FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36830

FusionGeneSummary for SUZ12_VANGL1

check button Fusion gene summary
Fusion gene informationFusion gene name: SUZ12_VANGL1
Fusion gene ID: 36830
HgeneTgene
Gene symbol

SUZ12

VANGL1

Gene ID

23512

81839

Gene nameSUZ12, polycomb repressive complex 2 subunitVANGL planar cell polarity protein 1
SynonymsCHET9|JJAZ1KITENIN|LPP2|STB2|STBM2
Cytomap

17q11.2

1p13.1

Type of geneprotein-codingprotein-coding
Descriptionpolycomb protein SUZ12chET 9 proteinchromatin precipitated E2F target 9 proteinjoined to JAZF1 proteinsuppressor of zeste 12 protein homologvang-like protein 1KAI1 C-terminal interacting tetraspaninloop-tail protein 2 homologstrabismus 2van Gogh-like protein 1vang-like 1 (van gogh, Drosophila)
Modification date2018052320180519
UniProtAcc

Q15022

Q8TAA9

Ensembl transtripts involved in fusion geneENST00000322652, ENST00000580398, 
ENST00000355485, ENST00000369510, 
ENST00000310260, ENST00000369509, 
ENST00000474344, 
Fusion gene scores* DoF score7 X 8 X 8=4486 X 5 X 4=120
# samples 96
** MAII scorelog2(9/448*10)=-2.31550182572793
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SUZ12 [Title/Abstract] AND VANGL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-D3-A5GU-06ASUZ12chr17

30323896

+VANGL1chr1

116202262

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000322652ENST00000355485SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000322652ENST00000369510SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000322652ENST00000310260SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000322652ENST00000369509SUZ12chr17

30323896

+VANGL1chr1

116202262

+
5CDS-intronENST00000322652ENST00000474344SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000580398ENST00000355485SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000580398ENST00000369510SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000580398ENST00000310260SUZ12chr17

30323896

+VANGL1chr1

116202262

+
In-frameENST00000580398ENST00000369509SUZ12chr17

30323896

+VANGL1chr1

116202262

+
5CDS-intronENST00000580398ENST00000474344SUZ12chr17

30323896

+VANGL1chr1

116202262

+

Top

FusionProtFeatures for SUZ12_VANGL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SUZ12

Q15022

VANGL1

Q8TAA9

Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27'(H3K27me) of histone H3, leading to transcriptional repression ofthe affected target gene. The PRC2/EED-EZH2 complex may also serveas a recruiting platform for DNA methyltransferases, therebylinking two epigenetic repression systems. Genes repressed by thePRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.{ECO:0000269|PubMed:15225548, ECO:0000269|PubMed:15231737,ECO:0000269|PubMed:15385962, ECO:0000269|PubMed:16618801,ECO:0000269|PubMed:17344414, ECO:0000269|PubMed:18285464,ECO:0000269|PubMed:28229514}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSUZ12chr17:30323896chr1:116202262ENST00000322652+151651_59624740Compositional biasNote=Poly-Ser
HgeneSUZ12chr17:30323896chr1:116202262ENST00000322652+151660_67624740Compositional biasNote=Poly-Ala
HgeneSUZ12chr17:30323896chr1:116202262ENST00000322652+15167_50624740Compositional biasNote=Gly-rich
HgeneSUZ12chr17:30323896chr1:116202262ENST00000322652+1516448_471624740Zinc fingerNote=C2H2-type
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18139_15123525Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18173_18223525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18204_22223525Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18244_52423525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18139_15123525Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18173_18223525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18204_22223525Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18244_52423525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07139_15123525Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07173_18223525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07204_22223525Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07244_52423525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18139_15123523Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18173_18223523Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18204_22223523Topological domainExtracellular
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18244_52423523Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18118_13823525TransmembraneHelical%3B Name%3D1
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18152_17223525TransmembraneHelical%3B Name%3D2
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18183_20323525TransmembraneHelical%3B Name%3D3
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+18223_24323525TransmembraneHelical%3B Name%3D4
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18118_13823525TransmembraneHelical%3B Name%3D1
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18152_17223525TransmembraneHelical%3B Name%3D2
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18183_20323525TransmembraneHelical%3B Name%3D3
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+18223_24323525TransmembraneHelical%3B Name%3D4
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07118_13823525TransmembraneHelical%3B Name%3D1
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07152_17223525TransmembraneHelical%3B Name%3D2
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07183_20323525TransmembraneHelical%3B Name%3D3
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+07223_24323525TransmembraneHelical%3B Name%3D4
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18118_13823523TransmembraneHelical%3B Name%3D1
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18152_17223523TransmembraneHelical%3B Name%3D2
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18183_20323523TransmembraneHelical%3B Name%3D3
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+18223_24323523TransmembraneHelical%3B Name%3D4

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSUZ12chr17:30323896chr1:116202262ENST00000322652+1516563_639624740RegionNote=VEFS-box
TgeneVANGL1chr17:30323896chr1:116202262ENST00000310260+181_11723525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000355485+181_11723525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369509+071_11723525Topological domainCytoplasmic
TgeneVANGL1chr17:30323896chr1:116202262ENST00000369510+181_11723523Topological domainCytoplasmic


Top

FusionGeneSequence for SUZ12_VANGL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000355485_chr1_116202262_+_1126aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHC
PWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRE
RHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFL
GLLVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL
DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASK
FRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMD
PREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGI

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000369510_chr1_116202262_+_1124aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHC
PWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRE
RHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGL
LVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDS
RDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFR
AAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPR
EAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVF

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000310260_chr1_116202262_+_1126aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHC
PWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRE
RHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFL
GLLVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL
DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASK
FRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMD
PREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGI

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000369509_chr1_116202262_+_1126aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHC
PWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRE
RHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFL
GLLVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL
DSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASK
FRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMD
PREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGI

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000355485_chr1_116202262_+_1103aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSR
FIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNR
LYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRERHKSPRNKDGRGSEKSVTIQPPT
GEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRDEL
EPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLF
IHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNAT
GQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRIT
RQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIIL

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000369510_chr1_116202262_+_1101aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSR
FIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNR
LYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRERHKSPRNKDGRGSEKSVTIQPPT
GEPLLGNDSTRTEEDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRDELEP
CGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIH
YLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQ
SRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQ
QNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSE

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000310260_chr1_116202262_+_1103aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSR
FIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNR
LYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRERHKSPRNKDGRGSEKSVTIQPPT
GEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRDEL
EPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLF
IHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNAT
GQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRIT
RQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIIL

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000369509_chr1_116202262_+_1103aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSR
FIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNR
LYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGERTRERHKSPRNKDGRGSEKSVTIQPPT
GEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRDEL
EPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLF
IHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNAT
GQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRIT
RQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIIL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000355485_chr1_116202262_+_3378nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGC
CCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTAT
CATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCT
GGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATG
TCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACC
TGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATT
GAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAG
AGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAAT
GATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAA
GAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTT
GGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGT
GAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATG
CCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTG
GACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTC
CTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACAC
CTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAA
TTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATT
GCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCA
AGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGAC
CCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGC
ATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCC
ACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATT
GTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCC

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000369510_chr1_116202262_+_3372nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGC
CCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTAT
CATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCT
GGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATG
TCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACC
TGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATT
GAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAG
AGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAAT
GATTCTACTCGGACAGAGGAAGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAAGAGGAC
ATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTTGGACTT
CTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGTGAGGGG
CTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATGCCACGG
GTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTGGACTCT
CGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTCCTGCTG
GAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACACCTGAGT
ATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAATTCCGA
GCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATTGCTGCA
GCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCAAGGCTG
GTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGACCCTAGG
GAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGCATGGAG
AGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCCACCCTG
CAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATTGTGTTC
GTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCCAAATCT

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000310260_chr1_116202262_+_3378nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGC
CCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTAT
CATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCT
GGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATG
TCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACC
TGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATT
GAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAG
AGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAAT
GATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAA
GAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTT
GGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGT
GAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATG
CCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTG
GACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTC
CTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACAC
CTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAA
TTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATT
GCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCA
AGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGAC
CCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGC
ATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCC
ACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATT
GTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCC

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000369509_chr1_116202262_+_3378nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGC
CCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTAT
CATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCT
GGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATG
TCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACC
TGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATT
GAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAG
AGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAAT
GATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAA
GAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTT
GGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGT
GAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATG
CCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTG
GACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTC
CTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACAC
CTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAA
TTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATT
GCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCA
AGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGAC
CCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGC
ATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCC
ACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATT
GTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCC

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000355485_chr1_116202262_+_3309nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACC
TCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGC
CTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTG
GAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTC
CGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTT
TTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTC
ATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCC
CGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCA
AACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACT
GGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGG
CGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAA
GCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACC
CGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAA
CGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACT
AATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTC

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000369510_chr1_116202262_+_3303nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACCTCGGAG
CACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGCCTCACC
GTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCT
TGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTCCGCAAG
CGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTAC
GGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTCATCCAT
TACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTC
TACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCAAACCTC
CTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACTGGCCAG
TCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGGCGAGTA
AAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCA
GGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACCCGGCAG
CAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAACGGTAC
CTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACTAATGGA
TTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTCTCTGAA

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000310260_chr1_116202262_+_3309nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACC
TCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGC
CTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTG
GAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTC
CGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTT
TTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTC
ATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCC
CGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCA
AACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACT
GGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGG
CGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAA
GCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACC
CGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAA
CGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACT
AATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTC

