FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36829

FusionGeneSummary for SUZ12_TAC4

check button Fusion gene summary
Fusion gene informationFusion gene name: SUZ12_TAC4
Fusion gene ID: 36829
HgeneTgene
Gene symbol

SUZ12

TAC4

Gene ID

23512

255061

Gene nameSUZ12, polycomb repressive complex 2 subunittachykinin 4
SynonymsCHET9|JJAZ1EK|HK-1|HK1|PPT-C
Cytomap

17q11.2

17q21.33

Type of geneprotein-codingprotein-coding
Descriptionpolycomb protein SUZ12chET 9 proteinchromatin precipitated E2F target 9 proteinjoined to JAZF1 proteinsuppressor of zeste 12 protein homologtachykinin-4endokininpreprotachykinin-Ctachykinin 4 (hemokinin)
Modification date2018052320180523
UniProtAcc

Q15022

Q86UU9

Ensembl transtripts involved in fusion geneENST00000322652, ENST00000580398, 
ENST00000326219, ENST00000352793, 
ENST00000436235, ENST00000398154, 
ENST00000334568, 
Fusion gene scores* DoF score7 X 8 X 8=4482 X 1 X 1=2
# samples 92
** MAII scorelog2(9/448*10)=-2.31550182572793
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/2*10)=3.32192809488736
Context

PubMed: SUZ12 [Title/Abstract] AND TAC4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTAC4

GO:1902093

positive regulation of flagellated sperm motility

17437961


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A06Q-01ASUZ12chr17

30320352

+TAC4chr17

47921519

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000322652ENST00000326219SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000322652ENST00000352793SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000322652ENST00000436235SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000322652ENST00000398154SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000322652ENST00000334568SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000580398ENST00000326219SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000580398ENST00000352793SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000580398ENST00000436235SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000580398ENST00000398154SUZ12chr17

30320352

+TAC4chr17

47921519

-
In-frameENST00000580398ENST00000334568SUZ12chr17

30320352

+TAC4chr17

47921519

-

Top

FusionProtFeatures for SUZ12_TAC4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SUZ12

Q15022

TAC4

Q86UU9

Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27'(H3K27me) of histone H3, leading to transcriptional repression ofthe affected target gene. The PRC2/EED-EZH2 complex may also serveas a recruiting platform for DNA methyltransferases, therebylinking two epigenetic repression systems. Genes repressed by thePRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.{ECO:0000269|PubMed:15225548, ECO:0000269|PubMed:15231737,ECO:0000269|PubMed:15385962, ECO:0000269|PubMed:16618801,ECO:0000269|PubMed:17344414, ECO:0000269|PubMed:18285464,ECO:0000269|PubMed:28229514}. Tachykinins are active peptides which excite neurons,evoke behavioral responses, are potent vasodilators andsecretagogues, and contract (directly or indirectly) many smoothmuscles. Endokinin-A induces thermal hyperalgesia and pain-relatedbehavior such as scratching following intrathecal administrationin rats. These effects are suppressed by treatment with endokinin-C. Endokinin-A/B reduces arterial blood pressure and increasessperm motility. {ECO:0000269|PubMed:12716968,ECO:0000269|PubMed:17101218, ECO:0000269|PubMed:17437961,ECO:0000269|PubMed:17655832}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSUZ12chr17:30320352chr17:47921519ENST00000322652+111651_59431740Compositional biasNote=Poly-Ser
HgeneSUZ12chr17:30320352chr17:47921519ENST00000322652+111660_67431740Compositional biasNote=Poly-Ala
HgeneSUZ12chr17:30320352chr17:47921519ENST00000322652+11167_50431740Compositional biasNote=Gly-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSUZ12chr17:30320352chr17:47921519ENST00000322652+1116563_639431740RegionNote=VEFS-box
HgeneSUZ12chr17:30320352chr17:47921519ENST00000322652+1116448_471431740Zinc fingerNote=C2H2-type


Top

FusionGeneSequence for SUZ12_TAC4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000326219_chr17_47921519_-_484aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKA

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000352793_chr17_47921519_-_473aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKA

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000436235_chr17_47921519_-_504aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKA

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000398154_chr17_47921519_-_493aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKA

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000334568_chr17_47921519_-_504aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGET
NENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKA

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000326219_chr17_47921519_-_461aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKK

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000352793_chr17_47921519_-_450aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGREDEAQGSEX

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000436235_chr17_47921519_-_481aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKK

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000398154_chr17_47921519_-_470aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGAYQLEHTFQGL

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000334568_chr17_47921519_-_481aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPI
RQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEK
TFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSE
SLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000326219_chr17_47921519_-_1452nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCA
AGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAAGGCAGAGAGGATGAGGCCCAA

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000352793_chr17_47921519_-_1419nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCA

