FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36722

FusionGeneSummary for SUFU_GBF1

check button Fusion gene summary
Fusion gene informationFusion gene name: SUFU_GBF1
Fusion gene ID: 36722
HgeneTgene
Gene symbol

SUFU

GBF1

Gene ID

51684

80142

Gene nameSUFU negative regulator of hedgehog signalingprostaglandin E synthase 2
SynonymsJBTS32|PRO1280|SUFUH|SUFUXLC9orf15|GBF-1|GBF1|PGES2|mPGES-2
Cytomap

10q24.32

9q34.11

Type of geneprotein-codingprotein-coding
Descriptionsuppressor of fused homologprostaglandin E synthase 2GATE-binding factor 1gamma-interferon-activated transcriptional element-binding factor 1mPGE synthase-2membrane-associated prostaglandin E synthase 2microsomal prostaglandin E synthase-2prostaglandin-H(2) E-isomerase
Modification date2018052320180519
UniProtAcc

Q9UMX1

Q92538

Ensembl transtripts involved in fusion geneENST00000369902, ENST00000369899, 
ENST00000423559, ENST00000471000, 
ENST00000369983, ENST00000476019, 
Fusion gene scores* DoF score6 X 3 X 6=1089 X 8 X 5=360
# samples 812
** MAII scorelog2(8/108*10)=-0.432959407276106
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/360*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SUFU [Title/Abstract] AND GBF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSUFU

GO:0000122

negative regulation of transcription by RNA polymerase II

10564661


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E2-A15E-01ASUFUchr10

104309863

+GBF1chr10

104111013

+
TCGARVBRCATCGA-E2-A15E-06ASUFUchr10

104309863

+GBF1chr10

104111013

+
TCGARVUCECTCGA-B5-A3S1-01ASUFUchr10

104309863

+GBF1chr10

104111013

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369902ENST00000369983SUFUchr10

104309863

+GBF1chr10

104111013

+
5CDS-intronENST00000369902ENST00000476019SUFUchr10

104309863

+GBF1chr10

104111013

+
In-frameENST00000369899ENST00000369983SUFUchr10

104309863

+GBF1chr10

104111013

+
5CDS-intronENST00000369899ENST00000476019SUFUchr10

104309863

+GBF1chr10

104111013

+
In-frameENST00000423559ENST00000369983SUFUchr10

104309863

+GBF1chr10

104111013

+
5CDS-intronENST00000423559ENST00000476019SUFUchr10

104309863

+GBF1chr10

104111013

+
intron-3CDSENST00000471000ENST00000369983SUFUchr10

104309863

+GBF1chr10

104111013

+
intron-intronENST00000471000ENST00000476019SUFUchr10

104309863

+GBF1chr10

104111013

+

Top

FusionProtFeatures for SUFU_GBF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SUFU

Q9UMX1

GBF1

Q92538

Negative regulator in the hedgehog/smoothened signalingpathway. Down-regulates GLI1-mediated transactivation of targetgenes (PubMed:15367681, PubMed:24311597, PubMed:24217340). Down-regulates GLI2-mediated transactivation of target genes(PubMed:24311597, PubMed:24217340). Part of a corepressor complexthat acts on DNA-bound GLI1. May also act by linking GLI1 to BTRCand thereby targeting GLI1 to degradation by the proteasome.Sequesters GLI1, GLI2 and GLI3 in the cytoplasm, this effect isovercome by binding of STK36 to both SUFU and a GLI protein(PubMed:10806483, PubMed:24217340). Negative regulator of beta-catenin signaling. Regulates the formation of either the repressorform (GLI3R) or the activator form (GLI3A) of the full-length formof GLI3 (GLI3FL). GLI3FL is complexed with SUFU in the cytoplasmand is maintained in a neutral state. Without the Hh signal, theSUFU-GLI3 complex is recruited to cilia, leading to the efficientprocessing of GLI3FL into GLI3R. When Hh signaling is initiated,SUFU dissociates from GLI3FL and the latter translocates to thenucleus, where it is phosphorylated, destabilized, and convertedto a transcriptional activator (GLI3A). Required for normalembryonic development. Required for the proper formation of hairfollicles and the control of epidermal differentiation (Bysimilarity). {ECO:0000250|UniProtKB:Q9Z0P7,ECO:0000269|PubMed:10559945, ECO:0000269|PubMed:10564661,ECO:0000269|PubMed:10806483, ECO:0000269|PubMed:12068298,ECO:0000269|PubMed:12975309, ECO:0000269|PubMed:15367681,ECO:0000269|PubMed:22365972, ECO:0000269|PubMed:24217340,ECO:0000269|PubMed:24311597, ECO:0000269|PubMed:28965847}. Guanine-nucleotide exchange factor (GEF) for members ofthe Arf family of small GTPases involved in trafficking in theearly secretory pathway; its GEF activity initiates the coating ofnascent vesicles via the localized generation of activated ARFsthrough replacement of GDP with GTP. Recruitment to cis-Golgimembranes requires membrane association of Arf-GDP and can beregulated by ARF1, ARF3, ARF4 and ARF5. Involved in therecruitment of the COPI coat complex to the endoplasmic reticulumexit sites (ERES), and the endoplasmic reticulum-Golgiintermediate (ERGIC) and cis-Golgi compartments which implicatesARF1 activation. Involved in COPI vesicle-dependent retrogradetransport from the ERGIC and cis-Golgi compartments to theendoplasmic reticulum (ER) (PubMed:16926190, PubMed:17956946,PubMed:18003980, PubMed:12047556, PubMed:12808027,PubMed:19039328, PubMed:24213530). Involved in the trans-Golginetwork recruitment of GGA1, GGA2, GGA3, BIG1, BIG2, and the AP-1adaptor protein complex related to chlathrin-dependent transport;the function requires its GEF activity (probably at least in parton ARF4 and ARF5) (PubMed:23386609). Has GEF activity towards ARF1(PubMed:15616190). Has in vitro GEF activity towards ARF5 (Bysimilarity). Involved in the processing of PSAP (PubMed:17666033).Required for the assembly of the Golgi apparatus (PubMed:12808027,PubMed:18003980). The AMPK-phosphorylated form is involved inGolgi disassembly during mitotis and under stress conditions(PubMed:18063581, PubMed:23418352). May be involved in the COPIvesicle-dependent recruitment of PNPLA2 to lipid droplets;however, this function is under debate (PubMed:19461073,PubMed:22185782). In neutrophils, involved in G protein-coupledreceptor (GPCR)-mediated chemotaxis und superoxide production.Proposed to be recruited by phosphatidylinositol-phosphatesgenerated upon GPCR stimulation to the leading edge where itrecruits and activates ARF1, and is involved in recruitment ofGIT2 and the NADPH oxidase complex (PubMed:22573891).{ECO:0000250|UniProtKB:Q9R1D7, ECO:0000269|PubMed:12047556,ECO:0000269|PubMed:12808027, ECO:0000269|PubMed:15616190,ECO:0000269|PubMed:16926190, ECO:0000269|PubMed:17666033,ECO:0000269|PubMed:17956946, ECO:0000269|PubMed:18003980,ECO:0000269|PubMed:18063581, ECO:0000269|PubMed:19461073,ECO:0000269|PubMed:22185782, ECO:0000269|PubMed:22573891,ECO:0000269|PubMed:23386609, ECO:0000269|PubMed:23418352,ECO:0000269|PubMed:24213530, ECO:0000305|PubMed:19039328,ECO:0000305|PubMed:22573891}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGBF1chr10:104309863chr10:104111013ENST00000369983+3401751_1854981860Compositional biasNote=Pro-rich
TgeneGBF1chr10:104309863chr10:104111013ENST00000369983+340692_882981860DomainSEC7
TgeneGBF1chr10:104309863chr10:104111013ENST00000369983+340886_1370981860RegionPhosphatidylinositol-phosphate binding%3B required for translocation to the leading edge and for ARF1 activation upon GPCR signaling