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000369509_chr1_116202262_+_3309nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACC
TCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGC
CTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTG
GAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTC
CGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTT
TTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTC
ATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCC
CGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCA
AACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACT
GGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGG
CGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAA
GCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACC
CGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAA
CGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACT
AATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000355485_chr1_116202262_+_10452nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTA
TAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACT
CAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTG
TTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACC
TATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCA
AAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGA
AGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGAT
GAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGA
AAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGG
AGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGT
GGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTT
ACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCT
GCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCAT
CTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGC
AGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCA
GGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTA
CTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAA
TGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTT
GTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCA
GCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAG
GGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAA
CGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTG
GAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAA
TGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATC
CGTTTAAAAGTTCTATATTTGTGGCTTTATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTT
AAAAATTCTTCTTCATTGCTGACTGAAACTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGC
TGTCCACCCTGAAAAAGAGTGACTGATGACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCT
GTAAACCAAAGTGGAGCTGGTGCTTCTTGGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCT
GGTCAGCCCACTTGTAGACTTCCAGGGGACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATG
TTAATGTCCAGTATCACATCACCCATGAAAGTCGTGGGCAGTTCAGGAGATACCTGCCTTCATCTTTGTTCTTTGTTGCCTTAGGTTCTT
CAGAGAAAGATCACAACAAAAAATGTACACTGTCGTTTACAGCTATTAAGTGATTTGATTTTGTTTTTTTCCCAAAGAGAAAACCTACCT
GCCCTGTTTCTGATCCCACCCCTCTGCTGGCTTGAAGCAGGTAACCCTTTCCCAGCCCTGCAGCTGCCCACCTGGCCTCCATGCCATCCT
GCCCCCACCTGGCTGGCAGCCCTGGCTCTCCATGTGTGCCCTCCGGCTCTGTGTGAAGCCTCAAGTCAGTCCCAGCATTGTTTCCATAGG
GAAGTGTGGGGTGCCCAGCAGGTAAAGCACAGGGAGAGAGGGCAGTGGGAATGCCACCTTTAGGCTGCAGCAGGAGCCCCACACTGCCCA
GTTTTCCTCCCCACTGTTCTACACCAACCAGGGGAGACTAACACTGTGACTCTGGGATTGGCAGGTGCAACTTGGAGCCACTTAATTTCC
TGGGGACGTAAGTTCTTCCCAAGCTTAGAGCAAGCTGCCCTGCCAAAGGAGACCAAACCATGCCAACCACGCTGGCAACTGCTGCTGTCC
AGTCCCTGTGTTTTCTGACCACCGTCACTGTGCAACTCATCGCCTCTGCCACTTAGGACCAGGAAAGAGGCTGGTTTTGCTCCCACTCTT
AGTTGCTGATAAAGTGGGGAGAAGGAAAATGGACACTCTACAGAGTTTGGGGAAGGGAGAGTAGGGAGCCCATCTTGTCCAGAAAGATTC
ATCTGTGGTCTGTCTGTTAAACACAGCTGATTTCAGTGGGCTTTCCCCTGGCCCTGGGGGAGCAGACACTGACTGGGTTGTGGGCAGAGG
AGCCATCCTGGCGGAGCCCTGCTGCAGGGGAGCTCCTTCAGGAGCCCCATCCGGACCTCTTGCACTGGGCTGCCTTTGCCTCCATTTGCC
TTCCTGTATCTGCAACAAACCTTTTAAAAGTGTTCACTCTTGCTTTTTCCAGTATTTCGGTAATCAGCCATCTTGCTGTAGTACAGGATG
ACATTGTCGAATGCTCTTTGTATGTGTGCACACCCCCTTACTCCCTTACTGCTTCATACACTCCACAAGTGGTACAGTATTTTGTGTCAT
TGTAAAAATCAAAATTGGCTTTGGATCTTTGTAATACACCTGTACCTGAAAAAGTAAACAACATTCTTCAATTACTAGCCTTCAGCTTGA
AAAGACATGCTGGAGAAGAAGGAAGGGGGAACCCATAGGTGTGGCGTGGAGCCAAGATGTACTATTCAACTATGTGTTTCTGTTTATAAA
AAACACATACCATGGAACCATGGTGCTTTTGTTCTTAGTTTTTGCCGTTAGATCCCTTCAAACTGGAAGTTCCTTACAATATCTTTCTCA
GGAAATATTTTGGGAAATGGGGTAAGAGATGGCAAGTGTGAGACGGGCTGTGTCAGAGGTTGCTACGTCATGGATACAGTGCAGTTCCAA
GTGCCATAAGTGTATGTACATATAGTTAATAATGACACTGTTCATCACCATTCTAAAATACTGTTCTTCCAACCCTATCTTCAATGACCA
GTCCAGAAGGGGTTAAGCTGGATTCATTTGCTCTGGCATGTGCATTCCCAGCAGGGTGAAGAAAGGTTTAAATTAAAGAATTTATTTTCT
CTCTCCCCCTTCCTCTTTCTCCCAGTCTTTGCATAGGAGAATGTTAGACATTCAGAAATTACTGTTTCTGTTTTAAATTGAGTATTGATT
