FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36682

FusionGeneSummary for STXBP5L_EPHA3

check button Fusion gene summary
Fusion gene informationFusion gene name: STXBP5L_EPHA3
Fusion gene ID: 36682
HgeneTgene
Gene symbol

STXBP5L

EPHA3

Gene ID

9515

2042

Gene namesyntaxin binding protein 5 likeEPH receptor A3
SynonymsLLGL4EK4|ETK|ETK1|HEK|HEK4|TYRO4
Cytomap

3q13.33

3p11.1

Type of geneprotein-codingprotein-coding
Descriptionsyntaxin-binding protein 5-likelethal(2) giant larvae protein homolog 4tomosyn-2tomosyn-likeephrin type-A receptor 3EPH-like kinase 4TYRO4 protein tyrosine kinaseeph-like tyrosine kinase 1human embryo kinase 1testicular tissue protein Li 64tyrosine-protein kinase receptor ETK1
Modification date2018052320180523
UniProtAcc

Q9Y2K9

P29320

Ensembl transtripts involved in fusion geneENST00000273666, ENST00000471454, 
ENST00000472879, ENST00000497029, 
ENST00000492541, 
ENST00000336596, 
ENST00000452448, ENST00000494014, 
Fusion gene scores* DoF score1 X 1 X 1=14 X 4 X 4=64
# samples 14
** MAII scorelog2(1/1*10)=3.32192809488736log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STXBP5L [Title/Abstract] AND EPHA3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneEPHA3

GO:0018108

peptidyl-tyrosine phosphorylation

11877430

TgeneEPHA3

GO:0032956

regulation of actin cytoskeleton organization

11870224

TgeneEPHA3

GO:0043087

regulation of GTPase activity

11870224

TgeneEPHA3

GO:0045806

negative regulation of endocytosis

11877430

TgeneEPHA3

GO:0048013

ephrin receptor signaling pathway

11870224

TgeneEPHA3

GO:0051893

regulation of focal adhesion assembly

11870224

TgeneEPHA3

GO:0070507

regulation of microtubule cytoskeleton organization

11870224

TgeneEPHA3

GO:1903078

positive regulation of protein localization to plasma membrane

11877430


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKICHTCGA-KL-8341-01ASTXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000273666ENST00000336596STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000273666ENST00000452448STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000273666ENST00000494014STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000471454ENST00000336596STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000471454ENST00000452448STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000471454ENST00000494014STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000472879ENST00000336596STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000472879ENST00000452448STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000472879ENST00000494014STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000497029ENST00000336596STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000497029ENST00000452448STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000497029ENST00000494014STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000492541ENST00000336596STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000492541ENST00000452448STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+
In-frameENST00000492541ENST00000494014STXBP5Lchr3

121100379

+EPHA3chr3

89444987

+

Top

FusionProtFeatures for STXBP5L_EPHA3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STXBP5L

Q9Y2K9

EPHA3

P29320

May play a role in vesicle trafficking and exocytosis.{ECO:0000305}. Receptor tyrosine kinase which binds promiscuouslymembrane-bound ephrin family ligands residing on adjacent cells,leading to contact-dependent bidirectional signaling intoneighboring cells. The signaling pathway downstream of thereceptor is referred to as forward signaling while the signalingpathway downstream of the ephrin ligand is referred to as reversesignaling. Highly promiscuous for ephrin-A ligands it bindspreferentially EFNA5. Upon activation by EFNA5 regulates cell-celladhesion, cytoskeletal organization and cell migration. Plays arole in cardiac cells migration and differentiation and regulatesthe formation of the atrioventricular canal and septum duringdevelopment probably through activation by EFNA1. Involved in theretinotectal mapping of neurons. May also control the segregationbut not the guidance of motor and sensory axons duringneuromuscular circuit development. {ECO:0000269|PubMed:11870224}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328114_1538861187RepeatNote=WD 2
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328158_1948861187RepeatNote=WD 3
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328213_2478861187RepeatNote=WD 4
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328253_2858861187RepeatNote=WD 5
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328307_3498861187RepeatNote=WD 6
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328357_3918861187RepeatNote=WD 7
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328413_4908861187RepeatNote=WD 8
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328518_6298861187RepeatNote=WD 9
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328643_7058861187RepeatNote=WD 10
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+232874_1078861187RepeatNote=WD 1
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328832_8898861187RepeatNote=WD 11
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417436_531435984DomainFibronectin type-III 2
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417621_882435984DomainProtein kinase
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417911_975435984DomainSAM
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47436_531435540DomainFibronectin type-III 2
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47621_882435540DomainProtein kinase
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47911_975435540DomainSAM
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417981_983435984MotifPDZ-binding
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47981_983435540MotifPDZ-binding
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417628_633435984Nucleotide bindingNote=ATP
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417700_706435984Nucleotide bindingNote=ATP
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417750_751435984Nucleotide bindingNote=ATP
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47628_633435540Nucleotide bindingNote=ATP
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47700_706435540Nucleotide bindingNote=ATP
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47750_751435540Nucleotide bindingNote=ATP
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417566_983435984Topological domainCytoplasmic
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47566_983435540Topological domainCytoplasmic
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417542_565435984TransmembraneHelical
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47542_565435540TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+23281121_11818861187Domainv-SNARE coiled-coil homology
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+23281032_10558861187RepeatNote=WD 14
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328898_9698861187RepeatNote=WD 12
HgeneSTXBP5Lchr3:121100379chr3:89444987ENST00000273666+2328974_10188861187RepeatNote=WD 13
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417189_322435984Compositional biasNote=Cys-rich
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47189_322435540Compositional biasNote=Cys-rich
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+41729_207435984DomainEph LBD
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+417325_435435984DomainFibronectin type-III 1
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+4729_207435540DomainEph LBD
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+47325_435435540DomainFibronectin type-III 1
TgeneEPHA3chr3:121100379chr3:89444987ENST00000336596+41721_541435984Topological domainExtracellular
TgeneEPHA3chr3:121100379chr3:89444987ENST00000452448+4721_541435540Topological domainExtracellular


Top

FusionGeneSequence for STXBP5L_EPHA3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_1435aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRE
NSTNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTS
RNSISLSWQEPEHPNGIILDYEVKYTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGES
SQVVMIAISAAVAIILLTVVITVLIGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGA
GEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGTVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWS
TGIVLWEVMSTGERPYWEMSNQDVIKAVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS

>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_991aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRE
NSTNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTS
RNSISLSWQEPEHPNGIILDYEVKYTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDCMTTFNAV

>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_1370aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRE
NSTNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTS
RNSISLSWQEPEHPNGIILDYEVKYTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGES
SQVVMIAISAAVAIILLTVVITVLIGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGA
GEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGTVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWS
TGIVLWEVMSTGERPYWEMSNQDVIKAVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_1411aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIAGLTELNDSPVPLELERC
KSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSTNRSRSSSISSIDKDSKEAITA
LYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVK
YTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVITVL
IGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIK
TLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGTV
HRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWSTGIVLWEVMSTGERPYWEMSNQDV
IKAVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGV

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_967aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIAGLTELNDSPVPLELERC
KSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSTNRSRSSSISSIDKDSKEAITA
LYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVK

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_1346aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIAGLTELNDSPVPLELERC
KSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSTNRSRSSSISSIDKDSKEAITA
LYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVK
YTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVITVL
IGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIK
TLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGTV
HRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWSTGIVLWEVMSTGERPYWEMSNQDV

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_1411aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIAGLTELNDSPVPLELERC
KSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSTNRSRSSSISSIDKDSKEAITA
LYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVK
YTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVITVL
IGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIK
TLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGTV
HRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWSTGIVLWEVMSTGERPYWEMSNQDV
IKAVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGV

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_967aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIAGLTELNDSPVPLELERC
KSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSTNRSRSSSISSIDKDSKEAITA
LYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVK

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_1346aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIAGLTELNDSPVPLELERC
KSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSTNRSRSSSISSIDKDSKEAITA
LYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVK
YTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVITVL
IGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIK
TLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGTV
HRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWSTGIVLWEVMSTGERPYWEMSNQDV

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_1409aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSGLATRTPESALGFTRNEISAMRQRNQVTHLPENRENSTNRSRSSSISSIDKDSKEAITALY
FMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYT
EKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVITVLIG
RFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTL
KVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGTVHR
DLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWSTGIVLWEVMSTGERPYWEMSNQDVIK
AVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWT