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSUFUchr10:104309863chr10:104111013ENST00000369899+311279_360151434RegionIntrinsically disordered
HgeneSUFUchr10:104309863chr10:104111013ENST00000369902+312279_360151485RegionIntrinsically disordered
HgeneSUFUchr10:104309863chr10:104111013ENST00000423559+310279_360151482RegionIntrinsically disordered


Top

FusionGeneSequence for SUFU_GBF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SUFU_ENST00000369902_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_1913aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHY
ISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSDPTHEGTAEGMENMADAVTHARFVGTDPA
SDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMR
AGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQTTSKEDLT
DLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALV
PYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESM
REHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLS
LDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEA
VDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSD
RKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNA
PMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAA
LSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGW
KNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPE
KMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLA
IRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQ
SDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTK
SLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDD
DEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTY
LQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHA
GSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGD
TRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEA

>In-frame_SUFU_ENST00000369899_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_1913aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHY
ISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSDPTHEGTAEGMENMADAVTHARFVGTDPA
SDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMR
AGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQTTSKEDLT
DLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALV
PYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESM
REHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLS
LDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEA
VDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSD
RKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNA
PMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAA
LSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGW
KNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPE
KMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLA
IRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQ
SDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTK
SLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDD
DEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTY
LQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHA
GSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGD
TRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEA

>In-frame_SUFU_ENST00000423559_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_1913aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHY
ISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSDPTHEGTAEGMENMADAVTHARFVGTDPA
SDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMR
AGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQTTSKEDLT
DLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALV
PYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESM
REHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLS
LDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEA
VDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSD
RKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNA
PMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAA
LSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGW
KNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPE
KMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLA
IRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQ
SDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTK
SLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDD
DEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTY
LQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHA
GSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGD
TRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEA

>In-frame_SUFU_ENST00000369902_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_1913aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHY
ISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSDPTHEGTAEGMENMADAVTHARFVGTDPA
SDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMR
AGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQTTSKEDLT
DLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALV
PYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESM
REHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLS
LDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEA
VDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSD
RKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNA
PMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAA
LSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGW
KNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPE
KMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLA
IRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQ
SDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTK
SLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDD
DEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTY
LQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHA
GSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGD
TRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEA

>In-frame_SUFU_ENST00000369899_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_1913aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHY
ISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSDPTHEGTAEGMENMADAVTHARFVGTDPA
SDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMR
AGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQTTSKEDLT
DLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALV
PYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESM
REHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLS
LDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEA
VDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSD
RKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNA
PMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAA
LSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGW
KNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPE
KMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLA
IRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQ
SDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTK
SLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDD
DEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTY
LQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHA
GSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGD
TRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEA

>In-frame_SUFU_ENST00000423559_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_1913aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHY
ISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSDPTHEGTAEGMENMADAVTHARFVGTDPA
SDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMR
AGGMSDSSKWKKQKRSPRPPRHMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQTTSKEDLT
DLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALV
PYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVCFLLFESM
REHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLS
LDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDLEEA
VDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSD
RKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNA
PMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAA
LSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGW
KNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPE
KMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLA
IRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQ
SDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTK
SLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDD
DEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTY
LQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHA
GSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGD
TRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SUFU_ENST00000369902_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_5739nt
ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTT
CCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTAC
TGGTTGGGTGGCCCAGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTAC
ATCAGCTTCGGCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTG
ACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAG
TCAGATCCCACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCC
AGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTG
TGTGAGATTATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGAC
ATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGA
GCCGGAGGCATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCA
GAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCA
AGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACT
GATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAG
GAAGGGACCCATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCT
GACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTC
CCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATT
CACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATG
TGCCGTCACTTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATG
CGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATG
AAGGAGATGGCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTAC
TGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCT
CTTGATGCCCTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAG
ACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATG
GCCTCAGACATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCT
GTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAA
AACAAAAAGAAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTC
ACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGAC
CGCAAAAACATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAA
GCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTT
GCCAATAGCGATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCA
CCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCAT
GCCATCAAGAATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGT
GCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCT
CTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCAC
TATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGT
GTATTTGGAAGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGG
AAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAAT
GGCAAGATCTCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGT
CCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAA
AAAATGATCACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACA
TATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACT
GTTCGAGACCATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCC
ATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGA
GTCAGCCACCAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTC
ACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAG
TCAGATAGTGAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGC
AGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCC
AAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAG
TCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACT
CTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAAC
CGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGAT
GATGAGGACGAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACG
CGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTC
TGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTAT
CTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTT
ACCAAGCTCTTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTC
CTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCA
GGCTCCAGCGACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCA
GATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTC
AAGCAGACCGTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGAC
ACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCC
AGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCA
CTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCC

>In-frame_SUFU_ENST00000369899_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_5739nt
ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTT
CCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTAC
TGGTTGGGTGGCCCAGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTAC
ATCAGCTTCGGCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTG
ACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAG
TCAGATCCCACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCC
AGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTG
TGTGAGATTATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGAC
ATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGA
GCCGGAGGCATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCA
GAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCA
AGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACT
GATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAG
GAAGGGACCCATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCT
GACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTC
CCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATT
CACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATG
TGCCGTCACTTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATG
CGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATG
AAGGAGATGGCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTAC
TGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCT
CTTGATGCCCTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAG
ACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATG
GCCTCAGACATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCT
GTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAA
AACAAAAAGAAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTC
ACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGAC
CGCAAAAACATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAA
GCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTT
GCCAATAGCGATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCA
CCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCAT
GCCATCAAGAATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGT
GCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCT
CTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCAC
TATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGT
GTATTTGGAAGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGG
AAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAAT
GGCAAGATCTCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGT
CCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAA
AAAATGATCACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACA
TATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACT
GTTCGAGACCATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCC
ATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGA
GTCAGCCACCAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTC
ACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAG
TCAGATAGTGAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGC
AGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCC
AAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAG
TCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACT
CTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAAC
CGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGAT
GATGAGGACGAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACG
CGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTC
TGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTAT
CTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTT
ACCAAGCTCTTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTC
CTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCA
GGCTCCAGCGACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCA
GATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTC
AAGCAGACCGTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGAC
ACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCC
AGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCA
CTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCC

>In-frame_SUFU_ENST00000423559_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_5739nt
ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTT
CCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTAC
TGGTTGGGTGGCCCAGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTAC
ATCAGCTTCGGCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTG
ACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAG
TCAGATCCCACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCC
AGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTG
TGTGAGATTATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGAC
ATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGA
GCCGGAGGCATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCA
GAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCA
AGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACT
GATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAG
GAAGGGACCCATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCT
GACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTC
CCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATT
CACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATG
TGCCGTCACTTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATG
CGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATG
AAGGAGATGGCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTAC
TGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCT
CTTGATGCCCTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAG
ACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATG
GCCTCAGACATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCT
GTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAA
AACAAAAAGAAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTC
ACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGAC
CGCAAAAACATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAA
GCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTT
GCCAATAGCGATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCA
CCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCAT
GCCATCAAGAATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGT
GCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCT
CTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCAC
TATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGT
GTATTTGGAAGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGG
AAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAAT
GGCAAGATCTCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGT
CCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAA
AAAATGATCACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACA
TATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACT
GTTCGAGACCATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCC
ATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGA
GTCAGCCACCAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTC
ACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAG
TCAGATAGTGAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGC
AGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCC
AAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAG
TCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACT
CTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAAC
CGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGAT
GATGAGGACGAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACG
CGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTC
TGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTAT
CTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTT
ACCAAGCTCTTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTC
CTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCA
GGCTCCAGCGACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCA
GATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTC
AAGCAGACCGTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGAC
ACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCC
AGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCA
CTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCC

>In-frame_SUFU_ENST00000369902_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_5739nt
ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTT
CCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTAC
TGGTTGGGTGGCCCAGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTAC
ATCAGCTTCGGCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTG
ACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAG
TCAGATCCCACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCC
AGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTG
TGTGAGATTATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGAC
ATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGA
GCCGGAGGCATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCA
GAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCA
AGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACT
GATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAG
GAAGGGACCCATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCT
GACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTC
CCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATT
CACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATG
TGCCGTCACTTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATG
CGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATG
AAGGAGATGGCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTAC
TGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCT
CTTGATGCCCTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAG
ACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATG
GCCTCAGACATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCT
GTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAA
AACAAAAAGAAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTC
ACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGAC
CGCAAAAACATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAA
GCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTT
GCCAATAGCGATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCA
CCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCAT
GCCATCAAGAATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGT
GCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCT
CTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCAC
TATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGT
GTATTTGGAAGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGG
AAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAAT
GGCAAGATCTCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGT
CCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAA
AAAATGATCACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACA
TATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACT
GTTCGAGACCATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCC
ATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGA
GTCAGCCACCAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTC
ACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAG
TCAGATAGTGAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGC
AGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCC
AAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAG
TCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACT
CTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAAC
CGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGAT
GATGAGGACGAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACG
CGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTC
TGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTAT
CTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTT
ACCAAGCTCTTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTC
CTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCA
GGCTCCAGCGACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCA
GATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTC
AAGCAGACCGTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGAC
ACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCC
AGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCA
CTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCC

>In-frame_SUFU_ENST00000369899_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_5739nt
ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTT
CCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTAC
TGGTTGGGTGGCCCAGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTAC
ATCAGCTTCGGCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTG
ACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAG
TCAGATCCCACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCC
AGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTG
TGTGAGATTATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGAC
ATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGA
GCCGGAGGCATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCA
GAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCA
AGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACT
GATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAG
GAAGGGACCCATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCT
GACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTC
CCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATT
CACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATG
TGCCGTCACTTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATG
CGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATG
AAGGAGATGGCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTAC
TGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCT
CTTGATGCCCTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAG
ACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATG
GCCTCAGACATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCT
GTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAA
AACAAAAAGAAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTC
ACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGAC
CGCAAAAACATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAA
GCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTT
GCCAATAGCGATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCA
CCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCAT
GCCATCAAGAATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGT
GCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCT
CTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCAC
TATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGT
GTATTTGGAAGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGG
AAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAAT
GGCAAGATCTCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGT
CCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAA
AAAATGATCACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACA
TATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACT
GTTCGAGACCATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCC
ATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGA
GTCAGCCACCAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTC
ACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAG
TCAGATAGTGAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGC
AGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCC
AAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAG
TCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACT
CTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAAC
CGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGAT
GATGAGGACGAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACG
CGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTC
TGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTAT
CTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTT
ACCAAGCTCTTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTC
CTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCA
GGCTCCAGCGACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCA
GATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTC
AAGCAGACCGTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGAC
ACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCC
AGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCA
CTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCC

>In-frame_SUFU_ENST00000423559_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_5739nt
ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTT
CCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTAC
TGGTTGGGTGGCCCAGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTAC
ATCAGCTTCGGCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTG
ACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAG
TCAGATCCCACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCC
AGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTG
TGTGAGATTATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGAC
ATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGA
GCCGGAGGCATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCA
GAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCA
AGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACT
GATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAG
GAAGGGACCCATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCT
GACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTC
CCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATT
CACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATG
TGCCGTCACTTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATG
CGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATG
AAGGAGATGGCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTAC
TGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCT
CTTGATGCCCTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAG
ACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATG
GCCTCAGACATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCT
GTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAA
AACAAAAAGAAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTC
ACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGAC
CGCAAAAACATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAA
GCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTT
GCCAATAGCGATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCA
CCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCAT
GCCATCAAGAATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGT
GCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCT
CTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCAC
TATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGT
GTATTTGGAAGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGG
AAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAAT
GGCAAGATCTCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGT
CCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAA
AAAATGATCACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACA
TATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACT
GTTCGAGACCATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCC
ATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGA
GTCAGCCACCAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTC
ACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAG
TCAGATAGTGAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGC
AGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCC
AAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAG
TCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACT
CTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAAC
CGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGAT
GATGAGGACGAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACG
CGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTC
TGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTAT
CTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTT
ACCAAGCTCTTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTC
CTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCA
GGCTCCAGCGACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCA
GATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTC
AAGCAGACCGTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGAC
ACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCC
AGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCA
CTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SUFU_ENST00000369902_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_6468nt
GACAGCCTGGGCGGACAGTGCGCCGTGCGCAGGCGCGGAGCTAGACCTCGCTGCAGCCCCCATCGCCTCGGGGAGTCTCACCCACCGAGT
CCGCCCGCTGGCCCGTCAGTGCTCTCCCCGTCGTTTGCCCTCTCCAGTTCCCCCAGTGCCTGCCCTACGCACCCCGATGGCGGAGCTGCG
GCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCA
CGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCC
AGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCGGCCT
GAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTGACCTTTCGTCTGAA
GAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGATCCCACCCA
TGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGT
CCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATTATGCA
GTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGACATGGTGCAGCTGCT
CTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGCATGAG
TGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCC
CAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAAGCTGC
CTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACTGATCTAGAGCAACC
TGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACCCATGT
GGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGT
CCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGTCTTCC
CTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATTCACATGGGACTGCA
TTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCACTTATT
CCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAA
GTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATGGCACT
GGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTACTGTTCCAACCTCTT
TGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCCCTATT
GACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAG
CTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGACATCCC
AGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGC
TGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAGAAGCT
GCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGA
CAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAACATTGA
CCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCC
TGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGCGATGC
CTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCACCCATGACCCTGGA
GGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAGAATGA
GGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGG
CATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTATGTCTT
TGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCACTATGGCCTCAGCGA
TGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGAAGCAA
CCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGGAAGAATATCATGGA
GGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATCTCTCT
ACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAG
TGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATCACAGA
AAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACATATGATGAGGAAGA
TGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGACCATCT
ATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCG
GAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCACCAGGT
TGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTCACACTGCTGGAGTG
CATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGTGAGCT
CCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGCAGGCCGGGCAAGAT
ACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGGCCCAG
CCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAGTCTCTGCTTAAGTG
TGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATCTTTGT
GGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAACCGCTTCAAGAAGAA
ATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGACGAAGG
CGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACGCGGGCAGCCTCTAT
CTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCACTGCTG
GTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTATCTGCAGCGAGCACT
ACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTCTTGGA
GAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTC
TCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGCGACTT
ACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCAGATGCACGGGGAGG
CGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACCGTCAT
CCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGACACTAGGACACCTGG
CCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGCTCCCC
AGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCC
CTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCAGTGCC
CCTCCTGGCCACACCCCGCCCCACAGATCCCATACCCACCTCTGAGGTCAACTAAGGCAGGTCACTCAGAGATCAGGACCAGTGCTTCCC
ACCAGGCTTTCCTTGACCCCACTTCTGGCTGTCCTGCGGGCCACAAGCTCTTCAGGCCAAGTCAGAGCTGCTGTTGCTGCCACTTGGATG
GGGACCTGAAAAAGAGAATGTTGATAGCCCCAGCTAAGACCCCCAATCAGCTGTGGGACCTTTTTCCTCCTCTGCGCTCCATTCCTGGGG
GTTCAGCCTGAGAGTGAACTCAGCTGTCATCTGCAGCCTCTGCCTCCAGCCCGGCAGCTCTGGGGAGGCATCCGTGTGCCGGCCCTGCAG
TGCCTGCCCACGGTCAGGCATTGAAAACTAAGCCCAACCACTCTGCACTTTGTTTCCCACTCCCATTAGCCCTGGGCCACCTCCTCCAGT
TCTTCCTCTTTTACTAATTAGTTGGTCAGTTTGGAGAGTTGACTGGCACCATGGAGGGTAGGCAGGTGGGGGCTGGGTGGGGGACTGCCC