TTTTTATATTGACTTTGTATTGAGTTCTTTTTGAAAGAATAACAAAATAAAATGCAGGATCTTTGTAAAGCCTTTGCACTTTCAACCTCT
TTATAGCTTGAGTTACTTTTGCAGTGGGAACAATGTAAATGACATTTAAAAGATTTAAGGTTTCAGAAAGCTGCATCCCACAATTGAACA
CAATGCATTTTTATTTCAATTCTTGGAACTGGTAGGCTATTCTTTTTAAAAGGGGGTAAACTTCGCCCTAAGGCTGGTAGAATGTATGTT
CACATTATAGTAGACAGGATTTCATTTGCCTTATATGTTTATAGATTTTTTATAATTTTCATCCTACGTTATTAAAATTAGAGCATTGAG
TGTTAAAGAACTTAATGAGGAGTCTATATCTGAGATTGCTCTCTTCCCTGGTGATGTTTTAACTGGTAGATAATTTGTTCTTAAATATGT
ACTTTTGAAGATAGGACAGTTTTTATAGTCCATGAACTGAATGTTAAAAAGTTCTGTATGCATTCTCAGAGAGGATTTTAAAGCTATATA
GTTCATCCATCCTTTGCATTATCAAAATGTTAAGTCAAATCTGTAATACTTTGGCTAAAATTCATAAAGTAAGCCCTAGAGAAAATACTT
GACCACCAAATTTTTGCCCAACTATCATCACCTCCCTTCCCCCGCCTCTGTTCTTGCCTTTTGACATCTACATGGAAGACAAGTTCTTTA
CAGCAAATGGTAAGAGGCAGGTGACCTGGTGTGTTTGCTGTGTTGTAGTTCATTGCCTGGGGCTTGGGACTCCTTTTTTAATGGAGAGAC
TAGCTGTGCAGGTGTGTGTTGGATAGGGATAAAGTGCTCACCCCTGCCCTCTCTACAGTAGTTGGTGGTAGATTTCTCTCTCATTTTGCC
TCATAATCACTTTCGAGTGCATGTATTTACCTAAGGGCTGTAGCTCTGTGGGATGCTACCAGCATATTGGACTGACAGAAATTGATTACC
TTGCCACTCCAACCTACGTACTGAGTGAGTGCTCCAGCCACTCAGTGAAACCAACAAAAGTGAGTCCTTGGTTTACCTTCCAATCTGGGT
CCTGCTGTGTAAGTATCCCTAAGTGGGGATGCATATTTGTTTGTGCGTTTTTATTTCCATATATGTGAGCATTTCTCTGAGTGTATTACC
AGACGGATAGCACATTTATATGTCAGACATCTTAACATCTGTGTTATCTGTAGCAGGTGTGTAGCTCAGCAGATACGTGTCATTGTGTAT
ATAGCTGAGTGTGTGAGGGTGTCTGTGTTTCTGCAGTCCCCTGTGTTTGAGAGATGACTTAATAACCCTGTGTTTTGAGAGGTCGCTCTA
AACCAGTGACTTTTCCCTCCCCTGCTTTATTCCTTTCCCTCACTGACACTGGCTTCTCCCGCTAGAGTAAATGGCTTTAGCACAGCACTG
TCTTCTGGGGAGCCTGCTGTCCTGCAGGCAAGTCCATTAAACTCTTTCTTGCTTTAGGACTCTGAAAACAGCAAGAAACAAACAAACAAA
GGTCAAGCTCTAAGAAAATTACTGCTCAAACTTCACTACCCTGGAAGCCTTACTAGATATTTCTTAAGGTAACTTAAAAATTGGGCTTTA
TTTTTAAAAAGTGATAGGTTACTTACAGTAGCACAGAAATGTTAGCATATTTATTTAAATAGTCCTGCAGCAGAGACCCTGCGATTGTAA
AGTGATTTAAGTATTTCTGGGTAGTGTTTGTGATTTACGGATTTGTTACTGAAAAACAAAAAAATCACTACTGTGAATTTACTACTATGT
AACCTTGTGGTCGTATTTCATTATAAATAAAATAAGAATTGCTCTTCTGCCCACCGTTCTTGATTGGTATTCAGTGCAGTAGCGAAATGA
GATAGTTTAGACACTGTTGAAATAACTGCATTGAGCTTTAACCAAGTGTATGCTCAGAAAATTCAGTTTTGGATCACATTTTGACAAAAC
ATGTTTTGGTCAAAGAAAGGAAAGGCTACTAACACATTTATCAGGTAATGTATGTCACAGTCCGTGTTCCACCCAGCCTTGTTATCCCCA
CATTCTTTCAAGATAGGAGTCATCTTGGTTTTTCGGGTGAAAAACGGAAGGTCAGAGAGGAAGGGGCTTGTCCAAGGTCTCATGTCTGGT
TAACAGAATTTCAAACTAGATGTTTGATTCTAACCCCTCAGTCCACTGTACCTTGAAGTATGGTCTAAATGATTCGGCACTTCTGGATGT
TGAGGAAGGACCTAGAGACACATCCTTGAACTAGAACCTGGGGTGAGAGTTCATTGGGAGGCAGGATCTCTTCTTTCACTTTGGATTTAC
ACCTTGTCCCTTGGAAAGCTTCTCCACTATGCTAGCAAATATCTTAGGATATTTGATGGAAAGAACTTGAGAATCCCTTCTGGAAAACCC
AGCCTTTCAGTGTTAACACCTGCTGCAAGACAGGGATGCTGTTGTTCTGGCAGCCCCCCTTTGCTTTTGCCTGGCCCCACCTTCTGCTCC
CACTCTGCTGGCTTGGGCAAGATGCGTGCCTTGGGCCTTGGGTGCAGGGAGGCAGGCAGGGGCTTGACCTGGCCTCTCTCTGGTGCCATG
GCAACATTATGCCCCAAACTTCTTCCCTGGTTGGAGTGAGAGGGGCTGTCCACAGCCCCATCCTGTGGGGATCTCAAGCCGGAGTCCCTG
GCCTGGCCTCCTTGACGTAGGTGTTCTCAGCAAGCAGTTTGCATCCCACCGTCTTTCTCACACTTGCCCCCAAGACTTTTGACAGAGCAG
ACGTAAAACAGGACTCAGAAAACCATTTTTCTCTGTTCCCATATGTAGTAAGTTTTGATTCAGTTGTGCATAAACCATAGTTTTCTGCCC
TGCTGTTTGCTTTCAATGGAAGACAGTAAAGGGAAGATGGTGCTCACATCTCTCCATGTGACATCTCATTAGGAATTAAGATGCGATGGA
TTAGAAATGTAAAACTTCAGAATAAAATTAAATTTCAGGGCTCTATAAGTCCCGTTTTCCCAGGTCCTGTTCCGTTTCTACGTAGATAAC
CCAATTTGTTTTGTCTATGAAATAAGCCTCTTTAGTGGGTTGTTTTAGTCTCTCCAACAAAAGAGCAGATTCCTAAAGCCAGGTGCAGCA
CTGTGAAAAGTTTCTTTCAATATGGCACCAAGACTCTACCATTTATGTCTCTCTCAGCTTACAAACATCAGCGTTTTGTCCTTGTCATAG
TGGAAGAAAGACACTTACTTTAAGCTTTGGGGACAAAGGTGACAAACCCCAGGCTTTTATCTTAAAAGTGTCTTTGGCACTTCTTTTGGC
ACTGAAATGGTATTTGGGAAGCATTATTTGAATGTACAGTTGTTTGGTTTTGTATGTGCTTATCTTTATCTGAGCTTTCACTTGTAGACA
TGGCCTTTTGTTGTGAAGTTGCTCATCATTTAGGAGTGTTTAATTCTAAAAAGCCTTCAGCCTAAGAAAGCTTCATCTGTGGGGACCAGA
GACTTGTTGCTCAGGGAGTTAGTGATGGGACTTGGGCATCTGATCTGCAGGTGACAAGTTTAGTTCAACTGAAGTTGTAGGGAATTTAGA
CAGTTGCACATCATTGCCGTTCTAGGGGCCTTGTAGAAAGATGAAACAGTTGTTTTTCATTTACCAGCACCTCTCAGTTATAGAGGTAAT
GGAACATTCGCTTACTTTTCATCATCATTCTTTAAAAAGGGAACATACAAAAATCTAAACTATGGCAATAATTTATTTTTATAATAGTTT
ACGGTAGGCTTTAATTAAATGGCAAACTCCTCTGGGACCCCTAAGTTATGGCGTGATTAGCCAAATTTGATTTCCAACAGTCATTTATGG
CCATAACTATTGCATAGAGTGCAGGATGCCAGCAAAGATGAGGGTGGGGGCAGATACTGGCTCAGTGATTTAACTCACATTATAGATGAC
CCCTTCCTCAACAGAAATGCTACTGAGAGAACCAGAGAGGCCTGGGCCAGGCAGGTCTTATTTGAGAGGAGATTATTTGATAATTGCTTT
GGTTAGAAGGACTTTACATTTCCTGATTTCAAGTCCAGCACCAATTTAGAAAGTTCAGAGATGAAACCACCTGTCTTTACCTGACAGAGT
CATAACGGTTTGTGTAAAAATGTGGTCAGGGACCTTTTTTGTTCTTTCTGATTAGTTAATACTGTACATTGTAACCAGGAGGGGCAGTTT
TGCCAACCAGCCTCTGCTCATGGTCACCATATGTGTATGACAAGGCCTGAGTGAGTTCCTGCATAAACTGGGTAGTGGGCTCTTTTGACA
CATTTGCAAGCATGTAAATGAATGAATGACACTACCAGCAACCATCTGTACAGGTCCATTTACTTACATTCATAAGGTTTATGCTATGAA
ACTTCTTCTCATTGTGATGTCAGTAACAGAGTTAGTGTCTCTGATGGAATAGTGTACCTGTCACCCAAGTTATTTTGTTCCTTTTTGGGT
CCTCCAGTATAATCCCCCCCTCATCCCAATTAACTGTAAAATGTTTTACACATCACATTTTTTATACTGTAAACTTGGAAAATAAACTGA