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_965aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSGLATRTPESALGFTRNEISAMRQRNQVTHLPENRENSTNRSRSSSISSIDKDSKEAITALY
FMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYT

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_1344aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSGLATRTPESALGFTRNEISAMRQRNQVTHLPENRENSTNRSRSSSISSIDKDSKEAITALY
FMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYT
EKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVITVLIG
RFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTL
KVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGTVHR
DLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWSTGIVLWEVMSTGERPYWEMSNQDVIK

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_1435aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRE
NSTNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTS
RNSISLSWQEPEHPNGIILDYEVKYTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGES
SQVVMIAISAAVAIILLTVVITVLIGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGA
GEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGTVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWS
TGIVLWEVMSTGERPYWEMSNQDVIKAVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_991aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRE
NSTNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTS
RNSISLSWQEPEHPNGIILDYEVKYTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDCMTTFNAV

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_1370aa
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSETFQICKTVRHGFPHQPTALAFDPVQKILAIGTR
TGAIRILGRPGVDCTCQHESGAAVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLTVGTERGNTH
IVNIESFILSGTVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGTENGTVVFWDLKSKRAELRVTTDEAIHSIDWHHEGKQFMCSHS
DGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEYKTCKNSEPFIIFSGGLSTDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPTPNEFQEPTAVVVLLEKDLIVVDLTQSNFPIFENPTPMDIHESPVTCTAYFADCPPDLILVLTSIGVKHKKQGYSNKEWPISG
GAWNLGAQTTPEIIITGHADGSIKFWDASAITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSATVII
TKFSRHEITTEIVSLEVRLQTDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASEGVTKDSIPCLNVKTRPVRMPPGTQAELVIQ
LVWVDGEPPQQITSLAVSSATGIVAFGNCNGLAVVDFIQKTVLLSMGTIDLTRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFTPDLTK
RIRTSTQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRE
NSTNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVLPSAPSPVLTIKKDRTS
RNSISLSWQEPEHPNGIILDYEVKYTEKQEQETSTTILRARGTNVTISSLKPDTIYVFQIRARTAAGTGTNSRKFEFETSPDSFSISGES
SQVVMIAISAAVAIILLTVVITVLIGRFCGTKSKHGADEKRLHFGNGHLKLPGLRTTVDPHTTEDPTQAVHEFAKELDATNISIDKVVGA
GEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGTVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAATTTRGGKIPIRWTSPEAIAYRKFTSASDVWS
TGIVLWEVMSTGERPYWEMSNQDVIKAVDEGTRLPPPMDCPAALTQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_4305nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGAC
CATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGC
TGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAA
AATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCC
TTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCA
TTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCC
AGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAA
CAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATC
CGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGT
AGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGC
TATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCA
CATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCA
GGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTAC
ACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTT
ACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACT
GTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCT
CGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTAT
ACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGT
TATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAG
GGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCC
AAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCA
AACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTCTGGACAGCACACTGCAAG
GAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGTT

>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_2973nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGAC
CATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGC
TGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAA
AATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCC
TTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCA
TTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCC
AGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAA
CAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATC
CGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATGTATTATTTCAATGCAGTC

>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4110nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGAC
CATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGC
TGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAA
AATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCC
TTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCA
TTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCC
AGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAA
CAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATC
CGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGT
AGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGC
TATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCA
CATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCA
GGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTAC
ACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTT
ACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACT
GTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCT
CGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTAT
ACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGT
TATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAG
GGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCC
AAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCA

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_4233nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGC
AAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGAT
GTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACA
ACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCA
CTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATC
ATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATT
AAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAA
TACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACT
ATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTC
TCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTG
ATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTC
AGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATT
GATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAG
ACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATT
CGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAA
CACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTT
CACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGAT
GACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCA
GCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTA
ATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAA
GACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGT
GCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTC
TGGACAGCACACTGCAAGGAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAG
GTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTG

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_2901nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGC
AAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGAT
GTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACA
ACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCA
CTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATC
ATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATT
AAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAA
TACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACT
ATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATG

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4038nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGC
AAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGAT
GTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACA
ACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCA
CTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATC
ATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATT
AAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAA
TACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACT
ATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTC
TCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTG
ATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTC
AGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATT
GATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAG
ACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATT
CGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAA
CACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTT
CACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGAT
GACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCA
GCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTA
ATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAA
GACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGT

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_4233nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGC
AAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGAT
GTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACA
ACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCA
CTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATC
ATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATT
AAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAA
TACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACT
ATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTC
TCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTG
ATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTC
AGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATT
GATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAG
ACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATT
CGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAA
CACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTT
CACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGAT
GACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCA
GCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTA
ATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAA
GACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGT
GCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTC
TGGACAGCACACTGCAAGGAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAG
GTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTG

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_2901nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGC
AAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGAT
GTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACA
ACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCA
CTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATC
ATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATT
AAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAA
TACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACT
ATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATG

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4038nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGC
AAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGAT
GTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACA
ACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCA
CTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATC
ATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATT
AAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAA
TACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACT
ATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTC
TCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTG
ATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTC
AGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATT
GATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAG
ACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATT
CGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAA
CACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTT
CACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGAT
GACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCA
GCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTA
ATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAA
GACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGT

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_4227nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGGA
CTTGCTACCAGAACCCCTGAGTCAGCACTAGGCTTTTATAGGAATGAAATATCAGCTATGAGACAGAGGAATCAAGTATATCACTTGCCA
GAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATAC
TTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCC
TTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAA
GATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTAT
GAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATAC
GTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATC
TCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGG
AGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACT
TATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAA
GTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTG
AAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTG
GAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGAT
GCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGA
GACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCA
GAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGC
GATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAA
GCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGG
AACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCC
GCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTCTGGACA
GCACACTGCAAGGAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGT

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_2895nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGGA
CTTGCTACCAGAACCCCTGAGTCAGCACTAGGCTTTTATAGGAATGAAATATCAGCTATGAGACAGAGGAATCAAGTATATCACTTGCCA
GAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATAC
TTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCC
TTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAA
GATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTAT
GAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATAC
GTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATGTATTAT

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4032nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGGA
CTTGCTACCAGAACCCCTGAGTCAGCACTAGGCTTTTATAGGAATGAAATATCAGCTATGAGACAGAGGAATCAAGTATATCACTTGCCA
GAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATAC
TTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCC
TTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAA
GATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTAT
GAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATAC
GTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATC
TCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGG
AGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACT
TATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAA
GTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTG
AAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTG
GAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGAT
GCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGA
GACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCA
GAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGC
GATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAA
GCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGG
AACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCC

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_4305nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGAC
CATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGC
TGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAA
AATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCC
TTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCA
TTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCC
AGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAA
CAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATC
CGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGT
AGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGC
TATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCA
CATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCA
GGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTAC
ACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTT
ACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACT
GTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCT
CGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTAT
ACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGT
TATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAG
GGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCC
AAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCA
AACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTCTGGACAGCACACTGCAAG
GAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGTT

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_2973nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGAC
CATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGC
TGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAA
AATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCC
TTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCA
TTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCC
AGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAA
CAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATC
CGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATGTATTATTTCAATGCAGTC

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4110nt
ATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGT
GGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAG
ATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGA
ACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTG
ATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCT
CTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACAT
ATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCA
GTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCT
AAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCA
GATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGA
AAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCC
TATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTT
CTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGAT
CTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGAT
TGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGA
GGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCA
ATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTA
GAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATT
TATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAA
CCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAA
GGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAA
TTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAAT
GGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGA
CAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAAA
CGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGAC
CATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGC
TGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAA
AATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCC
TTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCA
TTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCC
AGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAA
CAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATC
CGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGT
AGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGC
TATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCA
CATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCA
GGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTAC
ACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTT
ACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACT
GTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCT
CGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTAT
ACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGT
TATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAG
GGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCC
AAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_7208nt
GACGTCCCCGGGCACCCCGCCCCCTTCACCTCCCAGCTTTGCCGGGGAAGAAGCAGGGCGGGGCAAGCTAGGGGCCGGCCCGGGGGCGGG
GCCTGCCTCCCACGGCGGGAGGGCGGAGCCTGCTCTGGAGCCTGACTGCTCGGTTAGGACCTCGGAGAGCGCCAGGCGCCGCGACCAGAG
GGCCCAGAGAAGCGGCCGGAGCCCGCCTACCTCGGCCCCCTCAGCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAA
AATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGG
TGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCA
GATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAG
AACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTT
GATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTC
TCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACA
TATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCC
AGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATC
TAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTC
AGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAG
AAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTC
CTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATT
TCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGA
TCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGA
TTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGG
AGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGC
AATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGT
AGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAAT
TTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGA
ACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGA
AGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCA
ATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAA
TGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCG
ACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAA
ACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGA
CCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCG
CTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGA
AAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTC
CTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACC
ATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTC
CAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGA
ACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAAT
CCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAG
TAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGG
CTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCC
ACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGC
AGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTA
CACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGT
TACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTAC
TGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGC
TCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTA
TACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAG
TTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGA
GGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACC
CAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATC
AAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTCTGGACAGCACACTGCAA
GGAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGT
TGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAA
GTGCTTCTGGACGGAAGTGGTGGCTGTGGAAGGCGTAGCATCATCCTGCAGACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAG
TCCAATAAGACACTCAAATATGAGTACAAATGCCTTAAAATGGAATTGAAAAACTCTTTATTTTCCCCTATCATTTATTGGATGGGTGGG
TGGGGTATTTTTTTGTAATTGCTTTTTTAAATATTAGTTAATGGATTAAATTTAATTCTTCAGCGTAAAATGGTGAAGAACTAGCATATA
GCCATTGATCATAAACTGACTATCATAAAATCAAAACAAGTGAAATAACAAAATGGACATGGTGGCTTTGTTTAGGTAGAGCCACAAAAG
AAAAGACTTGTAATATTTTTATATACAGAGGAAATCTGTAACAGGTATTTTGTTTCTTTTAAAGCAAGCAACACAGAGGAATTTATACCT
CAAACTATCTGGCCATATTTACTACCTTATCACTGCATTATTCTCTTTTATCTGTTTAAAGCATATAGAGATGAAGTTTGTAGTTGTTTT
AAGTACTACACATTTTTAAATTGTTAGCTTCCTTAAGTATATCATGTAAAGAAATGTCTTAATTTTTGAAAAAAGTACATATTTATTTTC
TTTTGAATTGTTTTTATTGTTTTCTATTTATGCCTTGATGATTTAATATGGATTTGTTACAGCCAAGTGCCAAATGCTCTCTCAAATTGT
CAGCAATTTAACTAGACACAGATAATAATGGGTTTCTTTCAGATTTTTTGAACCATCCACTTACATATATTTTTAAAAAATGAAATCCTT
TTCCTGTTCATACACTAACCAAATCTCTCAAATCTGTTATCCCAATCATTGTTGCCTCTCCGTTTATTATAAACTGTATGCTCACAACTT
AGTGTAATATACCAGCTTGTATGCAATGGATTTTCAACCAGATAACATACCTTTCCTGCTCTGGTGCTTAGAGACTATCAACTCCCTCCT
TTAGTGAAGGAGCCGTGTTAGAGCTTCCGAGAATAGCTCCACTGGAGAGAAGTGGAATCCTATATAGAATGCTGCACTAATTGACAACAC
AGCCTATAGGCCAATGCATGAGTAAAAAAAAAAACAATTACTGGCTCACTGGCTTTGAAAAGTCACTTACTATTGTTGCTGAAACTTGCT
GAGCTGTTTATAGAGAATGATGATAACAGAACTTTTCCTCTGTATCACTGGTGTTTAGGTGAATTAATTAAACATTGTGATCATTAGTAC
CAGGTATTATTATCTTTAAGAGTCTTCCACTTCAATGCACATGGTGCAGTTTTGGTGTGTAACTTAGAAGGATTGAACTTCTTTGAATTT
ACTGGACATAACATTTTCAGAATAGTTGGTCATCTAGCAACCGCCTCAAAATGTGTAAGCAGGAGAGAAATTTCTCATCACAGGGATTTA
GACTTACTATTACATAAAGGCTAACTATGAGCTTGCTCATTAATTTTGAAAAGATGTACCTGGTGGATATCTAGCTAGTAATATATTCTG
AAGCAACATTTTAGCTCTATTGATACTCTTTCTAATGCTGATATGATCTTGAGTATAAGAAATGCATATGTCACTAGAATGGATAAAATA
ATGCTGCAAACTTAATGTTCTTATGCAAAATGGAACGCTAATGAAACACAGCTTACAATCGCAAATCAAAACTCACAAGTGCTCATCTGT
TGTAGATTTAGTGTAATAAGACTTAGATTGTGCTCCTTCGGATATGATTGTTTCTCAAATCTTGGCAATATTCCTTAGTCAAATCAGGCT
ACTAGAATTCTGTATTGGATATATAAGAGCATGAAATTTTTAAAAATACACTTGTGATTATAAAATTAATCACAAATTTCACTTATACCT
GCTATCAGCAGCTAGAAAACATTTTTTTTTTAAATCAAGTATTTTGTGTTTGGAATGTTAGAATGAGATCTGAATGTGGTTTCAATCTAA
TTTTTTCCCAGACTACTATTTTCTTTTTTAGGTACTATTCTGAGCATACTCAACAAAACCCATGCATTTCATAAACTAATAGAAGTTGAG
GATTGTTGAATCTATTTCACTTATTTTGGCTGTGGTTTCCATCTGAAAGTAGAGGTTGTATACACCATATACTGTTCTTCATTTTATTAA
TATTTTTCTCCTTGACCTCTCATAAATTTACTTTACACAATTCTTACCCTGTACATATGTAAACATAAGTGTACGATTCTTAACCATGGA
GTAGAGGTACTAGAATGCTTACGGCCATCTCTTTGTACAGGAACTGCATTGACTTTCAGTAAACATAAAGCCACAACTCCTACATGATGT
TATGTACCATATGATCTGTTTTGTATCTTAAATTTGATTTACATATATTATTTATTTCTGGTAACTCACTCAGTTTATGCTGTGCTAAAT
ATCAATCAAGCCATGTATAAATGTGATATGATTGGCAATATGTGTTTACTTTAAACTTGTCTTTTCAAAATATTACTCAGTTTATGTTGT
ACAATGTAGATGGCCTCTTACTAATGTAAAATGATTTGTAGTGGAAACATTTATATTTTTATAATAAACATAATGAAAATATTTTTTACA

>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_4083nt
GACGTCCCCGGGCACCCCGCCCCCTTCACCTCCCAGCTTTGCCGGGGAAGAAGCAGGGCGGGGCAAGCTAGGGGCCGGCCCGGGGGCGGG
GCCTGCCTCCCACGGCGGGAGGGCGGAGCCTGCTCTGGAGCCTGACTGCTCGGTTAGGACCTCGGAGAGCGCCAGGCGCCGCGACCAGAG
GGCCCAGAGAAGCGGCCGGAGCCCGCCTACCTCGGCCCCCTCAGCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAA
AATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGG
TGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCA
GATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAG
AACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTT
GATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTC
TCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACA
TATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCC
AGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATC
TAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTC
AGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAG
AAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTC
CTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATT
TCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGA
TCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGA
TTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGG
AGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGC
AATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGT
AGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAAT
TTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGA
ACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGA
AGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCA
ATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAA
TGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCG
ACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAA
ACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGA
CCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCG
CTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGA
AAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTC
CTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACC
ATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTC
CAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGA
ACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAAT
CCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATGTATTATTTCAATGCAGT
CTAGAGGAGGGGGCAGGGATCTTGCAAAAGATGTCTGATCGTTTATTCTCACTGTTTCTAAGTTTTAAACAAATGTGATACATTTAAGGT
ATATTGCTTGGGACATTGCAATTTGCAGAGCCCTGTGTCTGTATACAGTATTTGTGTTTGTGTGGGTGTACATTTTGTGTTTCTTTTTTT
CTTGTATGCAAATCAAACATATTCTAATGCCTGAAATGCTTCTGTTTTTTTTTTTTAGCCATAAATTGCTTTTGAGGAACATTATTTAAT
ATAGTAACACACTTCCAGTGTCTGTCATTTCAGATATTCCAGGTTCATTGCGTGATTCAATGAACCACAAAAAAGAAACTTGCTGATCCA
TGAGAATCTTAATTTTGTTTTAATCCTTAACACATTCAATAGCATATCACAGAGAGAATAAGGATTTTCTAAAATGTGTTTTATCACTTC
ATTCACATTCAGAAGTAATTTGAATAGCCTGTTCCTTTAACCCCAAATTTGGCTAAAATTGGCCTAAAACTGGCAAACATTTTTCCAGTA
ACTTTTCTTTTTTTCAAATGAATTTTCTTCATACTTAAAAAAGCCCTTTGCTAAAATATAATTTTCAAAAAGGTAAAATTATGTCTATGG
CACTAATATAAAATGAGTAGAAGTTAATGATTTTACTTAACTCATTTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTGAGACGGAGTC
TTGCTCTGTCACCCAGGCTGGAGTACAGCAGAGCGATCTCGGCTCACTGCAAGCTCCTGCAAGCTCCGCCTCCTGGCTTCACGCCATTCT