>In-frame_SUFU_ENST00000369899_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_6448nt
CGCCGTGCGCAGGCGCGGAGCTAGACCTCGCTGCAGCCCCCATCGCCTCGGGGAGTCTCACCCACCGAGTCCGCCCGCTGGCCCGTCAGT
GCTCTCCCCGTCGTTTGCCCTCTCCAGTTCCCCCAGTGCCTGCCCTACGCACCCCGATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCC
CCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCACGCCATCTACGGAGAGTGCC
GCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCCAGACCCCTTGGACTATGTTA
GCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCGGCCTGAGTGATCTCTATGGTGACA
ACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTGACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTG
CCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGATCCCACCCATGAGGGCACAGCAGAGGGCA
TGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGTCCTGATGAAAATCCTTCAGG
TTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATTATGCAGTCTTGCTTCCGGATCTGCT
TTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGACATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGT
TTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGCATGAGTGATTCATCCAAATGGAAGA
AACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCCCAATGGAACCACCTTATCAT
CTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCT
CTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACTGATCTAGAGCAACCTGGCTCTCCAGGGTACAGCA
CAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACCCATGTGGAAAAGTCCCAGTCAGCAT
CTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGTCCATGACATGGATTACGTCA
ATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCC
GCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATTCACATGGGACTGCATTTGCTGACAGTGGCCCTTG
AGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCACTTATTCCAGCTACTCAGCATAGAGC
GACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAAGTTCCAAATGGAGATGTACA
TCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATGGCACTGGAGGCCATTGTGCAGCTCT
GGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTACTGTTCCAACCTCTTTGAGGAACTCACAAAGCTGC
TGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCCCTATTGACAGTGATTGACAGCACCG
AGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAGCTGTGAGATAGTAGATGGCA
CCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGACATCCCAGGCCTGCATCTGCCAGGTG
GAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGA
AGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAGAAGCTGCTAATCACTGGCACAGAGC
AGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGACAACACAGAGGTTGCTCAGT
GGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAACATTGACCTGTTGGAGAGCTTTGTGA
GCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCC
AGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGCGATGCCTGCTTTTCCCTGGCCTATG
CTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCACCCATGACCCTGGAGGAGTTTCGCAAAAATCTGA
AAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAGAATGAGGAAATTGTAATGCCTGAGG
AGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGGCATATTCCTGCGTGTGCCTA
CTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGA
CAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCACTATGGCCTCAGCGATGTGTTTGACAATCTCATCA
TCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGAAGCAACCCTAAAGCCCATATTGCAG
CCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGGAAGAATATCATGGAGGCCATGCTGCAGCTCTTCC
GAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATCTCTCTACAGCGGGAAGAGACACCAT
CAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTG
AAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATCACAGAAAGCAAGTTCCTCCAGCTGG
AGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACATATGATGAGGAAGATGCTGCTTTCTGCCTAGAGA
TGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGACCATCTATACCACCTCTGTGTTCAGG
CACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTC
AGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCACCAGGTTGCGTATGGGCTCCATGAAC
TCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTCACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGC
CTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGTGAGCTCCCATCCTACCATCAGAATG
ACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGCAGGCCGGGCAAGATACACCGATCAGCCACAGATG
CCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCC
TGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAGTCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCA
TTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCG
GATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAACCGCTTCAAGAAGAAATCCAAAGAGGGATCAATGC
TTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGACGAAGGCGTGCCTGCCAGCTACCATA
CGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACGCGGGCAGCCTCTATCTACAGCTCATGGGCGGAGG
AGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTA
TTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTATCTGCAGCGAGCACTACTTGTACATGATCTGCAAA
AGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTCTTGGAGAACATCAGCCCTGCAGATG
TGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTCTCCACTGCTGTCACTCTCTA
CCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGCGACTTACTGTCAGAGGCGATCCCTG
AGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCAGATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGG
AGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACCGTCATCCAGGACCCCATGCCCATGG
AGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGACACTAGGACACCTGGCCATCCACCGCCCCCAGAGA
TTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAA
GCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGG
TGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCAGTGCCCCTCCTGGCCACACCCCGCC
CCACAGATCCCATACCCACCTCTGAGGTCAACTAAGGCAGGTCACTCAGAGATCAGGACCAGTGCTTCCCACCAGGCTTTCCTTGACCCC
ACTTCTGGCTGTCCTGCGGGCCACAAGCTCTTCAGGCCAAGTCAGAGCTGCTGTTGCTGCCACTTGGATGGGGACCTGAAAAAGAGAATG
TTGATAGCCCCAGCTAAGACCCCCAATCAGCTGTGGGACCTTTTTCCTCCTCTGCGCTCCATTCCTGGGGGTTCAGCCTGAGAGTGAACT
CAGCTGTCATCTGCAGCCTCTGCCTCCAGCCCGGCAGCTCTGGGGAGGCATCCGTGTGCCGGCCCTGCAGTGCCTGCCCACGGTCAGGCA
TTGAAAACTAAGCCCAACCACTCTGCACTTTGTTTCCCACTCCCATTAGCCCTGGGCCACCTCCTCCAGTTCTTCCTCTTTTACTAATTA
GTTGGTCAGTTTGGAGAGTTGACTGGCACCATGGAGGGTAGGCAGGTGGGGGCTGGGTGGGGGACTGCCCACAGGAGCATGTACATATGG

>In-frame_SUFU_ENST00000423559_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_6376nt
GCCCGCTGGCCCGTCAGTGCTCTCCCCGTCGTTTGCCCTCTCCAGTTCCCCCAGTGCCTGCCCTACGCACCCCGATGGCGGAGCTGCGGC
CTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCACG
CCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCCAG
ACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCGGCCTGA
GTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTGACCTTTCGTCTGAAGA
GAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGATCCCACCCATG
AGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGTCC
TGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATTATGCAGT
CTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGACATGGTGCAGCTGCTCT
TCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGCATGAGTG
ATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCCCA
ATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAAGCTGCCT
CAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACTGATCTAGAGCAACCTG
GCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACCCATGTGG
AAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGTCC
ATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGTCTTCCCT
GCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATTCACATGGGACTGCATT
TGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCACTTATTCC
AGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAAGT
TCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATGGCACTGG
AGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTACTGTTCCAACCTCTTTG
AGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCCCTATTGA
CAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAGCT
GTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGACATCCCAG
GCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGCTG
ACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAGAAGCTGC
TAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGACA
ACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAACATTGACC
TGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCCTG
GGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGCGATGCCT
GCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCACCCATGACCCTGGAGG
AGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAGAATGAGG
AAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGGCA
TATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTATGTCTTTG
ACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCACTATGGCCTCAGCGATG
TGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGAAGCAACC
CTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGGAAGAATATCATGGAGG
CCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATCTCTCTAC
AGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAGTG
TTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATCACAGAAA
GCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACATATGATGAGGAAGATG
CTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGACCATCTAT
ACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCGGA
GAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCACCAGGTTG
CGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTCACACTGCTGGAGTGCA
TCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGTGAGCTCC
CATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGCAGGCCGGGCAAGATAC
ACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGGCCCAGCC
GCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAGTCTCTGCTTAAGTGTG
TGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATCTTTGTGG
AGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAACCGCTTCAAGAAGAAAT
CCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGACGAAGGCG
TGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACGCGGGCAGCCTCTATCT
ACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCACTGCTGGT
GCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTATCTGCAGCGAGCACTAC
TTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTCTTGGAGA
ACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTCTC
CACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGCGACTTAC
TGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCAGATGCACGGGGAGGCG
GCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACCGTCATCC
AGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGACACTAGGACACCTGGCC
ATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGCTCCCCAG
GATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCCCT
TGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCAGTGCCCC
TCCTGGCCACACCCCGCCCCACAGATCCCATACCCACCTCTGAGGTCAACTAAGGCAGGTCACTCAGAGATCAGGACCAGTGCTTCCCAC
CAGGCTTTCCTTGACCCCACTTCTGGCTGTCCTGCGGGCCACAAGCTCTTCAGGCCAAGTCAGAGCTGCTGTTGCTGCCACTTGGATGGG
GACCTGAAAAAGAGAATGTTGATAGCCCCAGCTAAGACCCCCAATCAGCTGTGGGACCTTTTTCCTCCTCTGCGCTCCATTCCTGGGGGT
TCAGCCTGAGAGTGAACTCAGCTGTCATCTGCAGCCTCTGCCTCCAGCCCGGCAGCTCTGGGGAGGCATCCGTGTGCCGGCCCTGCAGTG
CCTGCCCACGGTCAGGCATTGAAAACTAAGCCCAACCACTCTGCACTTTGTTTCCCACTCCCATTAGCCCTGGGCCACCTCCTCCAGTTC
TTCCTCTTTTACTAATTAGTTGGTCAGTTTGGAGAGTTGACTGGCACCATGGAGGGTAGGCAGGTGGGGGCTGGGTGGGGGACTGCCCAC