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000369510_chr1_116202262_+_10446nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTA
TAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACT
CAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTG
TTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACC
TATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCA
AAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGA
AGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGAT
GAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGA
AAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGATGACAACTGGGGAGAGAC
CACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCT
GGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCC
GATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCAT
AGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCT
CTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTC
CCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGT
CCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAA
AGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGA
TGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTA
TGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCT
CCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCT
CCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCAT
GACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCT
TGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAA
GAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATCCGTTTA
AAAGTTCTATATTTGTGGCTTTATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTTAAAAAT
TCTTCTTCATTGCTGACTGAAACTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGCTGTCCA
CCCTGAAAAAGAGTGACTGATGACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCTGTAAAC
CAAAGTGGAGCTGGTGCTTCTTGGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCTGGTCAG
CCCACTTGTAGACTTCCAGGGGACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATGTTAATG
TCCAGTATCACATCACCCATGAAAGTCGTGGGCAGTTCAGGAGATACCTGCCTTCATCTTTGTTCTTTGTTGCCTTAGGTTCTTCAGAGA
AAGATCACAACAAAAAATGTACACTGTCGTTTACAGCTATTAAGTGATTTGATTTTGTTTTTTTCCCAAAGAGAAAACCTACCTGCCCTG
TTTCTGATCCCACCCCTCTGCTGGCTTGAAGCAGGTAACCCTTTCCCAGCCCTGCAGCTGCCCACCTGGCCTCCATGCCATCCTGCCCCC
ACCTGGCTGGCAGCCCTGGCTCTCCATGTGTGCCCTCCGGCTCTGTGTGAAGCCTCAAGTCAGTCCCAGCATTGTTTCCATAGGGAAGTG
TGGGGTGCCCAGCAGGTAAAGCACAGGGAGAGAGGGCAGTGGGAATGCCACCTTTAGGCTGCAGCAGGAGCCCCACACTGCCCAGTTTTC
CTCCCCACTGTTCTACACCAACCAGGGGAGACTAACACTGTGACTCTGGGATTGGCAGGTGCAACTTGGAGCCACTTAATTTCCTGGGGA
CGTAAGTTCTTCCCAAGCTTAGAGCAAGCTGCCCTGCCAAAGGAGACCAAACCATGCCAACCACGCTGGCAACTGCTGCTGTCCAGTCCC
TGTGTTTTCTGACCACCGTCACTGTGCAACTCATCGCCTCTGCCACTTAGGACCAGGAAAGAGGCTGGTTTTGCTCCCACTCTTAGTTGC
TGATAAAGTGGGGAGAAGGAAAATGGACACTCTACAGAGTTTGGGGAAGGGAGAGTAGGGAGCCCATCTTGTCCAGAAAGATTCATCTGT
GGTCTGTCTGTTAAACACAGCTGATTTCAGTGGGCTTTCCCCTGGCCCTGGGGGAGCAGACACTGACTGGGTTGTGGGCAGAGGAGCCAT
CCTGGCGGAGCCCTGCTGCAGGGGAGCTCCTTCAGGAGCCCCATCCGGACCTCTTGCACTGGGCTGCCTTTGCCTCCATTTGCCTTCCTG
TATCTGCAACAAACCTTTTAAAAGTGTTCACTCTTGCTTTTTCCAGTATTTCGGTAATCAGCCATCTTGCTGTAGTACAGGATGACATTG
TCGAATGCTCTTTGTATGTGTGCACACCCCCTTACTCCCTTACTGCTTCATACACTCCACAAGTGGTACAGTATTTTGTGTCATTGTAAA
AATCAAAATTGGCTTTGGATCTTTGTAATACACCTGTACCTGAAAAAGTAAACAACATTCTTCAATTACTAGCCTTCAGCTTGAAAAGAC
ATGCTGGAGAAGAAGGAAGGGGGAACCCATAGGTGTGGCGTGGAGCCAAGATGTACTATTCAACTATGTGTTTCTGTTTATAAAAAACAC
ATACCATGGAACCATGGTGCTTTTGTTCTTAGTTTTTGCCGTTAGATCCCTTCAAACTGGAAGTTCCTTACAATATCTTTCTCAGGAAAT
ATTTTGGGAAATGGGGTAAGAGATGGCAAGTGTGAGACGGGCTGTGTCAGAGGTTGCTACGTCATGGATACAGTGCAGTTCCAAGTGCCA
TAAGTGTATGTACATATAGTTAATAATGACACTGTTCATCACCATTCTAAAATACTGTTCTTCCAACCCTATCTTCAATGACCAGTCCAG
AAGGGGTTAAGCTGGATTCATTTGCTCTGGCATGTGCATTCCCAGCAGGGTGAAGAAAGGTTTAAATTAAAGAATTTATTTTCTCTCTCC
CCCTTCCTCTTTCTCCCAGTCTTTGCATAGGAGAATGTTAGACATTCAGAAATTACTGTTTCTGTTTTAAATTGAGTATTGATTTTTTTA
TATTGACTTTGTATTGAGTTCTTTTTGAAAGAATAACAAAATAAAATGCAGGATCTTTGTAAAGCCTTTGCACTTTCAACCTCTTTATAG
CTTGAGTTACTTTTGCAGTGGGAACAATGTAAATGACATTTAAAAGATTTAAGGTTTCAGAAAGCTGCATCCCACAATTGAACACAATGC
ATTTTTATTTCAATTCTTGGAACTGGTAGGCTATTCTTTTTAAAAGGGGGTAAACTTCGCCCTAAGGCTGGTAGAATGTATGTTCACATT
ATAGTAGACAGGATTTCATTTGCCTTATATGTTTATAGATTTTTTATAATTTTCATCCTACGTTATTAAAATTAGAGCATTGAGTGTTAA
AGAACTTAATGAGGAGTCTATATCTGAGATTGCTCTCTTCCCTGGTGATGTTTTAACTGGTAGATAATTTGTTCTTAAATATGTACTTTT
GAAGATAGGACAGTTTTTATAGTCCATGAACTGAATGTTAAAAAGTTCTGTATGCATTCTCAGAGAGGATTTTAAAGCTATATAGTTCAT
CCATCCTTTGCATTATCAAAATGTTAAGTCAAATCTGTAATACTTTGGCTAAAATTCATAAAGTAAGCCCTAGAGAAAATACTTGACCAC
CAAATTTTTGCCCAACTATCATCACCTCCCTTCCCCCGCCTCTGTTCTTGCCTTTTGACATCTACATGGAAGACAAGTTCTTTACAGCAA
ATGGTAAGAGGCAGGTGACCTGGTGTGTTTGCTGTGTTGTAGTTCATTGCCTGGGGCTTGGGACTCCTTTTTTAATGGAGAGACTAGCTG
TGCAGGTGTGTGTTGGATAGGGATAAAGTGCTCACCCCTGCCCTCTCTACAGTAGTTGGTGGTAGATTTCTCTCTCATTTTGCCTCATAA
TCACTTTCGAGTGCATGTATTTACCTAAGGGCTGTAGCTCTGTGGGATGCTACCAGCATATTGGACTGACAGAAATTGATTACCTTGCCA
CTCCAACCTACGTACTGAGTGAGTGCTCCAGCCACTCAGTGAAACCAACAAAAGTGAGTCCTTGGTTTACCTTCCAATCTGGGTCCTGCT
GTGTAAGTATCCCTAAGTGGGGATGCATATTTGTTTGTGCGTTTTTATTTCCATATATGTGAGCATTTCTCTGAGTGTATTACCAGACGG
ATAGCACATTTATATGTCAGACATCTTAACATCTGTGTTATCTGTAGCAGGTGTGTAGCTCAGCAGATACGTGTCATTGTGTATATAGCT
GAGTGTGTGAGGGTGTCTGTGTTTCTGCAGTCCCCTGTGTTTGAGAGATGACTTAATAACCCTGTGTTTTGAGAGGTCGCTCTAAACCAG
TGACTTTTCCCTCCCCTGCTTTATTCCTTTCCCTCACTGACACTGGCTTCTCCCGCTAGAGTAAATGGCTTTAGCACAGCACTGTCTTCT
GGGGAGCCTGCTGTCCTGCAGGCAAGTCCATTAAACTCTTTCTTGCTTTAGGACTCTGAAAACAGCAAGAAACAAACAAACAAAGGTCAA
GCTCTAAGAAAATTACTGCTCAAACTTCACTACCCTGGAAGCCTTACTAGATATTTCTTAAGGTAACTTAAAAATTGGGCTTTATTTTTA
AAAAGTGATAGGTTACTTACAGTAGCACAGAAATGTTAGCATATTTATTTAAATAGTCCTGCAGCAGAGACCCTGCGATTGTAAAGTGAT
TTAAGTATTTCTGGGTAGTGTTTGTGATTTACGGATTTGTTACTGAAAAACAAAAAAATCACTACTGTGAATTTACTACTATGTAACCTT
GTGGTCGTATTTCATTATAAATAAAATAAGAATTGCTCTTCTGCCCACCGTTCTTGATTGGTATTCAGTGCAGTAGCGAAATGAGATAGT
TTAGACACTGTTGAAATAACTGCATTGAGCTTTAACCAAGTGTATGCTCAGAAAATTCAGTTTTGGATCACATTTTGACAAAACATGTTT
TGGTCAAAGAAAGGAAAGGCTACTAACACATTTATCAGGTAATGTATGTCACAGTCCGTGTTCCACCCAGCCTTGTTATCCCCACATTCT
TTCAAGATAGGAGTCATCTTGGTTTTTCGGGTGAAAAACGGAAGGTCAGAGAGGAAGGGGCTTGTCCAAGGTCTCATGTCTGGTTAACAG
AATTTCAAACTAGATGTTTGATTCTAACCCCTCAGTCCACTGTACCTTGAAGTATGGTCTAAATGATTCGGCACTTCTGGATGTTGAGGA
AGGACCTAGAGACACATCCTTGAACTAGAACCTGGGGTGAGAGTTCATTGGGAGGCAGGATCTCTTCTTTCACTTTGGATTTACACCTTG
TCCCTTGGAAAGCTTCTCCACTATGCTAGCAAATATCTTAGGATATTTGATGGAAAGAACTTGAGAATCCCTTCTGGAAAACCCAGCCTT
TCAGTGTTAACACCTGCTGCAAGACAGGGATGCTGTTGTTCTGGCAGCCCCCCTTTGCTTTTGCCTGGCCCCACCTTCTGCTCCCACTCT
GCTGGCTTGGGCAAGATGCGTGCCTTGGGCCTTGGGTGCAGGGAGGCAGGCAGGGGCTTGACCTGGCCTCTCTCTGGTGCCATGGCAACA
TTATGCCCCAAACTTCTTCCCTGGTTGGAGTGAGAGGGGCTGTCCACAGCCCCATCCTGTGGGGATCTCAAGCCGGAGTCCCTGGCCTGG
CCTCCTTGACGTAGGTGTTCTCAGCAAGCAGTTTGCATCCCACCGTCTTTCTCACACTTGCCCCCAAGACTTTTGACAGAGCAGACGTAA
AACAGGACTCAGAAAACCATTTTTCTCTGTTCCCATATGTAGTAAGTTTTGATTCAGTTGTGCATAAACCATAGTTTTCTGCCCTGCTGT
TTGCTTTCAATGGAAGACAGTAAAGGGAAGATGGTGCTCACATCTCTCCATGTGACATCTCATTAGGAATTAAGATGCGATGGATTAGAA
ATGTAAAACTTCAGAATAAAATTAAATTTCAGGGCTCTATAAGTCCCGTTTTCCCAGGTCCTGTTCCGTTTCTACGTAGATAACCCAATT
TGTTTTGTCTATGAAATAAGCCTCTTTAGTGGGTTGTTTTAGTCTCTCCAACAAAAGAGCAGATTCCTAAAGCCAGGTGCAGCACTGTGA
AAAGTTTCTTTCAATATGGCACCAAGACTCTACCATTTATGTCTCTCTCAGCTTACAAACATCAGCGTTTTGTCCTTGTCATAGTGGAAG
AAAGACACTTACTTTAAGCTTTGGGGACAAAGGTGACAAACCCCAGGCTTTTATCTTAAAAGTGTCTTTGGCACTTCTTTTGGCACTGAA
ATGGTATTTGGGAAGCATTATTTGAATGTACAGTTGTTTGGTTTTGTATGTGCTTATCTTTATCTGAGCTTTCACTTGTAGACATGGCCT
TTTGTTGTGAAGTTGCTCATCATTTAGGAGTGTTTAATTCTAAAAAGCCTTCAGCCTAAGAAAGCTTCATCTGTGGGGACCAGAGACTTG
TTGCTCAGGGAGTTAGTGATGGGACTTGGGCATCTGATCTGCAGGTGACAAGTTTAGTTCAACTGAAGTTGTAGGGAATTTAGACAGTTG
CACATCATTGCCGTTCTAGGGGCCTTGTAGAAAGATGAAACAGTTGTTTTTCATTTACCAGCACCTCTCAGTTATAGAGGTAATGGAACA
TTCGCTTACTTTTCATCATCATTCTTTAAAAAGGGAACATACAAAAATCTAAACTATGGCAATAATTTATTTTTATAATAGTTTACGGTA
GGCTTTAATTAAATGGCAAACTCCTCTGGGACCCCTAAGTTATGGCGTGATTAGCCAAATTTGATTTCCAACAGTCATTTATGGCCATAA
CTATTGCATAGAGTGCAGGATGCCAGCAAAGATGAGGGTGGGGGCAGATACTGGCTCAGTGATTTAACTCACATTATAGATGACCCCTTC
CTCAACAGAAATGCTACTGAGAGAACCAGAGAGGCCTGGGCCAGGCAGGTCTTATTTGAGAGGAGATTATTTGATAATTGCTTTGGTTAG
AAGGACTTTACATTTCCTGATTTCAAGTCCAGCACCAATTTAGAAAGTTCAGAGATGAAACCACCTGTCTTTACCTGACAGAGTCATAAC
GGTTTGTGTAAAAATGTGGTCAGGGACCTTTTTTGTTCTTTCTGATTAGTTAATACTGTACATTGTAACCAGGAGGGGCAGTTTTGCCAA
CCAGCCTCTGCTCATGGTCACCATATGTGTATGACAAGGCCTGAGTGAGTTCCTGCATAAACTGGGTAGTGGGCTCTTTTGACACATTTG
CAAGCATGTAAATGAATGAATGACACTACCAGCAACCATCTGTACAGGTCCATTTACTTACATTCATAAGGTTTATGCTATGAAACTTCT
TCTCATTGTGATGTCAGTAACAGAGTTAGTGTCTCTGATGGAATAGTGTACCTGTCACCCAAGTTATTTTGTTCCTTTTTGGGTCCTCCA
GTATAATCCCCCCCTCATCCCAATTAACTGTAAAATGTTTTACACATCACATTTTTTATACTGTAAACTTGGAAAATAAACTGAAATATC

