCTCTGAAAACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCT
TCGGCAGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACA
GAAGATCTTCCTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAG
GCCGAAACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAA
GAGAAAAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATA
GCTAAATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCC
AGTTCTCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAA
AAATCCAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGAT
GAATATAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAA
CAGAAGGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAA
GGCAAGGAATTCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTT
CTTCTCAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCT
CAGCCAGATCCTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTG
CAGACACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACT
GTTGCCACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTC
TCAAATGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATG
TCTGCCGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCT
TCTCCTTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAA
CAGGAGGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAAC
AAAAACTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCC
TTCAAATGTGAATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTT
GTGTGTTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACAT
CACGAGTTTGAAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGAT
CCTTTAGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAG
ACAAAAGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATG
GGGATTGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGT
GTCGACAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTA
CCATTAAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAA
AGGCTTAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAA
GCAATTCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAAT
CGAGAGTTCACTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCT
CATTCATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAG
ATTAAAATGCAAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTC
AGGTCCAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATG
GCCAAAATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTG
CACGTGAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCT
AGAGAGCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCC

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000235372_chr1_14075856_+_4824nt
ATGGAAGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAAT
GGGGAAGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGG
AAGAAAAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAAT
ATGAGAGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCC
AGTCAGGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGT
GAGGTGAATGATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGAC
GAGGGGGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAG
GAACCAAAAACAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAAT
GGTGATGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATC
CATATATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGC
CATGAAGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCT
TCAAAAGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCT
GTCGTAGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCAT
CAGCGTAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCC
CAGGCCACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAAT
ATCTCTGAAAACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCT
TCGGCAGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACA
GAAGATCTTCCTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAG
GCCGAAACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAA
GAGAAAAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATA
GCTAAATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCC
AGTTCTCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAA
AAATCCAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGAT
GAATATAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAA
CAGAAGGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAA
GGCAAGGAATTCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTT
CTTCTCAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCT
CAGCCAGATCCTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTG
CAGACACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACT
GTTGCCACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTC
TCAAATGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATG
TCTGCCGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCT
TCTCCTTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAA
CAGGAGGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAAC
AAAAACTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCC
TTCAAATGTGAATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTT
GTGTGTTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACAT
CACGAGTTTGAAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGAT
CCTTTAGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAG
ACAAAAGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATG
GGGATTGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGT
GTCGACAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTA
CCATTAAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAA
AGGCTTAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAA
GCAATTCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAAT
CGAGAGTTCACTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCT
CATTCATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAG
ATTAAAATGCAAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTC
AGGTCCAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATG
GCCAAAATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTG
CACGTGAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCT
AGAGAGCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCC
AAGCAGGAGCTGAAGGACTTCAGCTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000376048_chr1_14075856_+_2404nt
CTTCCAAGATGGCTGCCCTAATGTACACTTGGGACCTTGCCTGGCGCCTCTTCCGGGCTTGGCAGCGGGCGGGGTCCATTGAGTAAAGCC
TTGCGTGCCTGCGCCCGCGACGGAGGCGCGCTTCAAAGCGCAGGCGCGGGGAGGGGGTGGGGGAGGAGGGAAAGCGGCGAGTAAGATGGA
AGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGA
AGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGCTACAGC
CTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGGAAGGTCAAAGCTCCAGCTGCAGCCCAGTTC
CAGGGACCATTCTTCAAAGAGTAGACACTCTGGCTGCTCCCTGACAGCACCTGAAGTGACCTGGAATCAGTGAAGCCAAAGGGACTGGCA
GTCTGCCCTGCAGGGAGTACCGACCTATCCCAGTTGTGTGAGGCTGCGAGAGAAAGGGAGTGCATGTGCGCGCGTGCATGTGTGCGTGCG
TGTGTGTTCACGTGTTCTCGTGCGGGCGCGTGAGTGGTCTTCAAACGAGGGTCCCGATCCCCGGGGCGGCAGGAAGGGGGCCGACTCCAC
GCTGTCCTTTGGGATGATACTTGGATGCAGCTCTTGGGACCGTGTTCTGCAGCCCAGCCTTCCTGTTGGGGTGGGGCCTCTCCTACTATG
CAATTTTTCAAGAGCTCCTTGACCCTGCTTTTTGCTTCTTGAGTTGTCTTTTGCCATTATGGGGACTTTGGTTTGACCCAGGGGTCAGCC
TTAGGAAGGCCTTCAGGAGGAGGCCGAGTTCCCCTTCAGTACCACCCCTCTCTCCCCACCTTCCCTCTCCCGGCAACATCTCTGGGAATC
AACAGCATATTGACACGTTGGAGCCGAGCCTGAACATGCCCCTCGGCCCCAGCACATGGAAAACCCCCTTCCTTGCCTAAGGTGTCTGAG
TTTCTGGCTCTTGAGGCATTTCCAGACTTGAAATTCTCATCAGTCCATTGCTCTTGAGTCTTTGCAGAGAACCTCAGATCAGGTGCACCT
GGGAGAAAGACTTTGTCCCCACTTACAGATCTATCTCCTCCCTTGGGAAGGGCAGGGAATGGGGACGGTGTATGGAGGGGAGGGATCTCC
TGCGCCCTTCATTGCCACACTTGGTGGGACCATGAACATCTTTAGTGTCTGAGCTTCTCAAATTAGCTGCAATAGGAAAAAAACAAATTG
GGAAATGAAAAAAAAATGGGAAGATTAAAAAGCACAGGGGGAAGAAGAAGAGATTTCGGAGGCCATCCTGCCAGGGGCGGACGGGGCTGA
CTCCTGCTCTCTGGAGGACGGTCAGTCCATGTCTCGGAGAAACGGGTGAGCTGAGCTTGGCGTTTGGACCCAGTTCAGTGAGGTTCTTGG
GTTTTGTGCCTTTGGGGCAGACCCCAGGCAAGGATGTCTGAGACCACTTGGGCGCTGTTTTCTCAGCTCCAATTTCAAGAGTGAGCTATC
AAACCCAGAGCGGAAGGAGGGAGCTCTGATGAGCACGGTTTGTCACACGATAAAGGGATTTTTTTTTTCAGGGCTACTACGGTTGATCTT
GCAACTCTGTAAATATGTATGTAGACACTTTTAAAAGCACGTATTTATGTCCCTGACTGTAAATGCTCCATTTTTAAAGTTTTATAACTT
GTGTTATTTAATGAGTCAGTCAATCGGCTGCAGTATGGGATCTGATAAGGATCTAGGAGAAGGGTCTCATGCGGACCCTCACATGGGCAG
AAAAATGGTGGTCATTGGCCGACATCACAGTTTTCCTGTTTCCCACCCAGCTAAAAACCGTTGTTTGCTTTAAATTTTCATAAACTGGAA
TCCTTTCACCCGCTCCTACAGCTAACCCTCACAAGCATGAAGTGCTGTGGCTGTTCCTTATCCTAATGATGCGCTTTTGTCCCGTAAATG
TTAACACTCATGAAGCATACCCCGGCCTCTCAGTTCTTGAGGGCCTCCCCACCGCAGCAGCAAGGAAAGCTCACGAACCCCAAACCTGGC
AAGTCACCTGCAGCCCATGGTGAGCTCTGGGAAGTGTGGTTGAGGCCTTGGGGTCACTCCTTTTTTGCATGTGCAAATGTGCTGGTCACC
CTTCAACGCTCCCAGACGGTCAGGAAAACTGTTCCAATCATGAAAAGGGGGGATGATTTTGTAAAAGTGGCATTTCCTGGTCAGTGGTGG

>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000311066_chr1_14075856_+_6423nt
CTTCCAAGATGGCTGCCCTAATGTACACTTGGGACCTTGCCTGGCGCCTCTTCCGGGCTTGGCAGCGGGCGGGGTCCATTGAGTAAAGCC
TTGCGTGCCTGCGCCCGCGACGGAGGCGCGCTTCAAAGCGCAGGCGCGGGGAGGGGGTGGGGGAGGAGGGAAAGCGGCGAGTAAGATGGA
AGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGA
AGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGGAAGAA
AAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAATATGAG
AGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCCAGTCA
GGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGTGAGGT
GAATGATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGACGAGGG
GGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAGGAACC
AAAAACAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAATGGTGA
TGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATCCATAT
ATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGCCATGA
AGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCTTCAAA
AGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCTGTCGT
AGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCATCAGCG
TAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCCCAGGC
CACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAATATCTC
TGAAAACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCTTCGGC
AGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACAGAAGA
TCTTCCTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAGGCCGA
AACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAAGAGAA
AAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATAGCTAA
ATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCCAGTTC
TCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAAAAATC
CAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGATGAATA
TAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAACAGAA
GGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAAGGCAA
GGAATTCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTTCTTCT
CAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCTCAGCC
AGATCCTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTGCAGAC
ACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACTGTTGC
CACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTCTCAAA
TGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATGTCTGC
CGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCTTCTCC
TTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAACAGGA
GGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAACAAAAA
CTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCCTTCAA
ATGTGAATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTTGTGTG
TTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACATCACGA
GTTTGAAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGATCCTTT
AGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAGACAAA
AGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATGGGGAT
TGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGTGTCGA
CAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTACCATT
AAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAAAGGCT
TAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAAGCAAT
TCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAATCGAGA
GTTCACTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCTCATTC
ATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAGATTAA
AATGCAAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTCAGGTC
CAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATGGCCAA
AATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTGCACGT
GAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCTAGAGA
GCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCCAAGCA
GGAGCTGAAGGACTTCAGGAACTTCCTGTAGAAAAGCCCCCAAAACAAAACAAACCTTAATTGACTAAAAAGTATTGCATGCTCAACTTA
GGATAAGCACTACGGCAAAGGATACGAAATCTACCAAGCTTGCAAGACCAGTTGAAGCTGACTCAAAAATCCTAACATTCAGCTGATTGC
CGGCAGGCTTAGAGTCAGGCATCTGCTGCTTCGGTGGGGGCCCAACGCGCATGCTGGGCGCCCGGGTGATTGAGATCCAAAGAGAAGGGC
ACTGTAAGACAGGCCAGATGAACTGGCTCCTCGTCATGGGACTGGTACCTCAGATCTGAGCATGGCCCTTGTTTTTGGCACGTAGCAGAG
AAAGGATTGATTTGAACTTAACCTTGCAAAGCAAGTTGCCTGTTTTAGCAGTAGTTTGTTGTAGGTTTCAGGGATGACAGATTTGGATGC
ACTCATTTAAAACGTTTTGGTCACATATCAGCTCTTGATGCCTTTCTTTTAAATTAATTATAGACAGAGAGAGGCATTTAGCTGATCTCT
TACCCCTGGTATTTCTTTTTTTTGTTGTTTTCGTTTTTTTAAATCACAAGTAGATTGCCAGCGTAATGGAGAGGAAACCAGATTGGATAT
GGACTCTTTTTTATGCCTATTCTGGTGTTGCGTTTGTATATCCAAATGGACGTTATCCTCTCAGATTCTTATCTGGCACTAATTTATAAC
TATTATATTATCAGAGACTATGTAGCAATATATCAGTGCACAGGCGCATCCCAGGCCTGTACAGATGTATGTCTACACGTAAGTATAAAT
GAATTTGCATACCAGGTTTTACACTTGCATCTCTAATAGAGATTAAAAACAACAAATTGGCCTCTTCCTAAGTATATTAATATCATTTAT
CCTTACATTTTATGCCTCCCCCTAAATTAATGACTGAGTTGGTGGAAAGCGGCTAGGTTTTATTCATACTGTTTTTTGTTCTCAACTTCA
AAAGTAATCTACCTCTGAAAAATTTGTAGTTTAATATTTGTTTGGTGAATTTGTGCCACTTTAATCCTTCCACTATCATTCCCATTTTGT
TACATTTCTGTTATGGGGACTTTATGTTGAAATATTGTATAAAGCATTTGTAGCAATTTAAAAATAAAATATTTAAAATTATTTAAATTG