>In-frame_SUFU_ENST00000369902_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_6468nt
GACAGCCTGGGCGGACAGTGCGCCGTGCGCAGGCGCGGAGCTAGACCTCGCTGCAGCCCCCATCGCCTCGGGGAGTCTCACCCACCGAGT
CCGCCCGCTGGCCCGTCAGTGCTCTCCCCGTCGTTTGCCCTCTCCAGTTCCCCCAGTGCCTGCCCTACGCACCCCGATGGCGGAGCTGCG
GCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCA
CGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCC
AGACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCGGCCT
GAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTGACCTTTCGTCTGAA
GAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGATCCCACCCA
TGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGT
CCTGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATTATGCA
GTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGACATGGTGCAGCTGCT
CTTCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGCATGAG
TGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCC
CAATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAAGCTGC
CTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACTGATCTAGAGCAACC
TGGCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACCCATGT
GGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGT
CCATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGTCTTCC
CTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATTCACATGGGACTGCA
TTTGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCACTTATT
CCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAA
GTTCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATGGCACT
GGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTACTGTTCCAACCTCTT
TGAGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCCCTATT
GACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAG
CTGTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGACATCCC
AGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGC
TGACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAGAAGCT
GCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGA
CAACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAACATTGA
CCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCC
TGGGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGCGATGC
CTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCACCCATGACCCTGGA
GGAGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAGAATGA
GGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGG
CATATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTATGTCTT
TGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCACTATGGCCTCAGCGA
TGTGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGAAGCAA
CCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGGAAGAATATCATGGA
GGCCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATCTCTCT
ACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAG
TGTTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATCACAGA
AAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACATATGATGAGGAAGA
TGCTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGACCATCT
ATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCG
GAGAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCACCAGGT
TGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTCACACTGCTGGAGTG
CATCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGTGAGCT
CCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGCAGGCCGGGCAAGAT
ACACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGGCCCAG
CCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAGTCTCTGCTTAAGTG
TGTGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATCTTTGT
GGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAACCGCTTCAAGAAGAA
ATCCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGACGAAGG
CGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACGCGGGCAGCCTCTAT
CTACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCACTGCTG
GTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTATCTGCAGCGAGCACT
ACTTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTCTTGGA
GAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTC
TCCACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGCGACTT
ACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCAGATGCACGGGGAGG
CGGCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACCGTCAT
CCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGACACTAGGACACCTGG
CCATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGCTCCCC
AGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCC
CTTGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCAGTGCC
CCTCCTGGCCACACCCCGCCCCACAGATCCCATACCCACCTCTGAGGTCAACTAAGGCAGGTCACTCAGAGATCAGGACCAGTGCTTCCC
ACCAGGCTTTCCTTGACCCCACTTCTGGCTGTCCTGCGGGCCACAAGCTCTTCAGGCCAAGTCAGAGCTGCTGTTGCTGCCACTTGGATG
GGGACCTGAAAAAGAGAATGTTGATAGCCCCAGCTAAGACCCCCAATCAGCTGTGGGACCTTTTTCCTCCTCTGCGCTCCATTCCTGGGG
GTTCAGCCTGAGAGTGAACTCAGCTGTCATCTGCAGCCTCTGCCTCCAGCCCGGCAGCTCTGGGGAGGCATCCGTGTGCCGGCCCTGCAG
TGCCTGCCCACGGTCAGGCATTGAAAACTAAGCCCAACCACTCTGCACTTTGTTTCCCACTCCCATTAGCCCTGGGCCACCTCCTCCAGT
TCTTCCTCTTTTACTAATTAGTTGGTCAGTTTGGAGAGTTGACTGGCACCATGGAGGGTAGGCAGGTGGGGGCTGGGTGGGGGACTGCCC