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000310260_chr1_116202262_+_4082nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTA
TAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACT
CAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTG
TTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACC
TATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCA
AAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGA
AGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGAT
GAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGA
AAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGG
AGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGT
GGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTT
ACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCT
GCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCAT
CTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGC
AGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCA
GGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTA
CTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAA
TGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTT
GTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCA
GCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAG
GGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAA
CGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTG
GAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAA
TGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATC
CGTTTAAAAGTTCTATATTTGTGGCTTTATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTT
AAAAATTCTTCTTCATTGCTGACTGAAACTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGC
TGTCCACCCTGAAAAAGAGTGACTGATGACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCT
GTAAACCAAAGTGGAGCTGGTGCTTCTTGGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCT
GGTCAGCCCACTTGTAGACTTCCAGGGGACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATG

>In-frame_SUZ12_ENST00000322652_chr17_30323896_+_VANGL1_ENST00000369509_chr1_116202262_+_4082nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTA
TAACAACAATACAAGGCAACAAACTGAAGCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACT
CAAGCATCTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTG
TTATGATGGCTCCTATGCAGGAAATCCTCAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACC
TATCACACATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCA
AAGAACATATAGTAGTGGCCACAATCGTCTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGA
AGATGAAAAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGAT
GAAACTCTGGAATCTCCATGTCATGAAGCATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGA
AAAGTCTGTCACCATTCAACCTCCCACTGGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGG
AGAGACCACCACGGCCATCACAGGCACCTCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGT
GGGGCTGGATTGCAAACGCTACCTGGGCCTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTT
ACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCT
GCTCATAGGGACCTGGGCACTTTTTTTCCGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCAT
CTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGC
AGTCTCCCTTGTGGATGCCCTCCTCTTCATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCA
GGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTA
CTACAAAGATTTCACCATCTATAACCCAAACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAA
TGTAGATGGCCCCAGTAACAATGCCACTGGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTT
GTATTATGAAGAGGCCGAACATGAACGGCGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCA
GCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAG
GGCTCTCCAGAAGTACCTGCGCATCACCCGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAA
CGGCATGACCCCCAAGGCCTTCCTAGAACGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTG
GAGGCTTGTCAGTGATGAGGCTGTGACTAATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAA
TGTGAAGAAAATTCCATTCATCATACTCTCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATC
CGTTTAAAAGTTCTATATTTGTGGCTTTATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTT
AAAAATTCTTCTTCATTGCTGACTGAAACTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGC
TGTCCACCCTGAAAAAGAGTGACTGATGACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCT
GTAAACCAAAGTGGAGCTGGTGCTTCTTGGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCT
GGTCAGCCCACTTGTAGACTTCCAGGGGACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATG

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000355485_chr1_116202262_+_10334nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACC
TCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGC
CTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTG
GAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTC
CGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTT
TTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTC
ATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCC
CGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCA
AACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACT
GGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGG
CGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAA
GCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACC
CGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAA
CGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACT
AATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTC
TCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATCCGTTTAAAAGTTCTATATTTGTGGCTTT
ATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTTAAAAATTCTTCTTCATTGCTGACTGAAA
CTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGCTGTCCACCCTGAAAAAGAGTGACTGATG
ACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCTGTAAACCAAAGTGGAGCTGGTGCTTCTT
GGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCTGGTCAGCCCACTTGTAGACTTCCAGGGG
ACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATGTTAATGTCCAGTATCACATCACCCATGA
AAGTCGTGGGCAGTTCAGGAGATACCTGCCTTCATCTTTGTTCTTTGTTGCCTTAGGTTCTTCAGAGAAAGATCACAACAAAAAATGTAC
ACTGTCGTTTACAGCTATTAAGTGATTTGATTTTGTTTTTTTCCCAAAGAGAAAACCTACCTGCCCTGTTTCTGATCCCACCCCTCTGCT
GGCTTGAAGCAGGTAACCCTTTCCCAGCCCTGCAGCTGCCCACCTGGCCTCCATGCCATCCTGCCCCCACCTGGCTGGCAGCCCTGGCTC
TCCATGTGTGCCCTCCGGCTCTGTGTGAAGCCTCAAGTCAGTCCCAGCATTGTTTCCATAGGGAAGTGTGGGGTGCCCAGCAGGTAAAGC
ACAGGGAGAGAGGGCAGTGGGAATGCCACCTTTAGGCTGCAGCAGGAGCCCCACACTGCCCAGTTTTCCTCCCCACTGTTCTACACCAAC
CAGGGGAGACTAACACTGTGACTCTGGGATTGGCAGGTGCAACTTGGAGCCACTTAATTTCCTGGGGACGTAAGTTCTTCCCAAGCTTAG
AGCAAGCTGCCCTGCCAAAGGAGACCAAACCATGCCAACCACGCTGGCAACTGCTGCTGTCCAGTCCCTGTGTTTTCTGACCACCGTCAC
TGTGCAACTCATCGCCTCTGCCACTTAGGACCAGGAAAGAGGCTGGTTTTGCTCCCACTCTTAGTTGCTGATAAAGTGGGGAGAAGGAAA
ATGGACACTCTACAGAGTTTGGGGAAGGGAGAGTAGGGAGCCCATCTTGTCCAGAAAGATTCATCTGTGGTCTGTCTGTTAAACACAGCT
GATTTCAGTGGGCTTTCCCCTGGCCCTGGGGGAGCAGACACTGACTGGGTTGTGGGCAGAGGAGCCATCCTGGCGGAGCCCTGCTGCAGG
GGAGCTCCTTCAGGAGCCCCATCCGGACCTCTTGCACTGGGCTGCCTTTGCCTCCATTTGCCTTCCTGTATCTGCAACAAACCTTTTAAA
AGTGTTCACTCTTGCTTTTTCCAGTATTTCGGTAATCAGCCATCTTGCTGTAGTACAGGATGACATTGTCGAATGCTCTTTGTATGTGTG
CACACCCCCTTACTCCCTTACTGCTTCATACACTCCACAAGTGGTACAGTATTTTGTGTCATTGTAAAAATCAAAATTGGCTTTGGATCT
TTGTAATACACCTGTACCTGAAAAAGTAAACAACATTCTTCAATTACTAGCCTTCAGCTTGAAAAGACATGCTGGAGAAGAAGGAAGGGG
GAACCCATAGGTGTGGCGTGGAGCCAAGATGTACTATTCAACTATGTGTTTCTGTTTATAAAAAACACATACCATGGAACCATGGTGCTT
TTGTTCTTAGTTTTTGCCGTTAGATCCCTTCAAACTGGAAGTTCCTTACAATATCTTTCTCAGGAAATATTTTGGGAAATGGGGTAAGAG
ATGGCAAGTGTGAGACGGGCTGTGTCAGAGGTTGCTACGTCATGGATACAGTGCAGTTCCAAGTGCCATAAGTGTATGTACATATAGTTA
ATAATGACACTGTTCATCACCATTCTAAAATACTGTTCTTCCAACCCTATCTTCAATGACCAGTCCAGAAGGGGTTAAGCTGGATTCATT
TGCTCTGGCATGTGCATTCCCAGCAGGGTGAAGAAAGGTTTAAATTAAAGAATTTATTTTCTCTCTCCCCCTTCCTCTTTCTCCCAGTCT
TTGCATAGGAGAATGTTAGACATTCAGAAATTACTGTTTCTGTTTTAAATTGAGTATTGATTTTTTTATATTGACTTTGTATTGAGTTCT
TTTTGAAAGAATAACAAAATAAAATGCAGGATCTTTGTAAAGCCTTTGCACTTTCAACCTCTTTATAGCTTGAGTTACTTTTGCAGTGGG
AACAATGTAAATGACATTTAAAAGATTTAAGGTTTCAGAAAGCTGCATCCCACAATTGAACACAATGCATTTTTATTTCAATTCTTGGAA
CTGGTAGGCTATTCTTTTTAAAAGGGGGTAAACTTCGCCCTAAGGCTGGTAGAATGTATGTTCACATTATAGTAGACAGGATTTCATTTG
CCTTATATGTTTATAGATTTTTTATAATTTTCATCCTACGTTATTAAAATTAGAGCATTGAGTGTTAAAGAACTTAATGAGGAGTCTATA
TCTGAGATTGCTCTCTTCCCTGGTGATGTTTTAACTGGTAGATAATTTGTTCTTAAATATGTACTTTTGAAGATAGGACAGTTTTTATAG
TCCATGAACTGAATGTTAAAAAGTTCTGTATGCATTCTCAGAGAGGATTTTAAAGCTATATAGTTCATCCATCCTTTGCATTATCAAAAT
GTTAAGTCAAATCTGTAATACTTTGGCTAAAATTCATAAAGTAAGCCCTAGAGAAAATACTTGACCACCAAATTTTTGCCCAACTATCAT
CACCTCCCTTCCCCCGCCTCTGTTCTTGCCTTTTGACATCTACATGGAAGACAAGTTCTTTACAGCAAATGGTAAGAGGCAGGTGACCTG
GTGTGTTTGCTGTGTTGTAGTTCATTGCCTGGGGCTTGGGACTCCTTTTTTAATGGAGAGACTAGCTGTGCAGGTGTGTGTTGGATAGGG
ATAAAGTGCTCACCCCTGCCCTCTCTACAGTAGTTGGTGGTAGATTTCTCTCTCATTTTGCCTCATAATCACTTTCGAGTGCATGTATTT
ACCTAAGGGCTGTAGCTCTGTGGGATGCTACCAGCATATTGGACTGACAGAAATTGATTACCTTGCCACTCCAACCTACGTACTGAGTGA
GTGCTCCAGCCACTCAGTGAAACCAACAAAAGTGAGTCCTTGGTTTACCTTCCAATCTGGGTCCTGCTGTGTAAGTATCCCTAAGTGGGG
ATGCATATTTGTTTGTGCGTTTTTATTTCCATATATGTGAGCATTTCTCTGAGTGTATTACCAGACGGATAGCACATTTATATGTCAGAC
ATCTTAACATCTGTGTTATCTGTAGCAGGTGTGTAGCTCAGCAGATACGTGTCATTGTGTATATAGCTGAGTGTGTGAGGGTGTCTGTGT
TTCTGCAGTCCCCTGTGTTTGAGAGATGACTTAATAACCCTGTGTTTTGAGAGGTCGCTCTAAACCAGTGACTTTTCCCTCCCCTGCTTT
ATTCCTTTCCCTCACTGACACTGGCTTCTCCCGCTAGAGTAAATGGCTTTAGCACAGCACTGTCTTCTGGGGAGCCTGCTGTCCTGCAGG
CAAGTCCATTAAACTCTTTCTTGCTTTAGGACTCTGAAAACAGCAAGAAACAAACAAACAAAGGTCAAGCTCTAAGAAAATTACTGCTCA
AACTTCACTACCCTGGAAGCCTTACTAGATATTTCTTAAGGTAACTTAAAAATTGGGCTTTATTTTTAAAAAGTGATAGGTTACTTACAG
TAGCACAGAAATGTTAGCATATTTATTTAAATAGTCCTGCAGCAGAGACCCTGCGATTGTAAAGTGATTTAAGTATTTCTGGGTAGTGTT
TGTGATTTACGGATTTGTTACTGAAAAACAAAAAAATCACTACTGTGAATTTACTACTATGTAACCTTGTGGTCGTATTTCATTATAAAT
AAAATAAGAATTGCTCTTCTGCCCACCGTTCTTGATTGGTATTCAGTGCAGTAGCGAAATGAGATAGTTTAGACACTGTTGAAATAACTG
CATTGAGCTTTAACCAAGTGTATGCTCAGAAAATTCAGTTTTGGATCACATTTTGACAAAACATGTTTTGGTCAAAGAAAGGAAAGGCTA
CTAACACATTTATCAGGTAATGTATGTCACAGTCCGTGTTCCACCCAGCCTTGTTATCCCCACATTCTTTCAAGATAGGAGTCATCTTGG
TTTTTCGGGTGAAAAACGGAAGGTCAGAGAGGAAGGGGCTTGTCCAAGGTCTCATGTCTGGTTAACAGAATTTCAAACTAGATGTTTGAT
TCTAACCCCTCAGTCCACTGTACCTTGAAGTATGGTCTAAATGATTCGGCACTTCTGGATGTTGAGGAAGGACCTAGAGACACATCCTTG
AACTAGAACCTGGGGTGAGAGTTCATTGGGAGGCAGGATCTCTTCTTTCACTTTGGATTTACACCTTGTCCCTTGGAAAGCTTCTCCACT
ATGCTAGCAAATATCTTAGGATATTTGATGGAAAGAACTTGAGAATCCCTTCTGGAAAACCCAGCCTTTCAGTGTTAACACCTGCTGCAA
GACAGGGATGCTGTTGTTCTGGCAGCCCCCCTTTGCTTTTGCCTGGCCCCACCTTCTGCTCCCACTCTGCTGGCTTGGGCAAGATGCGTG
CCTTGGGCCTTGGGTGCAGGGAGGCAGGCAGGGGCTTGACCTGGCCTCTCTCTGGTGCCATGGCAACATTATGCCCCAAACTTCTTCCCT
GGTTGGAGTGAGAGGGGCTGTCCACAGCCCCATCCTGTGGGGATCTCAAGCCGGAGTCCCTGGCCTGGCCTCCTTGACGTAGGTGTTCTC
AGCAAGCAGTTTGCATCCCACCGTCTTTCTCACACTTGCCCCCAAGACTTTTGACAGAGCAGACGTAAAACAGGACTCAGAAAACCATTT
TTCTCTGTTCCCATATGTAGTAAGTTTTGATTCAGTTGTGCATAAACCATAGTTTTCTGCCCTGCTGTTTGCTTTCAATGGAAGACAGTA
AAGGGAAGATGGTGCTCACATCTCTCCATGTGACATCTCATTAGGAATTAAGATGCGATGGATTAGAAATGTAAAACTTCAGAATAAAAT
TAAATTTCAGGGCTCTATAAGTCCCGTTTTCCCAGGTCCTGTTCCGTTTCTACGTAGATAACCCAATTTGTTTTGTCTATGAAATAAGCC
TCTTTAGTGGGTTGTTTTAGTCTCTCCAACAAAAGAGCAGATTCCTAAAGCCAGGTGCAGCACTGTGAAAAGTTTCTTTCAATATGGCAC
CAAGACTCTACCATTTATGTCTCTCTCAGCTTACAAACATCAGCGTTTTGTCCTTGTCATAGTGGAAGAAAGACACTTACTTTAAGCTTT
GGGGACAAAGGTGACAAACCCCAGGCTTTTATCTTAAAAGTGTCTTTGGCACTTCTTTTGGCACTGAAATGGTATTTGGGAAGCATTATT
TGAATGTACAGTTGTTTGGTTTTGTATGTGCTTATCTTTATCTGAGCTTTCACTTGTAGACATGGCCTTTTGTTGTGAAGTTGCTCATCA
TTTAGGAGTGTTTAATTCTAAAAAGCCTTCAGCCTAAGAAAGCTTCATCTGTGGGGACCAGAGACTTGTTGCTCAGGGAGTTAGTGATGG
GACTTGGGCATCTGATCTGCAGGTGACAAGTTTAGTTCAACTGAAGTTGTAGGGAATTTAGACAGTTGCACATCATTGCCGTTCTAGGGG
CCTTGTAGAAAGATGAAACAGTTGTTTTTCATTTACCAGCACCTCTCAGTTATAGAGGTAATGGAACATTCGCTTACTTTTCATCATCAT
TCTTTAAAAAGGGAACATACAAAAATCTAAACTATGGCAATAATTTATTTTTATAATAGTTTACGGTAGGCTTTAATTAAATGGCAAACT
CCTCTGGGACCCCTAAGTTATGGCGTGATTAGCCAAATTTGATTTCCAACAGTCATTTATGGCCATAACTATTGCATAGAGTGCAGGATG
CCAGCAAAGATGAGGGTGGGGGCAGATACTGGCTCAGTGATTTAACTCACATTATAGATGACCCCTTCCTCAACAGAAATGCTACTGAGA
GAACCAGAGAGGCCTGGGCCAGGCAGGTCTTATTTGAGAGGAGATTATTTGATAATTGCTTTGGTTAGAAGGACTTTACATTTCCTGATT
TCAAGTCCAGCACCAATTTAGAAAGTTCAGAGATGAAACCACCTGTCTTTACCTGACAGAGTCATAACGGTTTGTGTAAAAATGTGGTCA
GGGACCTTTTTTGTTCTTTCTGATTAGTTAATACTGTACATTGTAACCAGGAGGGGCAGTTTTGCCAACCAGCCTCTGCTCATGGTCACC
ATATGTGTATGACAAGGCCTGAGTGAGTTCCTGCATAAACTGGGTAGTGGGCTCTTTTGACACATTTGCAAGCATGTAAATGAATGAATG
ACACTACCAGCAACCATCTGTACAGGTCCATTTACTTACATTCATAAGGTTTATGCTATGAAACTTCTTCTCATTGTGATGTCAGTAACA
GAGTTAGTGTCTCTGATGGAATAGTGTACCTGTCACCCAAGTTATTTTGTTCCTTTTTGGGTCCTCCAGTATAATCCCCCCCTCATCCCA