TTTTGGACGCTTCAATTGTATTATATGTGATTTACATTTCACTTTTTTTGTTGGCGTTGTTAACCCGGAGAGTGCTCCTGTATTGAACTT
TGCTGTTAGTTATTTTATTGCTTCTTTTTGGAGAGTGCTATAAAAGACTATTCTAATGAAAACATTAAAATTTACAATTTGACATACAAA
AAGGGGTTGTCCATTGATTTTAACCAATGTAGCACTGAGAGAGAGAGAGGTTAATTATAGATAGACAAGAGTGGTGTTTGTTGTTTTTCC
CCTCCCAGCATTGAAATCATTGGGGCTTGTCAGATGTATTAAAAAAAGATTTGTTGTGCTATTGCTGCAAACACTTAATAACTAGAGGAG

>In-frame_SZRD1_ENST00000401088_chr1_16693803_+_PRDM2_ENST00000235372_chr1_14075856_+_6943nt
CTTCCAAGATGGCTGCCCTAATGTACACTTGGGACCTTGCCTGGCGCCTCTTCCGGGCTTGGCAGCGGGCGGGGTCCATTGAGTAAAGCC
TTGCGTGCCTGCGCCCGCGACGGAGGCGCGCTTCAAAGCGCAGGCGCGGGGAGGGGGTGGGGGAGGAGGGAAAGCGGCGAGTAAGATGGA
AGATGAGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGA
AGACAACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGGAAGAA
AAAATCCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAATATGAG
AGATTCTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCCAGTCA
GGAGGTGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGTGAGGT
GAATGATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGACGAGGG
GGAAGAAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAGGAACC
AAAAACAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAATGGTGA
TGTATTTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATCCATAT
ATCCACCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGCCATGA
AGCAGGGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCTTCAAA
AGATGATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCTGTCGT
AGAAGAGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCATCAGCG
TAGAGTTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCCCAGGC
CACCCAGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAATATCTC
TGAAAACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCTTCGGC
AGATTTGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACAGAAGA
TCTTCCTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAGGCCGA
AACAGACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAAGAGAA
AAGTGTTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATAGCTAA
ATTAGGTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCCAGTTC
TCCACAGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAAAAATC
CAAATTAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGATGAATA
TAAAATGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAACAGAA
GGCTGAGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAAGGCAA
GGAATTCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTTCTTCT
CAATGAATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCTCAGCC
AGATCCTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTGCAGAC
ACCCTCCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACTGTTGC
CACTCCGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTCTCAAA
TGCCACCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATGTCTGC
CGCCTCACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCTTCTCC
TTCTCCACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAACAGGA
GGAATTAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAACAAAAA
CTTTGTTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCCTTCAA
ATGTGAATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTTGTGTG
TTCTGTTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACATCACGA
GTTTGAAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGATCCTTT
AGAAACTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAGACAAA
AGATCCAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATGGGGAT
TGGTGTGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGTGTCGA
CAATATGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTACCATT
AAAACAAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAAAGGCT
TAACTTTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAAGCAAT
TCTTCAGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAATCGAGA
GTTCACTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCTCATTC
ATCTAAGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAGATTAA
AATGCAAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTCAGGTC
CAAGCAGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATGGCCAA
AATAACTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTGCACGT
GAGGGTACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCTAGAGA
GCGGAGTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCCAAGCA
GGAGCTGAAGGACTTCAGCTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGGAAGGT
CAAAGCTCCAGCTGCAGCCCAGTTCCAGGGACCATTCTTCAAAGAGTAGACACTCTGGCTGCTCCCTGACAGCACCTGAAGTGACCTGGA