>In-frame_STXBP5L_ENST00000273666_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4636nt
GACGTCCCCGGGCACCCCGCCCCCTTCACCTCCCAGCTTTGCCGGGGAAGAAGCAGGGCGGGGCAAGCTAGGGGCCGGCCCGGGGGCGGG
GCCTGCCTCCCACGGCGGGAGGGCGGAGCCTGCTCTGGAGCCTGACTGCTCGGTTAGGACCTCGGAGAGCGCCAGGCGCCGCGACCAGAG
GGCCCAGAGAAGCGGCCGGAGCCCGCCTACCTCGGCCCCCTCAGCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAA
AATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGG
TGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCA
GATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAG
AACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTT
GATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTC
TCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACA
TATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCC
AGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATC
TAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTC
AGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAG
AAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTC
CTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATT
TCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGA
TCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGA
TTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGG
AGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGC
AATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGT
AGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAAT
TTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGA
ACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGA
AGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCA
ATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAA
TGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCG
ACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCCTGTCTAACTTTTATCCTGATTTAACGAA
ACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGA
CCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCG
CTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGA
AAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTC
CTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACC
ATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTC
CAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGA
ACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAAT
CCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAG
TAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGG
CTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCC
ACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGC
AGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTA
CACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGT
TACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTAC
TGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGC
TCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTA
TACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAG
TTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGA
GGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACC
CAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATC
AAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGTGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCA
CAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTC
TGGACGGAAGTGGTGGCTGTGGAAGGCGTAGCATCATCCTGCAGACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATA

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_7003nt
GACTGCTCGGTTAGGACCTCGGAGAGCGCCAGGCGCCGCGACCAGAGGGCCCAGAGAAGCGGCCGGAGCCCGCCTACCTCGGCCCCCTCA
GCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACT
GCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGG
GTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACA
GCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGC
TATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACA
CTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCT
TTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATC
ATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTG
CTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCAT
TCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGC
CCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAG
ACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCAT
GGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAA
CCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCC
ATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTC
AAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATT
ATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTG
TTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCA
GAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCA
TTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTT
CCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACA
CGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGT
CTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTA
AGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGT
TTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGT
CCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTT
CGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGC
TCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACC
ATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACA
GAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGG
CAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTG
AGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATAT
GGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATT
TCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGAT
GAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAA
GCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGT
GGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTC
CTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATT
GTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTT
CGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAAC
TTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCA
ATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTG
ATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATG
GACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATT
CTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAAT
GTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTCTGGACAGCACACTGCAAGGAAATCTTCACGGGTGTGGAGTAC
AGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGT
AGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCT
GTGGAAGGCGTAGCATCATCCTGCAGACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATAAGACACTCAAATATGAGT
ACAAATGCCTTAAAATGGAATTGAAAAACTCTTTATTTTCCCCTATCATTTATTGGATGGGTGGGTGGGGTATTTTTTTGTAATTGCTTT
TTTAAATATTAGTTAATGGATTAAATTTAATTCTTCAGCGTAAAATGGTGAAGAACTAGCATATAGCCATTGATCATAAACTGACTATCA
TAAAATCAAAACAAGTGAAATAACAAAATGGACATGGTGGCTTTGTTTAGGTAGAGCCACAAAAGAAAAGACTTGTAATATTTTTATATA
CAGAGGAAATCTGTAACAGGTATTTTGTTTCTTTTAAAGCAAGCAACACAGAGGAATTTATACCTCAAACTATCTGGCCATATTTACTAC
CTTATCACTGCATTATTCTCTTTTATCTGTTTAAAGCATATAGAGATGAAGTTTGTAGTTGTTTTAAGTACTACACATTTTTAAATTGTT
AGCTTCCTTAAGTATATCATGTAAAGAAATGTCTTAATTTTTGAAAAAAGTACATATTTATTTTCTTTTGAATTGTTTTTATTGTTTTCT
ATTTATGCCTTGATGATTTAATATGGATTTGTTACAGCCAAGTGCCAAATGCTCTCTCAAATTGTCAGCAATTTAACTAGACACAGATAA
TAATGGGTTTCTTTCAGATTTTTTGAACCATCCACTTACATATATTTTTAAAAAATGAAATCCTTTTCCTGTTCATACACTAACCAAATC
TCTCAAATCTGTTATCCCAATCATTGTTGCCTCTCCGTTTATTATAAACTGTATGCTCACAACTTAGTGTAATATACCAGCTTGTATGCA
ATGGATTTTCAACCAGATAACATACCTTTCCTGCTCTGGTGCTTAGAGACTATCAACTCCCTCCTTTAGTGAAGGAGCCGTGTTAGAGCT
TCCGAGAATAGCTCCACTGGAGAGAAGTGGAATCCTATATAGAATGCTGCACTAATTGACAACACAGCCTATAGGCCAATGCATGAGTAA
AAAAAAAAACAATTACTGGCTCACTGGCTTTGAAAAGTCACTTACTATTGTTGCTGAAACTTGCTGAGCTGTTTATAGAGAATGATGATA
ACAGAACTTTTCCTCTGTATCACTGGTGTTTAGGTGAATTAATTAAACATTGTGATCATTAGTACCAGGTATTATTATCTTTAAGAGTCT
TCCACTTCAATGCACATGGTGCAGTTTTGGTGTGTAACTTAGAAGGATTGAACTTCTTTGAATTTACTGGACATAACATTTTCAGAATAG
TTGGTCATCTAGCAACCGCCTCAAAATGTGTAAGCAGGAGAGAAATTTCTCATCACAGGGATTTAGACTTACTATTACATAAAGGCTAAC
TATGAGCTTGCTCATTAATTTTGAAAAGATGTACCTGGTGGATATCTAGCTAGTAATATATTCTGAAGCAACATTTTAGCTCTATTGATA
CTCTTTCTAATGCTGATATGATCTTGAGTATAAGAAATGCATATGTCACTAGAATGGATAAAATAATGCTGCAAACTTAATGTTCTTATG
CAAAATGGAACGCTAATGAAACACAGCTTACAATCGCAAATCAAAACTCACAAGTGCTCATCTGTTGTAGATTTAGTGTAATAAGACTTA
GATTGTGCTCCTTCGGATATGATTGTTTCTCAAATCTTGGCAATATTCCTTAGTCAAATCAGGCTACTAGAATTCTGTATTGGATATATA
AGAGCATGAAATTTTTAAAAATACACTTGTGATTATAAAATTAATCACAAATTTCACTTATACCTGCTATCAGCAGCTAGAAAACATTTT
TTTTTTAAATCAAGTATTTTGTGTTTGGAATGTTAGAATGAGATCTGAATGTGGTTTCAATCTAATTTTTTCCCAGACTACTATTTTCTT
TTTTAGGTACTATTCTGAGCATACTCAACAAAACCCATGCATTTCATAAACTAATAGAAGTTGAGGATTGTTGAATCTATTTCACTTATT
TTGGCTGTGGTTTCCATCTGAAAGTAGAGGTTGTATACACCATATACTGTTCTTCATTTTATTAATATTTTTCTCCTTGACCTCTCATAA
ATTTACTTTACACAATTCTTACCCTGTACATATGTAAACATAAGTGTACGATTCTTAACCATGGAGTAGAGGTACTAGAATGCTTACGGC
CATCTCTTTGTACAGGAACTGCATTGACTTTCAGTAAACATAAAGCCACAACTCCTACATGATGTTATGTACCATATGATCTGTTTTGTA
TCTTAAATTTGATTTACATATATTATTTATTTCTGGTAACTCACTCAGTTTATGCTGTGCTAAATATCAATCAAGCCATGTATAAATGTG
ATATGATTGGCAATATGTGTTTACTTTAAACTTGTCTTTTCAAAATATTACTCAGTTTATGTTGTACAATGTAGATGGCCTCTTACTAAT