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000369510_chr1_116202262_+_10328nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACCTCGGAG
CACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGCCTCACC
GTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTGGAGCCT
TGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTCCGCAAG
CGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTTTTTTAC
GGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTCATCCAT
TACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCCCGCTTC
TACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCAAACCTC
CTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACTGGCCAG
TCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGGCGAGTA
AAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAAGCCCCA
GGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACCCGGCAG
CAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAACGGTAC
CTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACTAATGGA
TTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTCTCTGAA
GAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATCCGTTTAAAAGTTCTATATTTGTGGCTTTATTAAA
AAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTTAAAAATTCTTCTTCATTGCTGACTGAAACTGGCA
GATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGCTGTCCACCCTGAAAAAGAGTGACTGATGACATCT
GACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCTGTAAACCAAAGTGGAGCTGGTGCTTCTTGGGAGC
CTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCTGGTCAGCCCACTTGTAGACTTCCAGGGGACACAT
CTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATGTTAATGTCCAGTATCACATCACCCATGAAAGTCG
TGGGCAGTTCAGGAGATACCTGCCTTCATCTTTGTTCTTTGTTGCCTTAGGTTCTTCAGAGAAAGATCACAACAAAAAATGTACACTGTC
GTTTACAGCTATTAAGTGATTTGATTTTGTTTTTTTCCCAAAGAGAAAACCTACCTGCCCTGTTTCTGATCCCACCCCTCTGCTGGCTTG
AAGCAGGTAACCCTTTCCCAGCCCTGCAGCTGCCCACCTGGCCTCCATGCCATCCTGCCCCCACCTGGCTGGCAGCCCTGGCTCTCCATG
TGTGCCCTCCGGCTCTGTGTGAAGCCTCAAGTCAGTCCCAGCATTGTTTCCATAGGGAAGTGTGGGGTGCCCAGCAGGTAAAGCACAGGG
AGAGAGGGCAGTGGGAATGCCACCTTTAGGCTGCAGCAGGAGCCCCACACTGCCCAGTTTTCCTCCCCACTGTTCTACACCAACCAGGGG
AGACTAACACTGTGACTCTGGGATTGGCAGGTGCAACTTGGAGCCACTTAATTTCCTGGGGACGTAAGTTCTTCCCAAGCTTAGAGCAAG
CTGCCCTGCCAAAGGAGACCAAACCATGCCAACCACGCTGGCAACTGCTGCTGTCCAGTCCCTGTGTTTTCTGACCACCGTCACTGTGCA
ACTCATCGCCTCTGCCACTTAGGACCAGGAAAGAGGCTGGTTTTGCTCCCACTCTTAGTTGCTGATAAAGTGGGGAGAAGGAAAATGGAC
ACTCTACAGAGTTTGGGGAAGGGAGAGTAGGGAGCCCATCTTGTCCAGAAAGATTCATCTGTGGTCTGTCTGTTAAACACAGCTGATTTC
AGTGGGCTTTCCCCTGGCCCTGGGGGAGCAGACACTGACTGGGTTGTGGGCAGAGGAGCCATCCTGGCGGAGCCCTGCTGCAGGGGAGCT
CCTTCAGGAGCCCCATCCGGACCTCTTGCACTGGGCTGCCTTTGCCTCCATTTGCCTTCCTGTATCTGCAACAAACCTTTTAAAAGTGTT
CACTCTTGCTTTTTCCAGTATTTCGGTAATCAGCCATCTTGCTGTAGTACAGGATGACATTGTCGAATGCTCTTTGTATGTGTGCACACC
CCCTTACTCCCTTACTGCTTCATACACTCCACAAGTGGTACAGTATTTTGTGTCATTGTAAAAATCAAAATTGGCTTTGGATCTTTGTAA
TACACCTGTACCTGAAAAAGTAAACAACATTCTTCAATTACTAGCCTTCAGCTTGAAAAGACATGCTGGAGAAGAAGGAAGGGGGAACCC
ATAGGTGTGGCGTGGAGCCAAGATGTACTATTCAACTATGTGTTTCTGTTTATAAAAAACACATACCATGGAACCATGGTGCTTTTGTTC
TTAGTTTTTGCCGTTAGATCCCTTCAAACTGGAAGTTCCTTACAATATCTTTCTCAGGAAATATTTTGGGAAATGGGGTAAGAGATGGCA
AGTGTGAGACGGGCTGTGTCAGAGGTTGCTACGTCATGGATACAGTGCAGTTCCAAGTGCCATAAGTGTATGTACATATAGTTAATAATG
ACACTGTTCATCACCATTCTAAAATACTGTTCTTCCAACCCTATCTTCAATGACCAGTCCAGAAGGGGTTAAGCTGGATTCATTTGCTCT
GGCATGTGCATTCCCAGCAGGGTGAAGAAAGGTTTAAATTAAAGAATTTATTTTCTCTCTCCCCCTTCCTCTTTCTCCCAGTCTTTGCAT
AGGAGAATGTTAGACATTCAGAAATTACTGTTTCTGTTTTAAATTGAGTATTGATTTTTTTATATTGACTTTGTATTGAGTTCTTTTTGA
AAGAATAACAAAATAAAATGCAGGATCTTTGTAAAGCCTTTGCACTTTCAACCTCTTTATAGCTTGAGTTACTTTTGCAGTGGGAACAAT
GTAAATGACATTTAAAAGATTTAAGGTTTCAGAAAGCTGCATCCCACAATTGAACACAATGCATTTTTATTTCAATTCTTGGAACTGGTA
GGCTATTCTTTTTAAAAGGGGGTAAACTTCGCCCTAAGGCTGGTAGAATGTATGTTCACATTATAGTAGACAGGATTTCATTTGCCTTAT
ATGTTTATAGATTTTTTATAATTTTCATCCTACGTTATTAAAATTAGAGCATTGAGTGTTAAAGAACTTAATGAGGAGTCTATATCTGAG
ATTGCTCTCTTCCCTGGTGATGTTTTAACTGGTAGATAATTTGTTCTTAAATATGTACTTTTGAAGATAGGACAGTTTTTATAGTCCATG
AACTGAATGTTAAAAAGTTCTGTATGCATTCTCAGAGAGGATTTTAAAGCTATATAGTTCATCCATCCTTTGCATTATCAAAATGTTAAG
TCAAATCTGTAATACTTTGGCTAAAATTCATAAAGTAAGCCCTAGAGAAAATACTTGACCACCAAATTTTTGCCCAACTATCATCACCTC
CCTTCCCCCGCCTCTGTTCTTGCCTTTTGACATCTACATGGAAGACAAGTTCTTTACAGCAAATGGTAAGAGGCAGGTGACCTGGTGTGT
TTGCTGTGTTGTAGTTCATTGCCTGGGGCTTGGGACTCCTTTTTTAATGGAGAGACTAGCTGTGCAGGTGTGTGTTGGATAGGGATAAAG
TGCTCACCCCTGCCCTCTCTACAGTAGTTGGTGGTAGATTTCTCTCTCATTTTGCCTCATAATCACTTTCGAGTGCATGTATTTACCTAA
GGGCTGTAGCTCTGTGGGATGCTACCAGCATATTGGACTGACAGAAATTGATTACCTTGCCACTCCAACCTACGTACTGAGTGAGTGCTC
CAGCCACTCAGTGAAACCAACAAAAGTGAGTCCTTGGTTTACCTTCCAATCTGGGTCCTGCTGTGTAAGTATCCCTAAGTGGGGATGCAT
ATTTGTTTGTGCGTTTTTATTTCCATATATGTGAGCATTTCTCTGAGTGTATTACCAGACGGATAGCACATTTATATGTCAGACATCTTA
ACATCTGTGTTATCTGTAGCAGGTGTGTAGCTCAGCAGATACGTGTCATTGTGTATATAGCTGAGTGTGTGAGGGTGTCTGTGTTTCTGC
AGTCCCCTGTGTTTGAGAGATGACTTAATAACCCTGTGTTTTGAGAGGTCGCTCTAAACCAGTGACTTTTCCCTCCCCTGCTTTATTCCT
TTCCCTCACTGACACTGGCTTCTCCCGCTAGAGTAAATGGCTTTAGCACAGCACTGTCTTCTGGGGAGCCTGCTGTCCTGCAGGCAAGTC
CATTAAACTCTTTCTTGCTTTAGGACTCTGAAAACAGCAAGAAACAAACAAACAAAGGTCAAGCTCTAAGAAAATTACTGCTCAAACTTC
ACTACCCTGGAAGCCTTACTAGATATTTCTTAAGGTAACTTAAAAATTGGGCTTTATTTTTAAAAAGTGATAGGTTACTTACAGTAGCAC
AGAAATGTTAGCATATTTATTTAAATAGTCCTGCAGCAGAGACCCTGCGATTGTAAAGTGATTTAAGTATTTCTGGGTAGTGTTTGTGAT
TTACGGATTTGTTACTGAAAAACAAAAAAATCACTACTGTGAATTTACTACTATGTAACCTTGTGGTCGTATTTCATTATAAATAAAATA
AGAATTGCTCTTCTGCCCACCGTTCTTGATTGGTATTCAGTGCAGTAGCGAAATGAGATAGTTTAGACACTGTTGAAATAACTGCATTGA
GCTTTAACCAAGTGTATGCTCAGAAAATTCAGTTTTGGATCACATTTTGACAAAACATGTTTTGGTCAAAGAAAGGAAAGGCTACTAACA
CATTTATCAGGTAATGTATGTCACAGTCCGTGTTCCACCCAGCCTTGTTATCCCCACATTCTTTCAAGATAGGAGTCATCTTGGTTTTTC
GGGTGAAAAACGGAAGGTCAGAGAGGAAGGGGCTTGTCCAAGGTCTCATGTCTGGTTAACAGAATTTCAAACTAGATGTTTGATTCTAAC
CCCTCAGTCCACTGTACCTTGAAGTATGGTCTAAATGATTCGGCACTTCTGGATGTTGAGGAAGGACCTAGAGACACATCCTTGAACTAG
AACCTGGGGTGAGAGTTCATTGGGAGGCAGGATCTCTTCTTTCACTTTGGATTTACACCTTGTCCCTTGGAAAGCTTCTCCACTATGCTA
GCAAATATCTTAGGATATTTGATGGAAAGAACTTGAGAATCCCTTCTGGAAAACCCAGCCTTTCAGTGTTAACACCTGCTGCAAGACAGG
GATGCTGTTGTTCTGGCAGCCCCCCTTTGCTTTTGCCTGGCCCCACCTTCTGCTCCCACTCTGCTGGCTTGGGCAAGATGCGTGCCTTGG
GCCTTGGGTGCAGGGAGGCAGGCAGGGGCTTGACCTGGCCTCTCTCTGGTGCCATGGCAACATTATGCCCCAAACTTCTTCCCTGGTTGG
AGTGAGAGGGGCTGTCCACAGCCCCATCCTGTGGGGATCTCAAGCCGGAGTCCCTGGCCTGGCCTCCTTGACGTAGGTGTTCTCAGCAAG
CAGTTTGCATCCCACCGTCTTTCTCACACTTGCCCCCAAGACTTTTGACAGAGCAGACGTAAAACAGGACTCAGAAAACCATTTTTCTCT
GTTCCCATATGTAGTAAGTTTTGATTCAGTTGTGCATAAACCATAGTTTTCTGCCCTGCTGTTTGCTTTCAATGGAAGACAGTAAAGGGA
AGATGGTGCTCACATCTCTCCATGTGACATCTCATTAGGAATTAAGATGCGATGGATTAGAAATGTAAAACTTCAGAATAAAATTAAATT
TCAGGGCTCTATAAGTCCCGTTTTCCCAGGTCCTGTTCCGTTTCTACGTAGATAACCCAATTTGTTTTGTCTATGAAATAAGCCTCTTTA
GTGGGTTGTTTTAGTCTCTCCAACAAAAGAGCAGATTCCTAAAGCCAGGTGCAGCACTGTGAAAAGTTTCTTTCAATATGGCACCAAGAC
TCTACCATTTATGTCTCTCTCAGCTTACAAACATCAGCGTTTTGTCCTTGTCATAGTGGAAGAAAGACACTTACTTTAAGCTTTGGGGAC
AAAGGTGACAAACCCCAGGCTTTTATCTTAAAAGTGTCTTTGGCACTTCTTTTGGCACTGAAATGGTATTTGGGAAGCATTATTTGAATG
TACAGTTGTTTGGTTTTGTATGTGCTTATCTTTATCTGAGCTTTCACTTGTAGACATGGCCTTTTGTTGTGAAGTTGCTCATCATTTAGG
AGTGTTTAATTCTAAAAAGCCTTCAGCCTAAGAAAGCTTCATCTGTGGGGACCAGAGACTTGTTGCTCAGGGAGTTAGTGATGGGACTTG
GGCATCTGATCTGCAGGTGACAAGTTTAGTTCAACTGAAGTTGTAGGGAATTTAGACAGTTGCACATCATTGCCGTTCTAGGGGCCTTGT
AGAAAGATGAAACAGTTGTTTTTCATTTACCAGCACCTCTCAGTTATAGAGGTAATGGAACATTCGCTTACTTTTCATCATCATTCTTTA
AAAAGGGAACATACAAAAATCTAAACTATGGCAATAATTTATTTTTATAATAGTTTACGGTAGGCTTTAATTAAATGGCAAACTCCTCTG
GGACCCCTAAGTTATGGCGTGATTAGCCAAATTTGATTTCCAACAGTCATTTATGGCCATAACTATTGCATAGAGTGCAGGATGCCAGCA
AAGATGAGGGTGGGGGCAGATACTGGCTCAGTGATTTAACTCACATTATAGATGACCCCTTCCTCAACAGAAATGCTACTGAGAGAACCA
GAGAGGCCTGGGCCAGGCAGGTCTTATTTGAGAGGAGATTATTTGATAATTGCTTTGGTTAGAAGGACTTTACATTTCCTGATTTCAAGT
CCAGCACCAATTTAGAAAGTTCAGAGATGAAACCACCTGTCTTTACCTGACAGAGTCATAACGGTTTGTGTAAAAATGTGGTCAGGGACC
TTTTTTGTTCTTTCTGATTAGTTAATACTGTACATTGTAACCAGGAGGGGCAGTTTTGCCAACCAGCCTCTGCTCATGGTCACCATATGT
GTATGACAAGGCCTGAGTGAGTTCCTGCATAAACTGGGTAGTGGGCTCTTTTGACACATTTGCAAGCATGTAAATGAATGAATGACACTA
CCAGCAACCATCTGTACAGGTCCATTTACTTACATTCATAAGGTTTATGCTATGAAACTTCTTCTCATTGTGATGTCAGTAACAGAGTTA
GTGTCTCTGATGGAATAGTGTACCTGTCACCCAAGTTATTTTGTTCCTTTTTGGGTCCTCCAGTATAATCCCCCCCTCATCCCAATTAAC