ATCAGTGAAGCCAAAGGGACTGGCAGTCTGCCCTGCAGGGAGTACCGACCTATCCCAGTTGTGTGAGGCTGCGAGAGAAAGGGAGTGCAT
GTGCGCGCGTGCATGTGTGCGTGCGTGTGTGTTCACGTGTTCTCGTGCGGGCGCGTGAGTGGTCTTCAAACGAGGGTCCCGATCCCCGGG
GCGGCAGGAAGGGGGCCGACTCCACGCTGTCCTTTGGGATGATACTTGGATGCAGCTCTTGGGACCGTGTTCTGCAGCCCAGCCTTCCTG
TTGGGGTGGGGCCTCTCCTACTATGCAATTTTTCAAGAGCTCCTTGACCCTGCTTTTTGCTTCTTGAGTTGTCTTTTGCCATTATGGGGA
CTTTGGTTTGACCCAGGGGTCAGCCTTAGGAAGGCCTTCAGGAGGAGGCCGAGTTCCCCTTCAGTACCACCCCTCTCTCCCCACCTTCCC
TCTCCCGGCAACATCTCTGGGAATCAACAGCATATTGACACGTTGGAGCCGAGCCTGAACATGCCCCTCGGCCCCAGCACATGGAAAACC
CCCTTCCTTGCCTAAGGTGTCTGAGTTTCTGGCTCTTGAGGCATTTCCAGACTTGAAATTCTCATCAGTCCATTGCTCTTGAGTCTTTGC
AGAGAACCTCAGATCAGGTGCACCTGGGAGAAAGACTTTGTCCCCACTTACAGATCTATCTCCTCCCTTGGGAAGGGCAGGGAATGGGGA
CGGTGTATGGAGGGGAGGGATCTCCTGCGCCCTTCATTGCCACACTTGGTGGGACCATGAACATCTTTAGTGTCTGAGCTTCTCAAATTA
GCTGCAATAGGAAAAAAACAAATTGGGAAATGAAAAAAAAATGGGAAGATTAAAAAGCACAGGGGGAAGAAGAAGAGATTTCGGAGGCCA
TCCTGCCAGGGGCGGACGGGGCTGACTCCTGCTCTCTGGAGGACGGTCAGTCCATGTCTCGGAGAAACGGGTGAGCTGAGCTTGGCGTTT
GGACCCAGTTCAGTGAGGTTCTTGGGTTTTGTGCCTTTGGGGCAGACCCCAGGCAAGGATGTCTGAGACCACTTGGGCGCTGTTTTCTCA
GCTCCAATTTCAAGAGTGAGCTATCAAACCCAGAGCGGAAGGAGGGAGCTCTGATGAGCACGGTTTGTCACACGATAAAGGGATTTTTTT
TTTCAGGGCTACTACGGTTGATCTTGCAACTCTGTAAATATGTATGTAGACACTTTTAAAAGCACGTATTTATGTCCCTGACTGTAAATG
CTCCATTTTTAAAGTTTTATAACTTGTGTTATTTAATGAGTCAGTCAATCGGCTGCAGTATGGGATCTGATAAGGATCTAGGAGAAGGGT
CTCATGCGGACCCTCACATGGGCAGAAAAATGGTGGTCATTGGCCGACATCACAGTTTTCCTGTTTCCCACCCAGCTAAAAACCGTTGTT
TGCTTTAAATTTTCATAAACTGGAATCCTTTCACCCGCTCCTACAGCTAACCCTCACAAGCATGAAGTGCTGTGGCTGTTCCTTATCCTA
ATGATGCGCTTTTGTCCCGTAAATGTTAACACTCATGAAGCATACCCCGGCCTCTCAGTTCTTGAGGGCCTCCCCACCGCAGCAGCAAGG
AAAGCTCACGAACCCCAAACCTGGCAAGTCACCTGCAGCCCATGGTGAGCTCTGGGAAGTGTGGTTGAGGCCTTGGGGTCACTCCTTTTT
TGCATGTGCAAATGTGCTGGTCACCCTTCAACGCTCCCAGACGGTCAGGAAAACTGTTCCAATCATGAAAAGGGGGGATGATTTTGTAAA
AGTGGCATTTCCTGGTCAGTGGTGGTCTTCAAGACGACAGCTCTGTATCTGCCATGTGAAGAGAATTAACAATAAAAGTGTGAAGAGCGA

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000376048_chr1_14075856_+_2399nt
AAGATGGCTGCCCTAATGTACACTTGGGACCTTGCCTGGCGCCTCTTCCGGGCTTGGCAGCGGGCGGGGTCCATTGAGTAAAGCCTTGCG
TGCCTGCGCCCGCGACGGAGGCGCGCTTCAAAGCGCAGGCGCGGGGAGGGGGTGGGGGAGGAGGGAAAGCGGCGAGTAAGATGGAAGATG
AGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGAAGACA
ACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGCTACAGCCTCCG
CTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGGAAGGTCAAAGCTCCAGCTGCAGCCCAGTTCCAGGG
ACCATTCTTCAAAGAGTAGACACTCTGGCTGCTCCCTGACAGCACCTGAAGTGACCTGGAATCAGTGAAGCCAAAGGGACTGGCAGTCTG
CCCTGCAGGGAGTACCGACCTATCCCAGTTGTGTGAGGCTGCGAGAGAAAGGGAGTGCATGTGCGCGCGTGCATGTGTGCGTGCGTGTGT
GTTCACGTGTTCTCGTGCGGGCGCGTGAGTGGTCTTCAAACGAGGGTCCCGATCCCCGGGGCGGCAGGAAGGGGGCCGACTCCACGCTGT
CCTTTGGGATGATACTTGGATGCAGCTCTTGGGACCGTGTTCTGCAGCCCAGCCTTCCTGTTGGGGTGGGGCCTCTCCTACTATGCAATT
TTTCAAGAGCTCCTTGACCCTGCTTTTTGCTTCTTGAGTTGTCTTTTGCCATTATGGGGACTTTGGTTTGACCCAGGGGTCAGCCTTAGG
AAGGCCTTCAGGAGGAGGCCGAGTTCCCCTTCAGTACCACCCCTCTCTCCCCACCTTCCCTCTCCCGGCAACATCTCTGGGAATCAACAG
CATATTGACACGTTGGAGCCGAGCCTGAACATGCCCCTCGGCCCCAGCACATGGAAAACCCCCTTCCTTGCCTAAGGTGTCTGAGTTTCT
GGCTCTTGAGGCATTTCCAGACTTGAAATTCTCATCAGTCCATTGCTCTTGAGTCTTTGCAGAGAACCTCAGATCAGGTGCACCTGGGAG
AAAGACTTTGTCCCCACTTACAGATCTATCTCCTCCCTTGGGAAGGGCAGGGAATGGGGACGGTGTATGGAGGGGAGGGATCTCCTGCGC
CCTTCATTGCCACACTTGGTGGGACCATGAACATCTTTAGTGTCTGAGCTTCTCAAATTAGCTGCAATAGGAAAAAAACAAATTGGGAAA
TGAAAAAAAAATGGGAAGATTAAAAAGCACAGGGGGAAGAAGAAGAGATTTCGGAGGCCATCCTGCCAGGGGCGGACGGGGCTGACTCCT
GCTCTCTGGAGGACGGTCAGTCCATGTCTCGGAGAAACGGGTGAGCTGAGCTTGGCGTTTGGACCCAGTTCAGTGAGGTTCTTGGGTTTT
GTGCCTTTGGGGCAGACCCCAGGCAAGGATGTCTGAGACCACTTGGGCGCTGTTTTCTCAGCTCCAATTTCAAGAGTGAGCTATCAAACC
CAGAGCGGAAGGAGGGAGCTCTGATGAGCACGGTTTGTCACACGATAAAGGGATTTTTTTTTTCAGGGCTACTACGGTTGATCTTGCAAC
TCTGTAAATATGTATGTAGACACTTTTAAAAGCACGTATTTATGTCCCTGACTGTAAATGCTCCATTTTTAAAGTTTTATAACTTGTGTT
ATTTAATGAGTCAGTCAATCGGCTGCAGTATGGGATCTGATAAGGATCTAGGAGAAGGGTCTCATGCGGACCCTCACATGGGCAGAAAAA
TGGTGGTCATTGGCCGACATCACAGTTTTCCTGTTTCCCACCCAGCTAAAAACCGTTGTTTGCTTTAAATTTTCATAAACTGGAATCCTT
TCACCCGCTCCTACAGCTAACCCTCACAAGCATGAAGTGCTGTGGCTGTTCCTTATCCTAATGATGCGCTTTTGTCCCGTAAATGTTAAC
ACTCATGAAGCATACCCCGGCCTCTCAGTTCTTGAGGGCCTCCCCACCGCAGCAGCAAGGAAAGCTCACGAACCCCAAACCTGGCAAGTC
ACCTGCAGCCCATGGTGAGCTCTGGGAAGTGTGGTTGAGGCCTTGGGGTCACTCCTTTTTTGCATGTGCAAATGTGCTGGTCACCCTTCA
ACGCTCCCAGACGGTCAGGAAAACTGTTCCAATCATGAAAAGGGGGGATGATTTTGTAAAAGTGGCATTTCCTGGTCAGTGGTGGTCTTC