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_3878nt
GACTGCTCGGTTAGGACCTCGGAGAGCGCCAGGCGCCGCGACCAGAGGGCCCAGAGAAGCGGCCGGAGCCCGCCTACCTCGGCCCCCTCA
GCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACT
GCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGG
GTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACA
GCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGC
TATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACA
CTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCT
TTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATC
ATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTG
CTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCAT
TCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGC
CCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAG
ACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCAT
GGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAA
CCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCC
ATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTC
AAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATT
ATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTG
TTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCA
GAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCA
TTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTT
CCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACA
CGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGT
CTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTA
AGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGT
TTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGT
CCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTT
CGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGC
TCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACC
ATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACA
GAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGG
CAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTG
AGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATAT
GGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATGTATTATTTCAATGCAGTCTAGAGGAGGGGGCAGGGATCTTGC
AAAAGATGTCTGATCGTTTATTCTCACTGTTTCTAAGTTTTAAACAAATGTGATACATTTAAGGTATATTGCTTGGGACATTGCAATTTG
CAGAGCCCTGTGTCTGTATACAGTATTTGTGTTTGTGTGGGTGTACATTTTGTGTTTCTTTTTTTCTTGTATGCAAATCAAACATATTCT
AATGCCTGAAATGCTTCTGTTTTTTTTTTTTAGCCATAAATTGCTTTTGAGGAACATTATTTAATATAGTAACACACTTCCAGTGTCTGT
CATTTCAGATATTCCAGGTTCATTGCGTGATTCAATGAACCACAAAAAAGAAACTTGCTGATCCATGAGAATCTTAATTTTGTTTTAATC
CTTAACACATTCAATAGCATATCACAGAGAGAATAAGGATTTTCTAAAATGTGTTTTATCACTTCATTCACATTCAGAAGTAATTTGAAT
AGCCTGTTCCTTTAACCCCAAATTTGGCTAAAATTGGCCTAAAACTGGCAAACATTTTTCCAGTAACTTTTCTTTTTTTCAAATGAATTT
TCTTCATACTTAAAAAAGCCCTTTGCTAAAATATAATTTTCAAAAAGGTAAAATTATGTCTATGGCACTAATATAAAATGAGTAGAAGTT
AATGATTTTACTTAACTCATTTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTGAGACGGAGTCTTGCTCTGTCACCCAGGCTGGAGTA
CAGCAGAGCGATCTCGGCTCACTGCAAGCTCCTGCAAGCTCCGCCTCCTGGCTTCACGCCATTCTCCCCCTCAGCCTCCCGAGTAGCTGG

>In-frame_STXBP5L_ENST00000471454_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4431nt
GACTGCTCGGTTAGGACCTCGGAGAGCGCCAGGCGCCGCGACCAGAGGGCCCAGAGAAGCGGCCGGAGCCCGCCTACCTCGGCCCCCTCA
GCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACT
GCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGG
GTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACA
GCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGC
TATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACA
CTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCT
TTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATC
ATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTG
CTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCAT
TCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGC
CCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAG
ACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCAT
GGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAA
CCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCC
ATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTC
AAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATT
ATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTG
TTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCA
GAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCA
TTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTT
CCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACA
CGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGT
CTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTA
AGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGGT
TTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGT
CCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTT
CGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGC
TCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACC
ATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACA
GAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGG
CAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTG
AGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATAT
GGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATT
TCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGAT
GAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAA
GCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGT
GGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTC
CTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATT
GTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTT
CGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAAC
TTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCA
ATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTG
ATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATG
GACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATT
CTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAAT
GTGGATATCACTACCTTCCGCACAACAGTGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTA
AAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCTGTGGAAG
GCGTAGCATCATCCTGCAGACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATAAGACACTCAAATATGAGTACAAATG

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_6919nt
CCCTCAGCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGC
TTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACT
GCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAG
CCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTT
GATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGAT
GATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCAT
CTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATAT
GTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGC
AAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCT
ATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCA
AGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAA
TACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATC
ATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTT
CAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCA
TATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATA
GGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAA
ATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCA
AAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGG
TGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATA
GTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCC
CAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTG
AAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATT
ACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTA
CTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATT
GCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGC
ACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCA
CCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCT
AGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGAC
TCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGG
TTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTG
TCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACC
ATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCT
GGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATC
GCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGG
GCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCT
ACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTG
TGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGA
GACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTT
ATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGG
ATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAAC
AGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAG
ATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGG
GAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCC
CCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTT
AGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAA
AGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTTAATGGTGTCTGGACAGCACACTGCAAGGAAATCTTCACGGGTGTG
GAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATC
ATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTG
GTGGCTGTGGAAGGCGTAGCATCATCCTGCAGACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATAAGACACTCAAAT
ATGAGTACAAATGCCTTAAAATGGAATTGAAAAACTCTTTATTTTCCCCTATCATTTATTGGATGGGTGGGTGGGGTATTTTTTTGTAAT
TGCTTTTTTAAATATTAGTTAATGGATTAAATTTAATTCTTCAGCGTAAAATGGTGAAGAACTAGCATATAGCCATTGATCATAAACTGA
CTATCATAAAATCAAAACAAGTGAAATAACAAAATGGACATGGTGGCTTTGTTTAGGTAGAGCCACAAAAGAAAAGACTTGTAATATTTT
TATATACAGAGGAAATCTGTAACAGGTATTTTGTTTCTTTTAAAGCAAGCAACACAGAGGAATTTATACCTCAAACTATCTGGCCATATT
TACTACCTTATCACTGCATTATTCTCTTTTATCTGTTTAAAGCATATAGAGATGAAGTTTGTAGTTGTTTTAAGTACTACACATTTTTAA
ATTGTTAGCTTCCTTAAGTATATCATGTAAAGAAATGTCTTAATTTTTGAAAAAAGTACATATTTATTTTCTTTTGAATTGTTTTTATTG
TTTTCTATTTATGCCTTGATGATTTAATATGGATTTGTTACAGCCAAGTGCCAAATGCTCTCTCAAATTGTCAGCAATTTAACTAGACAC
AGATAATAATGGGTTTCTTTCAGATTTTTTGAACCATCCACTTACATATATTTTTAAAAAATGAAATCCTTTTCCTGTTCATACACTAAC
CAAATCTCTCAAATCTGTTATCCCAATCATTGTTGCCTCTCCGTTTATTATAAACTGTATGCTCACAACTTAGTGTAATATACCAGCTTG
TATGCAATGGATTTTCAACCAGATAACATACCTTTCCTGCTCTGGTGCTTAGAGACTATCAACTCCCTCCTTTAGTGAAGGAGCCGTGTT
AGAGCTTCCGAGAATAGCTCCACTGGAGAGAAGTGGAATCCTATATAGAATGCTGCACTAATTGACAACACAGCCTATAGGCCAATGCAT
GAGTAAAAAAAAAAACAATTACTGGCTCACTGGCTTTGAAAAGTCACTTACTATTGTTGCTGAAACTTGCTGAGCTGTTTATAGAGAATG
ATGATAACAGAACTTTTCCTCTGTATCACTGGTGTTTAGGTGAATTAATTAAACATTGTGATCATTAGTACCAGGTATTATTATCTTTAA
GAGTCTTCCACTTCAATGCACATGGTGCAGTTTTGGTGTGTAACTTAGAAGGATTGAACTTCTTTGAATTTACTGGACATAACATTTTCA
GAATAGTTGGTCATCTAGCAACCGCCTCAAAATGTGTAAGCAGGAGAGAAATTTCTCATCACAGGGATTTAGACTTACTATTACATAAAG
GCTAACTATGAGCTTGCTCATTAATTTTGAAAAGATGTACCTGGTGGATATCTAGCTAGTAATATATTCTGAAGCAACATTTTAGCTCTA
TTGATACTCTTTCTAATGCTGATATGATCTTGAGTATAAGAAATGCATATGTCACTAGAATGGATAAAATAATGCTGCAAACTTAATGTT
CTTATGCAAAATGGAACGCTAATGAAACACAGCTTACAATCGCAAATCAAAACTCACAAGTGCTCATCTGTTGTAGATTTAGTGTAATAA
GACTTAGATTGTGCTCCTTCGGATATGATTGTTTCTCAAATCTTGGCAATATTCCTTAGTCAAATCAGGCTACTAGAATTCTGTATTGGA
TATATAAGAGCATGAAATTTTTAAAAATACACTTGTGATTATAAAATTAATCACAAATTTCACTTATACCTGCTATCAGCAGCTAGAAAA
CATTTTTTTTTTAAATCAAGTATTTTGTGTTTGGAATGTTAGAATGAGATCTGAATGTGGTTTCAATCTAATTTTTTCCCAGACTACTAT
TTTCTTTTTTAGGTACTATTCTGAGCATACTCAACAAAACCCATGCATTTCATAAACTAATAGAAGTTGAGGATTGTTGAATCTATTTCA
CTTATTTTGGCTGTGGTTTCCATCTGAAAGTAGAGGTTGTATACACCATATACTGTTCTTCATTTTATTAATATTTTTCTCCTTGACCTC
TCATAAATTTACTTTACACAATTCTTACCCTGTACATATGTAAACATAAGTGTACGATTCTTAACCATGGAGTAGAGGTACTAGAATGCT
TACGGCCATCTCTTTGTACAGGAACTGCATTGACTTTCAGTAAACATAAAGCCACAACTCCTACATGATGTTATGTACCATATGATCTGT
TTTGTATCTTAAATTTGATTTACATATATTATTTATTTCTGGTAACTCACTCAGTTTATGCTGTGCTAAATATCAATCAAGCCATGTATA
AATGTGATATGATTGGCAATATGTGTTTACTTTAAACTTGTCTTTTCAAAATATTACTCAGTTTATGTTGTACAATGTAGATGGCCTCTT