>In-frame_SUFU_ENST00000369899_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_6448nt
CGCCGTGCGCAGGCGCGGAGCTAGACCTCGCTGCAGCCCCCATCGCCTCGGGGAGTCTCACCCACCGAGTCCGCCCGCTGGCCCGTCAGT
GCTCTCCCCGTCGTTTGCCCTCTCCAGTTCCCCCAGTGCCTGCCCTACGCACCCCGATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCC
CCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCACGCCATCTACGGAGAGTGCC
GCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCCAGACCCCTTGGACTATGTTA
GCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCGGCCTGAGTGATCTCTATGGTGACA
ACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTGACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTG
CCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGATCCCACCCATGAGGGCACAGCAGAGGGCA
TGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGTCCTGATGAAAATCCTTCAGG
TTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATTATGCAGTCTTGCTTCCGGATCTGCT
TTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGACATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGT
TTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGCATGAGTGATTCATCCAAATGGAAGA
AACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCCCAATGGAACCACCTTATCAT
CTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAAGCTGCCTCAGCAGTGGTCAGTCCCT
CTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACTGATCTAGAGCAACCTGGCTCTCCAGGGTACAGCA
CAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACCCATGTGGAAAAGTCCCAGTCAGCAT
CTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGTCCATGACATGGATTACGTCA
ATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGTCTTCCCTGCATCCGCGAGCTCTTCC
GCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATTCACATGGGACTGCATTTGCTGACAGTGGCCCTTG
AGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCACTTATTCCAGCTACTCAGCATAGAGC
GACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAAGTTCCAAATGGAGATGTACA
TCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATGGCACTGGAGGCCATTGTGCAGCTCT
GGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTACTGTTCCAACCTCTTTGAGGAACTCACAAAGCTGC
TGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCCCTATTGACAGTGATTGACAGCACCG
AGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAGCTGTGAGATAGTAGATGGCA
CCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGACATCCCAGGCCTGCATCTGCCAGGTG
GAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGA
AGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAGAAGCTGCTAATCACTGGCACAGAGC
AGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGACAACACAGAGGTTGCTCAGT
GGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAACATTGACCTGTTGGAGAGCTTTGTGA
GCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCC
AGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGCGATGCCTGCTTTTCCCTGGCCTATG
CTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCACCCATGACCCTGGAGGAGTTTCGCAAAAATCTGA
AAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAGAATGAGGAAATTGTAATGCCTGAGG
AGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGGCATATTCCTGCGTGTGCCTA
CTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTATGTCTTTGACAAAAGCCTTGAGGAGA
CAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCACTATGGCCTCAGCGATGTGTTTGACAATCTCATCA
TCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGAAGCAACCCTAAAGCCCATATTGCAG
CCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGGAAGAATATCATGGAGGCCATGCTGCAGCTCTTCC
GAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATCTCTCTACAGCGGGAAGAGACACCAT
CAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTG
AAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATCACAGAAAGCAAGTTCCTCCAGCTGG
AGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACATATGATGAGGAAGATGCTGCTTTCTGCCTAGAGA
TGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGACCATCTATACCACCTCTGTGTTCAGG
CACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTC
AGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCACCAGGTTGCGTATGGGCTCCATGAAC
TCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTCACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGC
CTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGTGAGCTCCCATCCTACCATCAGAATG
ACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGCAGGCCGGGCAAGATACACCGATCAGCCACAGATG
CCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGGCCCAGCCGCCCAGGCCCTTCACCCC
TGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAGTCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCA
TTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATCTTTGTGGAGGCCAGTCTGAATGGCG
GATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAACCGCTTCAAGAAGAAATCCAAAGAGGGATCAATGC
TTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGACGAAGGCGTGCCTGCCAGCTACCATA
CGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACGCGGGCAGCCTCTATCTACAGCTCATGGGCGGAGG
AGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCACTGCTGGTGCCCTTTACTGCAGGGTA
TTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTATCTGCAGCGAGCACTACTTGTACATGATCTGCAAA
AGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTCTTGGAGAACATCAGCCCTGCAGATG
TGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTCTCCACTGCTGTCACTCTCTA
CCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGCGACTTACTGTCAGAGGCGATCCCTG
AGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCAGATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGG
AGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACCGTCATCCAGGACCCCATGCCCATGG
AGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGACACTAGGACACCTGGCCATCCACCGCCCCCAGAGA
TTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGCTCCCCAGGATCACCAGTGGCCTCAA
GCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGG
TGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCAGTGCCCCTCCTGGCCACACCCCGCC
CCACAGATCCCATACCCACCTCTGAGGTCAACTAAGGCAGGTCACTCAGAGATCAGGACCAGTGCTTCCCACCAGGCTTTCCTTGACCCC
ACTTCTGGCTGTCCTGCGGGCCACAAGCTCTTCAGGCCAAGTCAGAGCTGCTGTTGCTGCCACTTGGATGGGGACCTGAAAAAGAGAATG
TTGATAGCCCCAGCTAAGACCCCCAATCAGCTGTGGGACCTTTTTCCTCCTCTGCGCTCCATTCCTGGGGGTTCAGCCTGAGAGTGAACT
CAGCTGTCATCTGCAGCCTCTGCCTCCAGCCCGGCAGCTCTGGGGAGGCATCCGTGTGCCGGCCCTGCAGTGCCTGCCCACGGTCAGGCA
TTGAAAACTAAGCCCAACCACTCTGCACTTTGTTTCCCACTCCCATTAGCCCTGGGCCACCTCCTCCAGTTCTTCCTCTTTTACTAATTA
GTTGGTCAGTTTGGAGAGTTGACTGGCACCATGGAGGGTAGGCAGGTGGGGGCTGGGTGGGGGACTGCCCACAGGAGCATGTACATATGG