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000311066_chr1_14075856_+_6418nt
AAGATGGCTGCCCTAATGTACACTTGGGACCTTGCCTGGCGCCTCTTCCGGGCTTGGCAGCGGGCGGGGTCCATTGAGTAAAGCCTTGCG
TGCCTGCGCCCGCGACGGAGGCGCGCTTCAAAGCGCAGGCGCGGGGAGGGGGTGGGGGAGGAGGGAAAGCGGCGAGTAAGATGGAAGATG
AGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGAAGACA
ACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGGAAGAAAAAAT
CCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAATATGAGAGATT
CTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCCAGTCAGGAGG
TGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGTGAGGTGAATG
ATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGACGAGGGGGAAG
AAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAGGAACCAAAAA
CAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAATGGTGATGTAT
TTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATCCATATATCCA
CCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGCCATGAAGCAG
GGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCTTCAAAAGATG
ATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCTGTCGTAGAAG
AGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCATCAGCGTAGAG
TTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCCCAGGCCACCC
AGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAATATCTCTGAAA
ACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCTTCGGCAGATT
TGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACAGAAGATCTTC
CTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAGGCCGAAACAG
ACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAAGAGAAAAGTG
TTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATAGCTAAATTAG
GTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCCAGTTCTCCAC
AGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAAAAATCCAAAT
TAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGATGAATATAAAA
TGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAACAGAAGGCTG
AGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAAGGCAAGGAAT
TCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTTCTTCTCAATG
AATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCTCAGCCAGATC
CTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTGCAGACACCCT
CCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACTGTTGCCACTC
CGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTCTCAAATGCCA
CCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATGTCTGCCGCCT
CACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCTTCTCCTTCTC
CACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAACAGGAGGAAT
TAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAACAAAAACTTTG
TTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCCTTCAAATGTG
AATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTTGTGTGTTCTG
TTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACATCACGAGTTTG
AAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGATCCTTTAGAAA
CTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAGACAAAAGATC
CAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATGGGGATTGGTG
TGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGTGTCGACAATA
TGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTACCATTAAAAC
AAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAAAGGCTTAACT
TTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAAGCAATTCTTC
AGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAATCGAGAGTTCA
CTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCTCATTCATCTA
AGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAGATTAAAATGC
AAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTCAGGTCCAAGC
AGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATGGCCAAAATAA
CTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTGCACGTGAGGG
TACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCTAGAGAGCGGA
GTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCCAAGCAGGAGC
TGAAGGACTTCAGGAACTTCCTGTAGAAAAGCCCCCAAAACAAAACAAACCTTAATTGACTAAAAAGTATTGCATGCTCAACTTAGGATA
AGCACTACGGCAAAGGATACGAAATCTACCAAGCTTGCAAGACCAGTTGAAGCTGACTCAAAAATCCTAACATTCAGCTGATTGCCGGCA
GGCTTAGAGTCAGGCATCTGCTGCTTCGGTGGGGGCCCAACGCGCATGCTGGGCGCCCGGGTGATTGAGATCCAAAGAGAAGGGCACTGT
AAGACAGGCCAGATGAACTGGCTCCTCGTCATGGGACTGGTACCTCAGATCTGAGCATGGCCCTTGTTTTTGGCACGTAGCAGAGAAAGG
ATTGATTTGAACTTAACCTTGCAAAGCAAGTTGCCTGTTTTAGCAGTAGTTTGTTGTAGGTTTCAGGGATGACAGATTTGGATGCACTCA
TTTAAAACGTTTTGGTCACATATCAGCTCTTGATGCCTTTCTTTTAAATTAATTATAGACAGAGAGAGGCATTTAGCTGATCTCTTACCC