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_3794nt
CCCTCAGCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGC
TTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACT
GCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAG
CCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTT
GATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGAT
GATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCAT
CTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATAT
GTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGC
AAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCT
ATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCA
AGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAA
TACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATC
ATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTT
CAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCA
TATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATA
GGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAA
ATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCA
AAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGG
TGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATA
GTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCC
CAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTG
AAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATT
ACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTA
CTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATT
GCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGC
ACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCA
CCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCT
AGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGAC
TCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGG
TTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTG
TCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACC
ATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCT
GGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTGTATGTATTATTTCAATGCAGTCTAGAGGAGGGGGCAGGGA
TCTTGCAAAAGATGTCTGATCGTTTATTCTCACTGTTTCTAAGTTTTAAACAAATGTGATACATTTAAGGTATATTGCTTGGGACATTGC
AATTTGCAGAGCCCTGTGTCTGTATACAGTATTTGTGTTTGTGTGGGTGTACATTTTGTGTTTCTTTTTTTCTTGTATGCAAATCAAACA
TATTCTAATGCCTGAAATGCTTCTGTTTTTTTTTTTTAGCCATAAATTGCTTTTGAGGAACATTATTTAATATAGTAACACACTTCCAGT
GTCTGTCATTTCAGATATTCCAGGTTCATTGCGTGATTCAATGAACCACAAAAAAGAAACTTGCTGATCCATGAGAATCTTAATTTTGTT
TTAATCCTTAACACATTCAATAGCATATCACAGAGAGAATAAGGATTTTCTAAAATGTGTTTTATCACTTCATTCACATTCAGAAGTAAT
TTGAATAGCCTGTTCCTTTAACCCCAAATTTGGCTAAAATTGGCCTAAAACTGGCAAACATTTTTCCAGTAACTTTTCTTTTTTTCAAAT
GAATTTTCTTCATACTTAAAAAAGCCCTTTGCTAAAATATAATTTTCAAAAAGGTAAAATTATGTCTATGGCACTAATATAAAATGAGTA
GAAGTTAATGATTTTACTTAACTCATTTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTGAGACGGAGTCTTGCTCTGTCACCCAGGCT
GGAGTACAGCAGAGCGATCTCGGCTCACTGCAAGCTCCTGCAAGCTCCGCCTCCTGGCTTCACGCCATTCTCCCCCTCAGCCTCCCGAGT

>In-frame_STXBP5L_ENST00000472879_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4347nt
CCCTCAGCTTCCCGGGCTGGCAGGCGGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGC
TTAACTGCCTCCTCCCCTGGCAGTGGTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACT
GCAGGGGTTCTCAGAGAGGAAATTCAGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAG
CCCACAGCATTAGCCTTTGATCCAGTTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTT
GATTGCTATTGCCAACATGAAAGTGGTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGAT
GATACACTTCATTTGTGGAACCTTAGACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCAT
CTACCTTTCCAGAGTAAATGGCTTTATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATAT
GTTATCATGTGGAACAAGGCAATTGAACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGC
AAACTGCTAATAGGTTATGAAAATGGTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCT
ATTCATTCAATTGATTGGCATCATGAGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCA
AGTCGCCCTTTCCAGACCACAATTCCACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAA
TACAAGACCTGCAAAAACAGCGAACCATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATC
ATGCATGGAAAAGCAATTACAGTACTTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTT
CAAGAACCCTATGCTGTCGTGGTACTTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCA
TATCCCATGGACATTCATGAATCACCAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATA
GGAGTCAAGCATAAAAAACAAGGATACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAA
ATTATTATTACTGGTCATGCAGATGGATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCA
AAAGTGTTTGAAAAACAGAAGGTAGGAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGG
TGTCCAGAGAGCAGAATATTCTGTGTATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATA
GTGTCATTAGAGGTACGACTTCAGTATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCC
CAGCTTCCTTCTTCAAGGAGTCTTTCTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTG
AAGACACGGCCAGTGCGAATGCCTCCAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATT
ACTAGTCTTGCTGTAAGCTCAGCATATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTA
CTGTTAAGCATGGGGACCATTGACCTATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATT
GCAGGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAACTTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGC
ACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTTCTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCA
CCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTTTACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCT
AGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGAC
TCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGG
TTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTG
TCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACC
ATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCT
GGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATC
GCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGG
GCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCT
ACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTG
TGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGA
GACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTT
ATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGG
ATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAAC
AGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAG
ATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGG
GAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCC
CCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTT
AGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAA
AGCAATGTGGATATCACTACCTTCCGCACAACAGTGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTA
GCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCTG
TGGAAGGCGTAGCATCATCCTGCAGACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATAAGACACTCAAATATGAGTA

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_6888nt
GGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTG
GTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTC
AGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAG
TTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTG
GTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTA
GACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTT
ATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTG
AACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATG
GTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATG
AGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTC
CACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAAC
CATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTAC
TTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTAC
TTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCAC
CAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGAT
ACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATG
GATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAG
GAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTG
TATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGT
ATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTT
CTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTC
CAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCAT
ATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACC
TATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCC
TGTCTAACTTTTATCCTGATTTAACGAAACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAAC
TTGAGCGCTGCAAGTCTCCTACCTCAGGACTTGCTACCAGAACCCCTGAGTCAGCACTAGGCTTTTATAGGAATGAAATATCAGCTATGA
GACAGAGGAATCAAGTATATCACTTGCCAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAG
ATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAA
CCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTG
CTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGA
TCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCA
TCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGT
TTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCC
TCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATG
GGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAAT
TGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAA
AAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGAC
AGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTT
CCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGT
ACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCG
GACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTA
TAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACT
GGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGC
TGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCG
GCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAA
CAGGTGACTGGCTTAATGGTGTCTGGACAGCACACTGCAAGGAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGA
TTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAAT
CAAAGAATGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCTGTGGAAGGCGTAGCATCATCCTGCA
GACAGACAATAATTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATAAGACACTCAAATATGAGTACAAATGCCTTAAAATGGAATTGAA
AAACTCTTTATTTTCCCCTATCATTTATTGGATGGGTGGGTGGGGTATTTTTTTGTAATTGCTTTTTTAAATATTAGTTAATGGATTAAA
TTTAATTCTTCAGCGTAAAATGGTGAAGAACTAGCATATAGCCATTGATCATAAACTGACTATCATAAAATCAAAACAAGTGAAATAACA
AAATGGACATGGTGGCTTTGTTTAGGTAGAGCCACAAAAGAAAAGACTTGTAATATTTTTATATACAGAGGAAATCTGTAACAGGTATTT
TGTTTCTTTTAAAGCAAGCAACACAGAGGAATTTATACCTCAAACTATCTGGCCATATTTACTACCTTATCACTGCATTATTCTCTTTTA
TCTGTTTAAAGCATATAGAGATGAAGTTTGTAGTTGTTTTAAGTACTACACATTTTTAAATTGTTAGCTTCCTTAAGTATATCATGTAAA
GAAATGTCTTAATTTTTGAAAAAAGTACATATTTATTTTCTTTTGAATTGTTTTTATTGTTTTCTATTTATGCCTTGATGATTTAATATG
GATTTGTTACAGCCAAGTGCCAAATGCTCTCTCAAATTGTCAGCAATTTAACTAGACACAGATAATAATGGGTTTCTTTCAGATTTTTTG
AACCATCCACTTACATATATTTTTAAAAAATGAAATCCTTTTCCTGTTCATACACTAACCAAATCTCTCAAATCTGTTATCCCAATCATT
GTTGCCTCTCCGTTTATTATAAACTGTATGCTCACAACTTAGTGTAATATACCAGCTTGTATGCAATGGATTTTCAACCAGATAACATAC
CTTTCCTGCTCTGGTGCTTAGAGACTATCAACTCCCTCCTTTAGTGAAGGAGCCGTGTTAGAGCTTCCGAGAATAGCTCCACTGGAGAGA
AGTGGAATCCTATATAGAATGCTGCACTAATTGACAACACAGCCTATAGGCCAATGCATGAGTAAAAAAAAAAACAATTACTGGCTCACT
GGCTTTGAAAAGTCACTTACTATTGTTGCTGAAACTTGCTGAGCTGTTTATAGAGAATGATGATAACAGAACTTTTCCTCTGTATCACTG
GTGTTTAGGTGAATTAATTAAACATTGTGATCATTAGTACCAGGTATTATTATCTTTAAGAGTCTTCCACTTCAATGCACATGGTGCAGT
TTTGGTGTGTAACTTAGAAGGATTGAACTTCTTTGAATTTACTGGACATAACATTTTCAGAATAGTTGGTCATCTAGCAACCGCCTCAAA
ATGTGTAAGCAGGAGAGAAATTTCTCATCACAGGGATTTAGACTTACTATTACATAAAGGCTAACTATGAGCTTGCTCATTAATTTTGAA
AAGATGTACCTGGTGGATATCTAGCTAGTAATATATTCTGAAGCAACATTTTAGCTCTATTGATACTCTTTCTAATGCTGATATGATCTT
GAGTATAAGAAATGCATATGTCACTAGAATGGATAAAATAATGCTGCAAACTTAATGTTCTTATGCAAAATGGAACGCTAATGAAACACA
GCTTACAATCGCAAATCAAAACTCACAAGTGCTCATCTGTTGTAGATTTAGTGTAATAAGACTTAGATTGTGCTCCTTCGGATATGATTG
TTTCTCAAATCTTGGCAATATTCCTTAGTCAAATCAGGCTACTAGAATTCTGTATTGGATATATAAGAGCATGAAATTTTTAAAAATACA
CTTGTGATTATAAAATTAATCACAAATTTCACTTATACCTGCTATCAGCAGCTAGAAAACATTTTTTTTTTAAATCAAGTATTTTGTGTT
TGGAATGTTAGAATGAGATCTGAATGTGGTTTCAATCTAATTTTTTCCCAGACTACTATTTTCTTTTTTAGGTACTATTCTGAGCATACT
CAACAAAACCCATGCATTTCATAAACTAATAGAAGTTGAGGATTGTTGAATCTATTTCACTTATTTTGGCTGTGGTTTCCATCTGAAAGT
AGAGGTTGTATACACCATATACTGTTCTTCATTTTATTAATATTTTTCTCCTTGACCTCTCATAAATTTACTTTACACAATTCTTACCCT
GTACATATGTAAACATAAGTGTACGATTCTTAACCATGGAGTAGAGGTACTAGAATGCTTACGGCCATCTCTTTGTACAGGAACTGCATT
GACTTTCAGTAAACATAAAGCCACAACTCCTACATGATGTTATGTACCATATGATCTGTTTTGTATCTTAAATTTGATTTACATATATTA
TTTATTTCTGGTAACTCACTCAGTTTATGCTGTGCTAAATATCAATCAAGCCATGTATAAATGTGATATGATTGGCAATATGTGTTTACT
TTAAACTTGTCTTTTCAAAATATTACTCAGTTTATGTTGTACAATGTAGATGGCCTCTTACTAATGTAAAATGATTTGTAGTGGAAACAT

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_3763nt
GGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTG
GTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTC
AGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAG
TTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTG
GTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTA
GACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTT
ATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTG
AACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATG
GTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATG
AGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTC
CACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAAC
CATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTAC
TTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTAC
TTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCAC
CAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGAT
ACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATG
GATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAG
GAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTG
TATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGT
ATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTT
CTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTC
CAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCAT
ATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACC
TATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCC
TGTCTAACTTTTATCCTGATTTAACGAAACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAAC
TTGAGCGCTGCAAGTCTCCTACCTCAGGACTTGCTACCAGAACCCCTGAGTCAGCACTAGGCTTTTATAGGAATGAAATATCAGCTATGA
GACAGAGGAATCAAGTATATCACTTGCCAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAG
ATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAA
CCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTG
CTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGA
TCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCA
TCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGT
TTGAAACTAGTCCAGACTGTATGTATTATTTCAATGCAGTCTAGAGGAGGGGGCAGGGATCTTGCAAAAGATGTCTGATCGTTTATTCTC
ACTGTTTCTAAGTTTTAAACAAATGTGATACATTTAAGGTATATTGCTTGGGACATTGCAATTTGCAGAGCCCTGTGTCTGTATACAGTA
TTTGTGTTTGTGTGGGTGTACATTTTGTGTTTCTTTTTTTCTTGTATGCAAATCAAACATATTCTAATGCCTGAAATGCTTCTGTTTTTT
TTTTTTAGCCATAAATTGCTTTTGAGGAACATTATTTAATATAGTAACACACTTCCAGTGTCTGTCATTTCAGATATTCCAGGTTCATTG
CGTGATTCAATGAACCACAAAAAAGAAACTTGCTGATCCATGAGAATCTTAATTTTGTTTTAATCCTTAACACATTCAATAGCATATCAC
AGAGAGAATAAGGATTTTCTAAAATGTGTTTTATCACTTCATTCACATTCAGAAGTAATTTGAATAGCCTGTTCCTTTAACCCCAAATTT
GGCTAAAATTGGCCTAAAACTGGCAAACATTTTTCCAGTAACTTTTCTTTTTTTCAAATGAATTTTCTTCATACTTAAAAAAGCCCTTTG
CTAAAATATAATTTTCAAAAAGGTAAAATTATGTCTATGGCACTAATATAAAATGAGTAGAAGTTAATGATTTTACTTAACTCATTTTTT
TCTTTCTTTCTTTTTTTTTTTTTTTTTTTGAGACGGAGTCTTGCTCTGTCACCCAGGCTGGAGTACAGCAGAGCGATCTCGGCTCACTGC

>In-frame_STXBP5L_ENST00000497029_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4316nt
GGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTG
GTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTC
AGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAG
TTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTG
GTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTA
GACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTT
ATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTG
AACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATG
GTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATG
AGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTC
CACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAAC
CATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTAC
TTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTAC
TTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCAC
CAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGAT
ACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATG
GATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAG
GAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTG
TATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGT
ATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTT
CTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTC
CAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCAT
ATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACC
TATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCC
TGTCTAACTTTTATCCTGATTTAACGAAACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAAC
TTGAGCGCTGCAAGTCTCCTACCTCAGGACTTGCTACCAGAACCCCTGAGTCAGCACTAGGCTTTTATAGGAATGAAATATCAGCTATGA
GACAGAGGAATCAAGTATATCACTTGCCAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAG
ATTCTAAAGAAGCAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAA
CCAGTCTGGGAATGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTG
CTCCATCACCTGTCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGA
TCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCA
TCAGTAGCCTCAAGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGT
TTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCC
TCACTGTTGTCATCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATG
GGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAAT
TGGATGCCACCAACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAA
AAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGAC
AGTTTGACCACCCCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTT
CCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGT
ACCTGTCAGACATGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCG
GACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTA
TAGCCTACCGCAAGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACT
GGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGC
TGATGCTGGACTGCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCG
GCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAA
CAGTGACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAA
TGGCCCAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCTGTGGAAGGCGTAGCATCATCCTGCAGACAGAC