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000436235_chr17_47921519_-_1512nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCA
AGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAAGCATATCAGCTGGAACACACG

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000398154_chr17_47921519_-_1479nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCA
AGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTC

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000334568_chr17_47921519_-_1512nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCT
CATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAAT
TCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAA
AAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGT
AACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACC
AATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACA
GTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAA
AGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGT
TGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAG
CCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAAT
GAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCA
AGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAAGCATATCAGCTGGAACACACG

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000326219_chr17_47921519_-_1383nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAA

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000352793_chr17_47921519_-_1350nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGCAGAGAGGATGAGGCCCAAGGTTCAGAGTAA

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000436235_chr17_47921519_-_1443nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAA
GCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAG

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000398154_chr17_47921519_-_1410nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGCATATCAGCTGGAACACACGTTCCAGGGCCTC

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000334568_chr17_47921519_-_1443nt
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAA
GCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000326219_chr17_47921519_-_2014nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGC
TGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAG
ACCTCTGATCCAGCCAAGGAGAAAAAAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAGTAAAAGCCCCCACCACAGACTTCCCAGAGGAC
ACGGTGCCGCTTCTTCCTACCTGGATGTCACAGCTGACAAGCCGGCAGGCCAACTCTCTTCTCTGTGTCTCCTGTCCTCATCGCTGGCAC
TTCACACAAGGCCCACACTGAACCCACTGGGCTTCTTCCTGGACTCTCAGTGTCAAGCAGCAGTCCTGCATAAATGCACAGCTTCGCCGT
AGCAAGCTGCACTGACTCTGCCCTCCCTCACACTCAGAGTTGGCATCTCACTGCACAGCAGTGAGGAGACTCGCACACTCTGTATCCTGT

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000352793_chr17_47921519_-_1981nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGC
TGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGCAG
AGAGGATGAGGCCCAAGGTTCAGAGTAAAAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCACAG
CTGACAAGCCGGCAGGCCAACTCTCTTCTCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGGGCT
TCTTCCTGGACTCTCAGTGTCAAGCAGCAGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCACAC
TCAGAGTTGGCATCTCACTGCACAGCAGTGAGGAGACTCGCACACTCTGTATCCTGTGCCTAGCACACAGTAGGCACTCAATAAATGAGT

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000436235_chr17_47921519_-_2074nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGC
TGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAG
ACCTCTGATCCAGCCAAGGAGAAAAAAAGCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGG
CAGAGAGGATGAGGCCCAAGGTTCAGAGTAAAAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCA
CAGCTGACAAGCCGGCAGGCCAACTCTCTTCTCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGG
GCTTCTTCCTGGACTCTCAGTGTCAAGCAGCAGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCA
CACTCAGAGTTGGCATCTCACTGCACAGCAGTGAGGAGACTCGCACACTCTGTATCCTGTGCCTAGCACACAGTAGGCACTCAATAAATG

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000398154_chr17_47921519_-_2041nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGC
TGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGCATA
TCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAGTAAAA
GCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCACAGCTGACAAGCCGGCAGGCCAACTCTCTTCTC
TGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGGGCTTCTTCCTGGACTCTCAGTGTCAAGCAGCAG
TCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCACACTCAGAGTTGGCATCTCACTGCACAGCAGTG

>In-frame_SUZ12_ENST00000322652_chr17_30320352_+_TAC4_ENST00000334568_chr17_47921519_-_2074nt
AGGGTAGGGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTC
CCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCT
CCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTC
GGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGG
GAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCC
GAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAA
TCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAACATCAAAAGGAAAACATTTAAAGT
TGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGAGAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTT
CTTCCACAAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAA
AAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACC
CGGAAATTTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGT
GACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAG
AAAACGAAATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGA
ATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCC
TCCATTCGAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGC
CAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGA
ATCATTGACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGC
TGGCCCCAGCATTCAGCTCCAGCTGCAGGAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAG
ACCTCTGATCCAGCCAAGGAGAAAAAAAGCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGG
CAGAGAGGATGAGGCCCAAGGTTCAGAGTAAAAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCA
CAGCTGACAAGCCGGCAGGCCAACTCTCTTCTCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGG
GCTTCTTCCTGGACTCTCAGTGTCAAGCAGCAGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCA
CACTCAGAGTTGGCATCTCACTGCACAGCAGTGAGGAGACTCGCACACTCTGTATCCTGTGCCTAGCACACAGTAGGCACTCAATAAATG