CTGGTATTTCTTTTTTTTGTTGTTTTCGTTTTTTTAAATCACAAGTAGATTGCCAGCGTAATGGAGAGGAAACCAGATTGGATATGGACT
CTTTTTTATGCCTATTCTGGTGTTGCGTTTGTATATCCAAATGGACGTTATCCTCTCAGATTCTTATCTGGCACTAATTTATAACTATTA
TATTATCAGAGACTATGTAGCAATATATCAGTGCACAGGCGCATCCCAGGCCTGTACAGATGTATGTCTACACGTAAGTATAAATGAATT
TGCATACCAGGTTTTACACTTGCATCTCTAATAGAGATTAAAAACAACAAATTGGCCTCTTCCTAAGTATATTAATATCATTTATCCTTA
CATTTTATGCCTCCCCCTAAATTAATGACTGAGTTGGTGGAAAGCGGCTAGGTTTTATTCATACTGTTTTTTGTTCTCAACTTCAAAAGT
AATCTACCTCTGAAAAATTTGTAGTTTAATATTTGTTTGGTGAATTTGTGCCACTTTAATCCTTCCACTATCATTCCCATTTTGTTACAT
TTCTGTTATGGGGACTTTATGTTGAAATATTGTATAAAGCATTTGTAGCAATTTAAAAATAAAATATTTAAAATTATTTAAATTGTTTTG
GACGCTTCAATTGTATTATATGTGATTTACATTTCACTTTTTTTGTTGGCGTTGTTAACCCGGAGAGTGCTCCTGTATTGAACTTTGCTG
TTAGTTATTTTATTGCTTCTTTTTGGAGAGTGCTATAAAAGACTATTCTAATGAAAACATTAAAATTTACAATTTGACATACAAAAAGGG
GTTGTCCATTGATTTTAACCAATGTAGCACTGAGAGAGAGAGAGGTTAATTATAGATAGACAAGAGTGGTGTTTGTTGTTTTTCCCCTCC
CAGCATTGAAATCATTGGGGCTTGTCAGATGTATTAAAAAAAGATTTGTTGTGCTATTGCTGCAAACACTTAATAACTAGAGGAGAATTT

>In-frame_SZRD1_ENST00000471507_chr1_16693803_+_PRDM2_ENST00000235372_chr1_14075856_+_6938nt
AAGATGGCTGCCCTAATGTACACTTGGGACCTTGCCTGGCGCCTCTTCCGGGCTTGGCAGCGGGCGGGGTCCATTGAGTAAAGCCTTGCG
TGCCTGCGCCCGCGACGGAGGCGCGCTTCAAAGCGCAGGCGCGGGGAGGGGGTGGGGGAGGAGGGAAAGCGGCGAGTAAGATGGAAGATG
AGGAGGTCGCTGAGAGCTGGGAAGAGGCGGCAGACAGCGGGCCAATCGCGCCGGGCGAGGAGCTCCTGGTCTGGTACAATGGGGAAGACA
ACCCTGAGATAGCAGCTGCGATTGAGGAAGAGCGAGCCAGCGCCCGGAGCAAGCGGAGCTCCCCCAAGAGCCGGAAAGGGAAGAAAAAAT
CCCAGGAAAATAAAAACAAAGGAAACAAAATCCAAGACATACAACTGAAGACAAGTGAGCCAGATTTCACCTCTGCAAATATGAGAGATT
CTGCAGAAGGTCCTAAAGAAGACGAAGAGAAGCCTTCAGCCTCAGCACTTGAGCAGCCGGCCACCCTCCAGGAGGTGGCCAGTCAGGAGG
TGCCTCCAGAACTAGCAACCCCTGCCCCTGCCTGGGAGCCACAGCCAGAACCAGACGAGCGATTAGAAGCGGCAGCTTGTGAGGTGAATG
ATTTGGGGGAAGAGGAGGAGGAGGAAGAGGAGGAGGATGAAGAAGAAGAAGAAGATGATGATGATGATGAGTTGGAAGACGAGGGGGAAG
AAGAAGCCAGCATGCCAAATGAAAATTCTGTGAAAGAGCCAGAAATACGGTGTGATGAGAAGCCAGAAGATTTATTAGAGGAACCAAAAA
CAACTTCAGAAGAAACTCTTGAAGACTGCTCAGAGGTAACACCTGCCATGCAAATCCCCAGAACTAAAGAAGAGGCCAATGGTGATGTAT
TTGAAACGTTTATGTTTCCGTGTCAACATTGTGAAAGGAAGTTTACAACCAAACAGGGGCTTGAGCGTCACATGCATATCCATATATCCA
CCGTCAATCATGCTTTCAAATGCAAGTACTGTGGGAAAGCCTTTGGCACACAGATTAACCGGCGGCGACATGAGCGGCGCCATGAAGCAG
GGTTAAAGCGGAAACCCAGCCAAACACTACAGCCGTCAGAGGATCTGGCTGATGGCAAAGCATCTGGAGAAAACGTTGCTTCAAAAGATG
ATTCGAGTCCTCCCAGTCTTGGGCCAGACTGTCTGATCATGAATTCAGAGAAGGCTTCCCAAGACACAATAAATTCTTCTGTCGTAGAAG
AGAATGGGGAAGTTAAAGAACTTCATCCGTGCAAATATTGTAAAAAGGTTTTTGGAACTCATACTAATATGAGACGGCATCAGCGTAGAG
TTCACGAACGTCATCTGATTCCCAAAGGTGTACGGCGAAAAGGAGGCCTTGAAGAGCCCCAGCCTCCAGCAGAACAGGCCCAGGCCACCC
AGAACGTGTATGTACCAAGCACAGAGCCGGAGGAGGAAGGGGAAGCAGATGATGTGTACATCATGGACATTTCTAGCAATATCTCTGAAA
ACTTAAATTACTATATTGATGGTAAAATTCAAACTAATAACAACACTAGTAACTGTGATGTGATTGAGATGGAGTCTGCTTCGGCAGATT
TGTATGGTATAAATTGTCTGCTCACTCCAGTTACAGTGGAAATTACTCAAAATATAAAGACCACACAGGTCCCTGTAACAGAAGATCTTC
CTAAAGAGCCTTTGGGCAGCACAAATAGTGAGGCCAAGAAGCGGAGAACTGCGAGCCCACCTGCACTGCCCAAAATTAAGGCCGAAACAG
ACTCTGACCCCATGGTCCCCTCTTGCTCTTTAAGTCTTCCTCTTAGCATATCAACAACAGAGGCAGTGTCTTTCCACAAAGAGAAAAGTG
TTTATTTGTCATCAAAGCTCAAACAACTTCTTCAAACCCAAGATAAACTAACTCCTGCAGGGATTTCAGCAACTGAAATAGCTAAATTAG
GTCCTGTTTGTGTGTCTGCTCCTGCATCAATGTTGCCTGTGACCTCAAGTAGGTTTAAGAGGCGGACCAGCTCTCCTCCCAGTTCTCCAC
AGCACAGTCCTGCCCTTCGAGACTTTGGAAAGCCAAGTGATGGGAAAGCAGCATGGACCGATGCCGGGCTGACTTCCAAAAAATCCAAAT
TAGAAAGTCACAGCGACTCACCAGCATGGAGTTTGTCTGGGAGAGATGAGAGAGAAACTGTGAGCCCTCCATGCTTTGATGAATATAAAA
TGTCTAAAGAGTGGACAGCTAGTTCTGCTTTTAGCAGTGTGTGCAACCAGCAGCCACTGGATTTATCCAGCGGTGTCAAACAGAAGGCTG
AGGGTACAGGCAAGACTCCAGTCCAGTGGGAATCTGTCTTAGATCTCAGTGTGCATAAAAAGCATTGTAGTGACTCTGAAGGCAAGGAAT
TCAAAGAAAGTCATTCAGTGCAGCCTACGTGTAGTGCTGTAAAGAAAAGGAAACCAACCACCTGCATGCTGCAGAAGGTTCTTCTCAATG
AATATAATGGCATCGATTTACCTGTAGAAAACCCTGCAGATGGGACCAGGAGCCCAAGTCCTTGTAAATCCCTAGAAGCTCAGCCAGATC
CTGACCTCGGTCCGGGCTCTGGTTTCCCTGCCCCTACTGTTGAGTCCACACCTGATGTTTGTCCTTCATCACCTGCCCTGCAGACACCCT
CCCTTTCATCCGGTCAGCTGCCTCCTCTCTTGATCCCCACAGATCCCTCTTCCCCTCCACCCTGTCCCCCGGTATTAACTGTTGCCACTC
CGCCCCCTCCCCTCCTTCCTACCGTACCTCTTCCAGCCCCCTCTTCCAGTGCATCTCCACACCCATGCCCCTCTCCACTCTCAAATGCCA
CCGCACAGTCCCCACTTCCAATTCTGTCCCCAACAGTGTCCCCCTCTCCCTCTCCCATTCCTCCCGTGGAGCCCCTGATGTCTGCCGCCT
CACCCGGGCCTCCAACACTTTCTTCTTCCTCCTCTTCATCTTCCTCCTCCTCTTCGTTTTCTTCTTCATCTTCCTCCTCTTCTCCTTCTC
CACCTCCTCTCTCCGCAATATCATCTGTTGTTTCCTCTGGTGATAATCTGGAGGCTTCTCTCCCCATGATATCTTTCAAACAGGAGGAAT
TAGAGAATGAAGGTCTGAAACCCAGGGAAGAGCCCCAGTCTGCTGCTGAACAGGATGTTGTTGTTCAGGAAACATTCAACAAAAACTTTG