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000310260_chr1_116202262_+_3964nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACC
TCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGC
CTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTG
GAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTC
CGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTT
TTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTC
ATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCC
CGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCA
AACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACT
GGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGG
CGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAA
GCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACC
CGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAA
CGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACT
AATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTC
TCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATCCGTTTAAAAGTTCTATATTTGTGGCTTT
ATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTTAAAAATTCTTCTTCATTGCTGACTGAAA
CTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGCTGTCCACCCTGAAAAAGAGTGACTGATG
ACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCTGTAAACCAAAGTGGAGCTGGTGCTTCTT
GGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCTGGTCAGCCCACTTGTAGACTTCCAGGGG
ACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATGTTAATGTCCAGTATCACATCACCCATGA

>In-frame_SUZ12_ENST00000580398_chr17_30323896_+_VANGL1_ENST00000369509_chr1_116202262_+_3964nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAA
GCAAGAGATGACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCATCTTAAACTCTGCCATAGCAGA
TTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGGATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCT
CAGGATATTCATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACACATATTCTTGTGTGCAGGCCA
AAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCTGAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGT
CTGTATTTCCATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAAAAGGATCCTGAATGGCTAAGA
GAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTTAATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAG
CATGGGGAAAGAACTAGAGAGAGACACAAGTCACCCCGGAATAAAGACGGCAGAGGGTCAGAAAAGTCTGTCACCATTCAACCTCCCACT
GGAGAGCCCCTGTTGGGAAATGATTCTACTCGGACAGAGGAAGTTCAGGATGACAACTGGGGAGAGACCACCACGGCCATCACAGGCACC
TCGGAGCACAGCATATCCCAAGAGGACATTGCCAGGATCAGCAAGGACATGGAGGACAGCGTGGGGCTGGATTGCAAACGCTACCTGGGC
CTCACCGTCGCCTCTTTTCTTGGACTTCTAGTTTTCCTCACCCCTATTGCCTTCATCCTTTTACCTCCGATCCTGTGGAGGGATGAGCTG
GAGCCTTGTGGCACAATTTGTGAGGGGCTCTTTATCTCCATGGCATTCAAACTCCTCATTCTGCTCATAGGGACCTGGGCACTTTTTTTC
CGCAAGCGGAGAGCTGACATGCCACGGGTGTTTGTGTTTCGTGCCCTTTTGTTGGTCCTCATCTTTCTCTTTGTGGTTTCCTATTGGCTT
TTTTACGGGGTCCGCATTTTGGACTCTCGGGACCGGAATTACCAGGGCATTGTGCAATATGCAGTCTCCCTTGTGGATGCCCTCCTCTTC
ATCCATTACCTGGCCATCGTCCTGCTGGAGCTCAGGCAGCTGCAGCCCATGTTCACGCTGCAGGTGGTCCGCTCCACCGATGGCGAGTCC
CGCTTCTACAGCCTGGGACACCTGAGTATCCAGCGAGCAGCATTGGTGGTCCTAGAAAATTACTACAAAGATTTCACCATCTATAACCCA
AACCTCCTAACAGCCTCCAAATTCCGAGCAGCCAAGCATATGGCCGGGCTGAAAGTCTACAATGTAGATGGCCCCAGTAACAATGCCACT
GGCCAGTCCCGGGCCATGATTGCTGCAGCTGCTCGGCGCAGGGACTCAAGCCACAACGAGTTGTATTATGAAGAGGCCGAACATGAACGG
CGAGTAAAGAAGCGGAAAGCAAGGCTGGTGGTTGCAGTGGAAGAGGCCTTCATCCACATTCAGCGTCTCCAGGCTGAGGAGCAGCAGAAA
GCCCCAGGGGAGGTGATGGACCCTAGGGAGGCCGCCCAGGCCATTTTCCCCTCCATGGCCAGGGCTCTCCAGAAGTACCTGCGCATCACC
CGGCAGCAGAACTACCACAGCATGGAGAGCATCCTGCAGCACCTGGCCTTCTGCATCACCAACGGCATGACCCCCAAGGCCTTCCTAGAA
CGGTACCTCAGTGCGGGCCCCACCCTGCAATATGACAAGGACCGCTGGCTCTCTACACAGTGGAGGCTTGTCAGTGATGAGGCTGTGACT
AATGGATTACGGGATGGAATTGTGTTCGTCCTTAAGTGCTTGGACTTCAGCCTCGTAGTCAATGTGAAGAAAATTCCATTCATCATACTC
TCTGAAGAGTTCATAGACCCCAAATCTCACAAATTTGTCCTTCGCTTACAGTCTGAGACATCCGTTTAAAAGTTCTATATTTGTGGCTTT
ATTAAAAAAAAAAGAAAAATATATAGAGAGATATATATCTATGCCAGAGGGGTGTCTTTTTTAAAAATTCTTCTTCATTGCTGACTGAAA
CTGGCAGATGATTGACCAGTATCCTTTGACCATCTGCACTTTATTTGGAAGGAAGCAGGGGCTGTCCACCCTGAAAAAGAGTGACTGATG
ACATCTGACTTTTGTCGATGGGACTTCTCAAGAAGCCATTCCTTGGAGCTTCTGTTACAGCTGTAAACCAAAGTGGAGCTGGTGCTTCTT
GGGAGCCTCGCCTTACAACTAATTCCTGCCTTTCGTCCAGTACCAAGTCCCCCGTTGCTTCTGGTCAGCCCACTTGTAGACTTCCAGGGG
ACACATCTTTATTCTGTTTCAGGAAACCAGTCACGACACGTCCACATATGTATTTGTGTATGTTAATGTCCAGTATCACATCACCCATGA


Top

FusionGenePPI for SUZ12_VANGL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SUZ12SETDB1, EED, AEBP2, RBBP4, EZH2, VAV1, WDR77, GTF2I, SNAI1, UBE2I, CTCF, JARID2, MTF2, EZH1, SUZ12, CREB1, EWSR1, HIST1H1A, HIST1H1C, KDM5A, SETD8, SIRT1, PHF1, WT1, DNMT1, PPP1R8, USP7, RARG, GATA4, PJA1, CDYL, HIST3H3, RELA, RELB, ELAVL1, CDK19, CDK8, MED6, MED17, UHRF1, HIC1, PML, RARA, HDAC2, PAXIP1, CBX5, SS18, SSX2, DNMT3B, BTRC, BRCA1, FBXW11, RBBP7, PLEC, THRAP3, HIST4H4, ACTG1, MTOR, ERH, ILF3, EIF4A3, PCNT, LUC7L2, ACIN1, NCL, DDX5, H2AFY, PRPF8, BCLAF1, SRSF1, PRMT1, SNRNP200, LIMA1, CDKAL1, UBB, SON, AKAP9, YBX1, PABPC4, RNPS1, TRA2A, TAF15, TRIM28, ARG1, DHX9, HIST1H3D, MYH14, NUMA1, SF3B1, SRSF10, PKP1, AR, RBM14, MLST8, H1F0, GCN1L1, EFTUD2, DYNC1H1, SRSF9, FMR1, ATP5B, DDX3X, CHTOP, HP1BP3, LARP1, IMMT, NCBP1, SNRPN, SNRNP70, ILF2, SAFB2, GNB2L1, PHF19, MAGOH, SRSF5, SF3B2, ATP2A2, SORBS2, DDX39B, U2AF2, HIST1H2BB, NOP58, UPF1, SRSF6, SF3B3, LUC7L, RALY, FBL, SRSF3, XRCC5, HIST1H2BA, ALYREF, SNRPA, C17orf85, MYO1C, PPP1R9B, NAT10, RBM8A, ZNF326, CHCHD3, ADAR, DBN1, FXR2, XAB2, SLTM, SRSF8, SNRPD3, ATAD3A, CHD4, C1QBP, YBX3, HIST2H2AA3, PABPN1, RBM39, U2AF1, FYTTD1, ATP5C1, CRNKL1, HSPA1A, SRSF7, SFXN1, VCP, CBX8, H2AFY2, TUFM, KHSRP, RAN, VGF, PRDX1, PHF5A, PTBP1, PKM, RCC1, CCT3, CALR, CNBP, CBX3, CPSF7, EIF2S2, FXR1, SAP18, LMNB2, MYL6, FIP1L1, SNRPD1, SNRPA1, CDK5RAP2, PHGDH, TRIM25, EIF2AK3, LGALS7, LDHB, NHP2L1, PDLIM5, NDRG1, NOP2, RCN1, RSL1D1, RUVBL2, SF1, SMARCA5, THOC2, TPI1, ZC3H13, SLC39A7, ACACA, AKAP8L, PRKAR2A, CSNK2B, CEP57, MCM7, RANBP2, FLNB, HIST1H2AE, AQR, KHDRBS1, MFAP1, PTCD3, PLG, CDC40, PDIA3, SPRR2G, SF3A1, GATAD2B, YY1, ABLIM1, AIFM1, ATP5O, CPSF6, COPA, CKMT1A, DNAJA1, RNF2, FUBP3, GSDMA, NHP2, DKC1, HEATR1, HIST2H2AB, LUC7L3, SSB, SYNE1, NUP93, NXF1, NOLC1, PPIB, PLRG1, SF3B6, PRPF19, BCAS2, DDX23, PHB, PHB2, DHX30, GLYR1, RCL1, RBM4, PGAM5, SNW1, SAMM50, SF3A3, STOML2, SMC3, TFAM, SART1, AFG3L2, AMOTL1, EPRS, CSRP1, DAZAP1, POLR2B, EMD, ERLIN1, GDAP1, HDAC1, C10orf12, IGLL5, KRR1, LPP, TIMM50, NGDN, NUP88, GTPBP4, ISY1, RBM22, DDX56, PDCD11, PYCR1, RBM34, MSI2, SNRPD2, SF3B4, SSR4, SNRNP40, DDX18, TM7SF2, DDOST, CSE1L, ALDOA, GLDC, C15orf52, KLK2, MTA1, SLC25A11, EBNA1BP2, RBM15B, RBM14-RBM4, REPIN1, FAM208A, RBM4B, RBM5, SKP1, SDF2L1, THOC6, TRAF4, UFD1L, EPB41L5, CANX, DNAJC9, ERGIC1, TBL1Y, H1FX, NUP107, P4HB, G3BP2, RNF114, FUS, U2AF1L4, TBL2, UTP15, HIST1H2BG, TRIM37, PRDM14, DDB2, ESR1, PCGF1, DPPA4, NANOG, POU5F1, MDM2, HNF4A, C17orf96, INTU, LCOR, KHDRBS2, C9orf3, LATS2, MEX3B, UHRF2VANGL1KBTBD7, RAPGEF5, NT5C3A, GMFG, SMYD3, THAP2, SRPK1, FBXW11, CCDC8, SPRY2, ZRANB2, LUC7L, EPB41L3, RASSF9, RASSF10, TCTN3, EVC2, TMEM17, TMEM216, NAF1, VANGL2, PTPN3, GPR156, CD44, DVL3, SDC2, PNN, TNFRSF1A, MANSC1, SDC1, PRICKLE3, NXF2, EPB41L5, CD83, JPH4, FGF8, ZC3H18, TRIM25, RNF41, ERBB4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SUZ12_VANGL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SUZ12_VANGL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSUZ12C0206727Nerve Sheath Tumors2CTD_human
HgeneSUZ12C0001430Adenoma1CTD_human
HgeneSUZ12C0014170Endometrial Neoplasms1CTD_human
HgeneSUZ12C0017636Glioblastoma1CTD_human
HgeneSUZ12C0017638Glioma1CTD_human
HgeneSUZ12C0025202melanoma1CTD_human
HgeneSUZ12C0027809Neurilemmoma1CTD_human
HgeneSUZ12C0027830neurofibroma1CTD_human
HgeneSUZ12C0027962Melanocytic nevus1CTD_human
TgeneVANGL1C0027794Neural Tube Defects2CTD_human
TgeneVANGL1C1838568Sacral defect and anterior sacral meningocele1CTD_human;UNIPROT
TgeneVANGL1C3891448NEURAL TUBE DEFECTS, SUSCEPTIBILITY TO1UNIPROT