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000326219_chr17_47921519_-_1896nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAA
GGCAGAGAGGATGAGGCCCAAGGTTCAGAGTAAAAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGT
CACAGCTGACAAGCCGGCAGGCCAACTCTCTTCTCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACT
GGGCTTCTTCCTGGACTCTCAGTGTCAAGCAGCAGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCT
CACACTCAGAGTTGGCATCTCACTGCACAGCAGTGAGGAGACTCGCACACTCTGTATCCTGTGCCTAGCACACAGTAGGCACTCAATAAA

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000352793_chr17_47921519_-_1863nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGCAGAGAGGATGAGGCCCAAGGTTCAGAGTAA
AAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCACAGCTGACAAGCCGGCAGGCCAACTCTCTTC
TCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGGGCTTCTTCCTGGACTCTCAGTGTCAAGCAGC
AGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCACACTCAGAGTTGGCATCTCACTGCACAGCAG

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000436235_chr17_47921519_-_1956nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAA
GCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAG
TAAAAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCACAGCTGACAAGCCGGCAGGCCAACTCTC
TTCTCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGGGCTTCTTCCTGGACTCTCAGTGTCAAGC
AGCAGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCACACTCAGAGTTGGCATCTCACTGCACAG

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000398154_chr17_47921519_-_1923nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGCATATCAGCTGGAACACACGTTCCAGGGCCTC
CTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAGTAAAAGCCCCCACCACAGACTTCCCAGAGGACA
CGGTGCCGCTTCTTCCTACCTGGATGTCACAGCTGACAAGCCGGCAGGCCAACTCTCTTCTCTGTGTCTCCTGTCCTCATCGCTGGCACT
TCACACAAGGCCCACACTGAACCCACTGGGCTTCTTCCTGGACTCTCAGTGTCAAGCAGCAGTCCTGCATAAATGCACAGCTTCGCCGTA
GCAAGCTGCACTGACTCTGCCCTCCCTCACACTCAGAGTTGGCATCTCACTGCACAGCAGTGAGGAGACTCGCACACTCTGTATCCTGTG

>In-frame_SUZ12_ENST00000580398_chr17_30320352_+_TAC4_ENST00000334568_chr17_47921519_-_1956nt
TTTTTTTTTCCTCCCTCCTTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCTCGGTCCGCCGGA
GCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGCCGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCG
ATGGCGCCTCAGAAGCACGGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGGGGTTCGGCGGCG
GTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGTGGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCG
GCGGCAGCGGCGGGGGCTGCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTCCTCCAGGCCTTT
GAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATAGCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCAT
CGAAACTCCAGAACAAACATCAAAAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCACAAAAATGATAAGCCATCACCA
AACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTCCTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATA
AGGCAAGTTCCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAATTTCCCGTCCCTTGCAGTTTCC
AGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAGTCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAAT
GGAATGATTAATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGAAATCGTGAGGATGGGGAAAAG
ACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGGCGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAA
GAATGTCCAATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTCGAAACATTTTCTCAGGGACCT
ACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAATGATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAG
AGTCTCCATCAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTGACTACAGATCTACAAACAAGA
AAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTAAGAATATTTTATCAGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCAG
GAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGGAAGACCTCTGATCCAGCCAAGGAGAAAAAAA
GCATATCAGCTGGAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAGGTTCAGAG
TAAAAGCCCCCACCACAGACTTCCCAGAGGACACGGTGCCGCTTCTTCCTACCTGGATGTCACAGCTGACAAGCCGGCAGGCCAACTCTC
TTCTCTGTGTCTCCTGTCCTCATCGCTGGCACTTCACACAAGGCCCACACTGAACCCACTGGGCTTCTTCCTGGACTCTCAGTGTCAAGC
AGCAGTCCTGCATAAATGCACAGCTTCGCCGTAGCAAGCTGCACTGACTCTGCCCTCCCTCACACTCAGAGTTGGCATCTCACTGCACAG