>In-frame_SUFU_ENST00000423559_chr10_104309863_+_GBF1_ENST00000369983_chr10_104111013_+_6376nt
GCCCGCTGGCCCGTCAGTGCTCTCCCCGTCGTTTGCCCTCTCCAGTTCCCCCAGTGCCTGCCCTACGCACCCCGATGGCGGAGCTGCGGC
CTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCCCGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCACG
CCATCTACGGAGAGTGCCGCCGCCTTTACCCTGACCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCCAG
ACCCCTTGGACTATGTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCGGCCTGA
GTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGGCTTTGAGTTGACCTTTCGTCTGAAGA
GAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTAATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGATCCCACCCATG
AGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGTTTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGTCC
TGATGAAAATCCTTCAGGTTCTACGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATTATGCAGT
CTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCCGCAGAGCACACTCTCGTAGACATGGTGCAGCTGCTCT
TCACAAGGTTACCTCAGTTTAAAGAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGCATGAGTG
ATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATGACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCCCA
ATGGAACCACCTTATCATCTAACCTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAAGCTGCCT
CAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACCACTTCCAAGGAAGACCTTACTGATCTAGAGCAACCTG
GCTCTCCAGGGTACAGCACAGCTACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACCCATGTGG
AAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGCACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGTCC
ATGACATGGATTACGTCAATCCCCGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGTCTTCCCT
GCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGCCATAACTCAGAGGTTATGATTCACATGGGACTGCATT
TGCTGACAGTGGCCCTTGAGTCAGCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCACTTATTCC
AGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGCTTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAAGT
TCCAAATGGAGATGTACATCAAAAAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATGGCACTGG
AGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATCAACTATGATTGTGACTACTACTGTTCCAACCTCTTTG
AGGAACTCACAAAGCTGCTGTCCAAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCCCTATTGA
CAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTCACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAGCT
GTGAGATAGTAGATGGCACCCGAGAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGACATCCCAG
GCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGATGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGCTG
ACAAAAAGTTTGCCCGGAAGCCACCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAGAAGCTGC
TAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTTCTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGACA
ACACAGAGGTTGCTCAGTGGCTCCGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAACATTGACC
TGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAAGCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCCTG
GGGAAGCACCAGTCATCCAGAGGTTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGCGATGCCT
GCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCACAATGTTCGTAAACAGAATGCACCCATGACCCTGGAGG
AGTTTCGCAAAAATCTGAAAGGTGTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAGAATGAGG
AAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGGAATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGGCA
TATTCCTGCGTGTGCCTACTGCCAGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTATGTCTTTG
ACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAGTGCGCCATGATCTCCGCCCACTATGGCCTCAGCGATG
TGTTTGACAATCTCATCATCTCTCTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGAAGCAACC
CTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGTGACATCCTGCGGGAGGGCTGGAAGAATATCATGGAGG
CCATGCTGCAGCTCTTCCGAGCCCAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATCTCTCTAC
AGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTGAGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAGTG
TTCGGGGCCCATCCACTGAAAACCAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATCACAGAAA
GCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCAGTGACACCAGATGAAGAGACATATGATGAGGAAGATG
CTGCTTTCTGCCTAGAGATGCTGCTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGACCATCTAT
ACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTGGTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCGGA
GAGAAGAGATCAGTGCTCAGGTGCTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCACCAGGTTG
CGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGTGATGACTGGGCCACACTCTTCACACTGCTGGAGTGCA
TCGGCTCAGGTGTGAAGCCTCCAGCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGTGAGCTCC
CATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCAGAGGTCTACACTGACCATGGCAGGCCGGGCAAGATAC
ACCGATCAGCCACAGATGCCGATGTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGGCCCAGCC
GCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGATTTGGGGCCACACGACACTAAGTCTCTGCTTAAGTGTG
TGGAATCGCTGTCCTTCATTGTGCGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATCTTTGTGG
AGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCACAAATATGACAGCAAAGGGAACCGCTTCAAGAAGAAAT
CCAAAGAGGGATCAATGCTTCGCCGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGACGAAGGCG
TGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGACCTGATGCACACCCTGCACACGCGGGCAGCCTCTATCT
ACAGCTCATGGGCGGAGGAGCAACGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCACTGCTGGT
GCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTACGGATGCAGGCACTGACCTATCTGCAGCGAGCACTAC
TTGTACATGATCTGCAAAAGCTAGATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTCTTGGAGA
ACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCCACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTCTC
CACTGCTGTCACTCTCTACCTTTGCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGCGACTTAC
TGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACAGCGGAGATTTTCCACAGTGCAGATGCACGGGGAGGCG
GCCCCTCGGCCCTCTGGGAGATCACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACCGTCATCC
AGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCACCTGACTTCCGCTGCTGGCGACACTAGGACACCTGGCC
ATCCACCGCCCCCAGAGATTCCATCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGCTCCCCAG
GATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCTCCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCCCT
TGGCCTCCCCACTGCAGGTGGGCGTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCAGTGCCCC
TCCTGGCCACACCCCGCCCCACAGATCCCATACCCACCTCTGAGGTCAACTAAGGCAGGTCACTCAGAGATCAGGACCAGTGCTTCCCAC
CAGGCTTTCCTTGACCCCACTTCTGGCTGTCCTGCGGGCCACAAGCTCTTCAGGCCAAGTCAGAGCTGCTGTTGCTGCCACTTGGATGGG
GACCTGAAAAAGAGAATGTTGATAGCCCCAGCTAAGACCCCCAATCAGCTGTGGGACCTTTTTCCTCCTCTGCGCTCCATTCCTGGGGGT
TCAGCCTGAGAGTGAACTCAGCTGTCATCTGCAGCCTCTGCCTCCAGCCCGGCAGCTCTGGGGAGGCATCCGTGTGCCGGCCCTGCAGTG
CCTGCCCACGGTCAGGCATTGAAAACTAAGCCCAACCACTCTGCACTTTGTTTCCCACTCCCATTAGCCCTGGGCCACCTCCTCCAGTTC
TTCCTCTTTTACTAATTAGTTGGTCAGTTTGGAGAGTTGACTGGCACCATGGAGGGTAGGCAGGTGGGGGCTGGGTGGGGGACTGCCCAC


Top

FusionGenePPI for SUFU_GBF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SUFUQPRT, GLIS3, RCN3, ZNF446, ZNF764, MID1IP1, ZNF263, PEX26, GLI1, SUFU, GLI2, GLI3, ZNF747, HDX, SAP18, FBXL17, NXPH3, NFATC3, LIPT1, NR2E1, TTLL3, FAM90A1, ALDH1B1, ZBTB46, LDLRAD4, EDEM1, STK36, CDC25C, BFSP2, ZNF785, ZFC3H1, UBE3D, LRRC36, LOXL3, OVOL1, PEX11A, PRPF31, PCK2, BMP4GBF1YWHAG, COPG1, KBTBD7, VCP, HDAC6, EGFR, PNPLA2, YWHAB, BIRC6, EPS15L1, NUP85, PLEC, CCAR2, NCAPH, RABL6, IRS4, IVNS1ABP, FBXW11, BTRC, SPACA1, PNKD, LYPD3, KIF4A, PUS7, RBM26, VARS, NTRK1, SRPK2, FBXO7, ZSCAN26, FOXB1, FOXG1, FOXI2, FOXL1, CDC73, TMEM206, CHRM3, GML, MILR1, DLK2, NPY2R, EPHA1, UBC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneGBF1chr10:104309863chr10:104111013ENST00000369983+3401_380981860RAB1B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SUFU_GBF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SUFU_GBF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSUFUC0007117Basal cell carcinoma1CTD_human;HPO