TTTGCAACGTCTGTGAATCACCTTTTCTTTCCATTAAAGATCTAACCAAACATTTATCTATTCATGCTGAAGAATGGCCCTTCAAATGTG
AATTTTGTGTGCAGCTTTTTAAGGATAAAACGGACTTGTCAGAACATCGCTTTTTGCTTCATGGAGTTGGGAATATCTTTGTGTGTTCTG
TTTGTAAAAAAGAATTTGCTTTTTTGTGCAATTTGCAGCAGCACCAGCGAGATCTCCACCCAGATAAGGTGTGCACACATCACGAGTTTG
AAAGCGGGACTCTGAGGCCCCAGAACTTTACAGATCCCAGCAAGGCCCATGTAGAGCATATGCAGAGCTTGCCAGAAGATCCTTTAGAAA
CTTCTAAAGAAGAAGAGGAGTTAAATGATTCCTCTGAAGAGCTTTACACGACTATAAAAATAATGGCTTCTGGAATAAAGACAAAAGATC
CAGATGTTCGATTGGGCCTCAATCAGCATTACCCAAGCTTTAAACCACCTCCATTTCAGTACCATCACCGTAACCCCATGGGGATTGGTG
TGACAGCCACAAATTTCACTACACACAATATTCCACAGACTTTCACTACCGCCATTCGCTGCACAAAGTGTGGAAAAGGTGTCGACAATA
TGCCGGAGTTGCACAAACATATCCTGGCTTGTGCTTCTGCAAGTGACAAGAAGAGGTACACGCCTAAGAAAAACCCAGTACCATTAAAAC
AAACTGTGCAACCCAAAAATGGCGTGGTGGTTTTAGATAACTCTGGGAAAAATGCCTTCCGACGAATGGGACAGCCCAAAAGGCTTAACT
TTAGTGTTGAGCTCAGCAAAATGTCGTCGAATAAGCTCAAATTAAATGCATTGAAGAAAAAAAATCAGCTAGTACAGAAAGCAATTCTTC
AGAAAAACAAATCTGCAAAGCAGAAGGCCGACTTGAAAAATGCTTGTGAGTCATCCTCTCACATCTGCCCTTACTGTAATCGAGAGTTCA
CTTACATTGGAAGCCTGAATAAACACGCCGCCTTCAGCTGTCCCAAAAAACCCCTTTCTCCTCCCAAAAAAAAAGTTTCTCATTCATCTA
AGAAAGGTGGACACTCATCACCTGCAAGTAGTGACAAAAACAGTAACAGCAACCACCGCAGACGGACAGCGGATGCGGAGATTAAAATGC
AAAGCATGCAGACTCCGTTGGGCAAGACCAGAGCCCGCAGCTCAGGCCCCACCCAAGTCCCACTTCCCTCCTCATCCTTCAGGTCCAAGC
AGAACGTCAAGTTTGCAGCTTCGGTGAAATCCAAAAAACCAAGCTCCTCCTCTTTAAGGAACTCCAGCCCGATAAGAATGGCCAAAATAA
CTCATGTTGAGGGGAAAAAACCTAAAGCTGTGGCCAAGAATCATTCTGCTCAGCTTTCCAGCAAAACATCACGGAGCCTGCACGTGAGGG
TACAGAAAAGCAAAGCTGTTTTACAAAGCAAATCCACCTTGGCGAGTAAGAAAAGAACAGACCGGTTCAATATAAAATCTAGAGAGCGGA
GTGGGGGGCCAGTCACCCGGAGCCTTCAGCTGGCAGCTGCTGCTGACTTGAGTGAGAACAAGAGAGAGGACGGCAGCGCCAAGCAGGAGC
TGAAGGACTTCAGCTACAGCCTCCGCTTGGCGTCCCGATGCTCTCCACCAGCGGCCCCGTACATCACCAGGCAGTATAGGAAGGTCAAAG
CTCCAGCTGCAGCCCAGTTCCAGGGACCATTCTTCAAAGAGTAGACACTCTGGCTGCTCCCTGACAGCACCTGAAGTGACCTGGAATCAG
TGAAGCCAAAGGGACTGGCAGTCTGCCCTGCAGGGAGTACCGACCTATCCCAGTTGTGTGAGGCTGCGAGAGAAAGGGAGTGCATGTGCG
CGCGTGCATGTGTGCGTGCGTGTGTGTTCACGTGTTCTCGTGCGGGCGCGTGAGTGGTCTTCAAACGAGGGTCCCGATCCCCGGGGCGGC
AGGAAGGGGGCCGACTCCACGCTGTCCTTTGGGATGATACTTGGATGCAGCTCTTGGGACCGTGTTCTGCAGCCCAGCCTTCCTGTTGGG
GTGGGGCCTCTCCTACTATGCAATTTTTCAAGAGCTCCTTGACCCTGCTTTTTGCTTCTTGAGTTGTCTTTTGCCATTATGGGGACTTTG
GTTTGACCCAGGGGTCAGCCTTAGGAAGGCCTTCAGGAGGAGGCCGAGTTCCCCTTCAGTACCACCCCTCTCTCCCCACCTTCCCTCTCC
CGGCAACATCTCTGGGAATCAACAGCATATTGACACGTTGGAGCCGAGCCTGAACATGCCCCTCGGCCCCAGCACATGGAAAACCCCCTT
CCTTGCCTAAGGTGTCTGAGTTTCTGGCTCTTGAGGCATTTCCAGACTTGAAATTCTCATCAGTCCATTGCTCTTGAGTCTTTGCAGAGA
ACCTCAGATCAGGTGCACCTGGGAGAAAGACTTTGTCCCCACTTACAGATCTATCTCCTCCCTTGGGAAGGGCAGGGAATGGGGACGGTG
TATGGAGGGGAGGGATCTCCTGCGCCCTTCATTGCCACACTTGGTGGGACCATGAACATCTTTAGTGTCTGAGCTTCTCAAATTAGCTGC
AATAGGAAAAAAACAAATTGGGAAATGAAAAAAAAATGGGAAGATTAAAAAGCACAGGGGGAAGAAGAAGAGATTTCGGAGGCCATCCTG
CCAGGGGCGGACGGGGCTGACTCCTGCTCTCTGGAGGACGGTCAGTCCATGTCTCGGAGAAACGGGTGAGCTGAGCTTGGCGTTTGGACC
CAGTTCAGTGAGGTTCTTGGGTTTTGTGCCTTTGGGGCAGACCCCAGGCAAGGATGTCTGAGACCACTTGGGCGCTGTTTTCTCAGCTCC
AATTTCAAGAGTGAGCTATCAAACCCAGAGCGGAAGGAGGGAGCTCTGATGAGCACGGTTTGTCACACGATAAAGGGATTTTTTTTTTCA
GGGCTACTACGGTTGATCTTGCAACTCTGTAAATATGTATGTAGACACTTTTAAAAGCACGTATTTATGTCCCTGACTGTAAATGCTCCA
TTTTTAAAGTTTTATAACTTGTGTTATTTAATGAGTCAGTCAATCGGCTGCAGTATGGGATCTGATAAGGATCTAGGAGAAGGGTCTCAT
GCGGACCCTCACATGGGCAGAAAAATGGTGGTCATTGGCCGACATCACAGTTTTCCTGTTTCCCACCCAGCTAAAAACCGTTGTTTGCTT
TAAATTTTCATAAACTGGAATCCTTTCACCCGCTCCTACAGCTAACCCTCACAAGCATGAAGTGCTGTGGCTGTTCCTTATCCTAATGAT
GCGCTTTTGTCCCGTAAATGTTAACACTCATGAAGCATACCCCGGCCTCTCAGTTCTTGAGGGCCTCCCCACCGCAGCAGCAAGGAAAGC
TCACGAACCCCAAACCTGGCAAGTCACCTGCAGCCCATGGTGAGCTCTGGGAAGTGTGGTTGAGGCCTTGGGGTCACTCCTTTTTTGCAT
GTGCAAATGTGCTGGTCACCCTTCAACGCTCCCAGACGGTCAGGAAAACTGTTCCAATCATGAAAAGGGGGGATGATTTTGTAAAAGTGG
CATTTCCTGGTCAGTGGTGGTCTTCAAGACGACAGCTCTGTATCTGCCATGTGAAGAGAATTAACAATAAAAGTGTGAAGAGCGATTGTG


Top

FusionGenePPI for SZRD1_PRDM2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SZRD1ELAVL1, EHD4, P3H1, MTMR2, NT5C2, SRP14, SRP9, ZPR1, ENO1, MOV10, NXF1, STRAP, TOM1L2, TRIM25PRDM2ESR1, RB1, PRDM2, PGR, EP300, SRC, TP53, E2F1, HIST3H3, HIST1H3A, CTBP1, MDM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SZRD1_PRDM2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SZRD1_PRDM2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePRDM2C0005695Bladder Neoplasm1CTD_human
TgenePRDM2C0040136Thyroid Neoplasm1CTD_human
TgenePRDM2C0236733Amphetamine-Related Disorders1CTD_human