Top

FusionGenePPI for SUZ12_TAC4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SUZ12SETDB1, EED, AEBP2, RBBP4, EZH2, VAV1, WDR77, GTF2I, SNAI1, UBE2I, CTCF, JARID2, MTF2, EZH1, SUZ12, CREB1, EWSR1, HIST1H1A, HIST1H1C, KDM5A, SETD8, SIRT1, PHF1, WT1, DNMT1, PPP1R8, USP7, RARG, GATA4, PJA1, CDYL, HIST3H3, RELA, RELB, ELAVL1, CDK19, CDK8, MED6, MED17, UHRF1, HIC1, PML, RARA, HDAC2, PAXIP1, CBX5, SS18, SSX2, DNMT3B, BTRC, BRCA1, FBXW11, RBBP7, PLEC, THRAP3, HIST4H4, ACTG1, MTOR, ERH, ILF3, EIF4A3, PCNT, LUC7L2, ACIN1, NCL, DDX5, H2AFY, PRPF8, BCLAF1, SRSF1, PRMT1, SNRNP200, LIMA1, CDKAL1, UBB, SON, AKAP9, YBX1, PABPC4, RNPS1, TRA2A, TAF15, TRIM28, ARG1, DHX9, HIST1H3D, MYH14, NUMA1, SF3B1, SRSF10, PKP1, AR, RBM14, MLST8, H1F0, GCN1L1, EFTUD2, DYNC1H1, SRSF9, FMR1, ATP5B, DDX3X, CHTOP, HP1BP3, LARP1, IMMT, NCBP1, SNRPN, SNRNP70, ILF2, SAFB2, GNB2L1, PHF19, MAGOH, SRSF5, SF3B2, ATP2A2, SORBS2, DDX39B, U2AF2, HIST1H2BB, NOP58, UPF1, SRSF6, SF3B3, LUC7L, RALY, FBL, SRSF3, XRCC5, HIST1H2BA, ALYREF, SNRPA, C17orf85, MYO1C, PPP1R9B, NAT10, RBM8A, ZNF326, CHCHD3, ADAR, DBN1, FXR2, XAB2, SLTM, SRSF8, SNRPD3, ATAD3A, CHD4, C1QBP, YBX3, HIST2H2AA3, PABPN1, RBM39, U2AF1, FYTTD1, ATP5C1, CRNKL1, HSPA1A, SRSF7, SFXN1, VCP, CBX8, H2AFY2, TUFM, KHSRP, RAN, VGF, PRDX1, PHF5A, PTBP1, PKM, RCC1, CCT3, CALR, CNBP, CBX3, CPSF7, EIF2S2, FXR1, SAP18, LMNB2, MYL6, FIP1L1, SNRPD1, SNRPA1, CDK5RAP2, PHGDH, TRIM25, EIF2AK3, LGALS7, LDHB, NHP2L1, PDLIM5, NDRG1, NOP2, RCN1, RSL1D1, RUVBL2, SF1, SMARCA5, THOC2, TPI1, ZC3H13, SLC39A7, ACACA, AKAP8L, PRKAR2A, CSNK2B, CEP57, MCM7, RANBP2, FLNB, HIST1H2AE, AQR, KHDRBS1, MFAP1, PTCD3, PLG, CDC40, PDIA3, SPRR2G, SF3A1, GATAD2B, YY1, ABLIM1, AIFM1, ATP5O, CPSF6, COPA, CKMT1A, DNAJA1, RNF2, FUBP3, GSDMA, NHP2, DKC1, HEATR1, HIST2H2AB, LUC7L3, SSB, SYNE1, NUP93, NXF1, NOLC1, PPIB, PLRG1, SF3B6, PRPF19, BCAS2, DDX23, PHB, PHB2, DHX30, GLYR1, RCL1, RBM4, PGAM5, SNW1, SAMM50, SF3A3, STOML2, SMC3, TFAM, SART1, AFG3L2, AMOTL1, EPRS, CSRP1, DAZAP1, POLR2B, EMD, ERLIN1, GDAP1, HDAC1, C10orf12, IGLL5, KRR1, LPP, TIMM50, NGDN, NUP88, GTPBP4, ISY1, RBM22, DDX56, PDCD11, PYCR1, RBM34, MSI2, SNRPD2, SF3B4, SSR4, SNRNP40, DDX18, TM7SF2, DDOST, CSE1L, ALDOA, GLDC, C15orf52, KLK2, MTA1, SLC25A11, EBNA1BP2, RBM15B, RBM14-RBM4, REPIN1, FAM208A, RBM4B, RBM5, SKP1, SDF2L1, THOC6, TRAF4, UFD1L, EPB41L5, CANX, DNAJC9, ERGIC1, TBL1Y, H1FX, NUP107, P4HB, G3BP2, RNF114, FUS, U2AF1L4, TBL2, UTP15, HIST1H2BG, TRIM37, PRDM14, DDB2, ESR1, PCGF1, DPPA4, NANOG, POU5F1, MDM2, HNF4A, C17orf96, INTU, LCOR, KHDRBS2, C9orf3, LATS2, MEX3B, UHRF2TAC4TACR2, TACR1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SUZ12_TAC4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SUZ12_TAC4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSUZ12C0206727Nerve Sheath Tumors2CTD_human
HgeneSUZ12C0001430Adenoma1CTD_human
HgeneSUZ12C0014170Endometrial Neoplasms1CTD_human
HgeneSUZ12C0017636Glioblastoma1CTD_human
HgeneSUZ12C0017638Glioma1CTD_human
HgeneSUZ12C0025202melanoma1CTD_human
HgeneSUZ12C0027809Neurilemmoma1CTD_human
HgeneSUZ12C0027830neurofibroma1CTD_human
HgeneSUZ12C0027962Melanocytic nevus1CTD_human