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000336596_chr3_89444987_+_6966nt
GGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTG
GTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTC
AGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAG
TTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTG
GTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTA
GACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTT
ATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTG
AACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATG
GTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATG
AGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTC
CACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAAC
CATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTAC
TTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTAC
TTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCAC
CAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGAT
ACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATG
GATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAG
GAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTG
TATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGT
ATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTT
CTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTC
CAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCAT
ATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACC
TATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCC
TGTCTAACTTTTATCCTGATTTAACGAAACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAAC
TTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTT
CTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTT
TACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAG
CAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAA
TGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTG
TCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACT
ACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCA
AGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTC
CAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCA
TCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAAC
TTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCA
ACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAG
TGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACC
CCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTT
TCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACA
TGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTG
TCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCA
AGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCA
ATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACT
GCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGA
TCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGC
TTAATGGTGTCTGGACAGCACACTGCAAGGAAATCTTCACGGGTGTGGAGTACAGTTCTTGTGACACAATAGCCAAGATTTCCACAGATG
ACATGAAAAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCC
CAGTTCCCGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCTGTGGAAGGCGTAGCATCATCCTGCAGACAGACAATAA
TTCTGGAGATACTGGTGGAAGTTCCAAGTCCAATAAGACACTCAAATATGAGTACAAATGCCTTAAAATGGAATTGAAAAACTCTTTATT
TTCCCCTATCATTTATTGGATGGGTGGGTGGGGTATTTTTTTGTAATTGCTTTTTTAAATATTAGTTAATGGATTAAATTTAATTCTTCA
GCGTAAAATGGTGAAGAACTAGCATATAGCCATTGATCATAAACTGACTATCATAAAATCAAAACAAGTGAAATAACAAAATGGACATGG
TGGCTTTGTTTAGGTAGAGCCACAAAAGAAAAGACTTGTAATATTTTTATATACAGAGGAAATCTGTAACAGGTATTTTGTTTCTTTTAA
AGCAAGCAACACAGAGGAATTTATACCTCAAACTATCTGGCCATATTTACTACCTTATCACTGCATTATTCTCTTTTATCTGTTTAAAGC
ATATAGAGATGAAGTTTGTAGTTGTTTTAAGTACTACACATTTTTAAATTGTTAGCTTCCTTAAGTATATCATGTAAAGAAATGTCTTAA
TTTTTGAAAAAAGTACATATTTATTTTCTTTTGAATTGTTTTTATTGTTTTCTATTTATGCCTTGATGATTTAATATGGATTTGTTACAG
CCAAGTGCCAAATGCTCTCTCAAATTGTCAGCAATTTAACTAGACACAGATAATAATGGGTTTCTTTCAGATTTTTTGAACCATCCACTT
ACATATATTTTTAAAAAATGAAATCCTTTTCCTGTTCATACACTAACCAAATCTCTCAAATCTGTTATCCCAATCATTGTTGCCTCTCCG
TTTATTATAAACTGTATGCTCACAACTTAGTGTAATATACCAGCTTGTATGCAATGGATTTTCAACCAGATAACATACCTTTCCTGCTCT
GGTGCTTAGAGACTATCAACTCCCTCCTTTAGTGAAGGAGCCGTGTTAGAGCTTCCGAGAATAGCTCCACTGGAGAGAAGTGGAATCCTA
TATAGAATGCTGCACTAATTGACAACACAGCCTATAGGCCAATGCATGAGTAAAAAAAAAAACAATTACTGGCTCACTGGCTTTGAAAAG
TCACTTACTATTGTTGCTGAAACTTGCTGAGCTGTTTATAGAGAATGATGATAACAGAACTTTTCCTCTGTATCACTGGTGTTTAGGTGA
ATTAATTAAACATTGTGATCATTAGTACCAGGTATTATTATCTTTAAGAGTCTTCCACTTCAATGCACATGGTGCAGTTTTGGTGTGTAA
CTTAGAAGGATTGAACTTCTTTGAATTTACTGGACATAACATTTTCAGAATAGTTGGTCATCTAGCAACCGCCTCAAAATGTGTAAGCAG
GAGAGAAATTTCTCATCACAGGGATTTAGACTTACTATTACATAAAGGCTAACTATGAGCTTGCTCATTAATTTTGAAAAGATGTACCTG
GTGGATATCTAGCTAGTAATATATTCTGAAGCAACATTTTAGCTCTATTGATACTCTTTCTAATGCTGATATGATCTTGAGTATAAGAAA
TGCATATGTCACTAGAATGGATAAAATAATGCTGCAAACTTAATGTTCTTATGCAAAATGGAACGCTAATGAAACACAGCTTACAATCGC
AAATCAAAACTCACAAGTGCTCATCTGTTGTAGATTTAGTGTAATAAGACTTAGATTGTGCTCCTTCGGATATGATTGTTTCTCAAATCT
TGGCAATATTCCTTAGTCAAATCAGGCTACTAGAATTCTGTATTGGATATATAAGAGCATGAAATTTTTAAAAATACACTTGTGATTATA
AAATTAATCACAAATTTCACTTATACCTGCTATCAGCAGCTAGAAAACATTTTTTTTTTAAATCAAGTATTTTGTGTTTGGAATGTTAGA
ATGAGATCTGAATGTGGTTTCAATCTAATTTTTTCCCAGACTACTATTTTCTTTTTTAGGTACTATTCTGAGCATACTCAACAAAACCCA
TGCATTTCATAAACTAATAGAAGTTGAGGATTGTTGAATCTATTTCACTTATTTTGGCTGTGGTTTCCATCTGAAAGTAGAGGTTGTATA
CACCATATACTGTTCTTCATTTTATTAATATTTTTCTCCTTGACCTCTCATAAATTTACTTTACACAATTCTTACCCTGTACATATGTAA
ACATAAGTGTACGATTCTTAACCATGGAGTAGAGGTACTAGAATGCTTACGGCCATCTCTTTGTACAGGAACTGCATTGACTTTCAGTAA
ACATAAAGCCACAACTCCTACATGATGTTATGTACCATATGATCTGTTTTGTATCTTAAATTTGATTTACATATATTATTTATTTCTGGT
AACTCACTCAGTTTATGCTGTGCTAAATATCAATCAAGCCATGTATAAATGTGATATGATTGGCAATATGTGTTTACTTTAAACTTGTCT
TTTCAAAATATTACTCAGTTTATGTTGTACAATGTAGATGGCCTCTTACTAATGTAAAATGATTTGTAGTGGAAACATTTATATTTTTAT

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000452448_chr3_89444987_+_3841nt
GGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTG
GTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTC
AGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAG
TTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTG
GTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTA
GACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTT
ATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTG
AACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATG
GTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATG
AGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTC
CACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAAC
CATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTAC
TTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTAC
TTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCAC
CAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGAT
ACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATG
GATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAG
GAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTG
TATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGT
ATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTT
CTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTC
CAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCAT
ATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACC
TATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCC
TGTCTAACTTTTATCCTGATTTAACGAAACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAAC
TTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTT
CTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTT
TACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAG
CAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAA
TGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTG
TCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACT
ACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCA
AGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTC
CAGACTGTATGTATTATTTCAATGCAGTCTAGAGGAGGGGGCAGGGATCTTGCAAAAGATGTCTGATCGTTTATTCTCACTGTTTCTAAG
TTTTAAACAAATGTGATACATTTAAGGTATATTGCTTGGGACATTGCAATTTGCAGAGCCCTGTGTCTGTATACAGTATTTGTGTTTGTG
TGGGTGTACATTTTGTGTTTCTTTTTTTCTTGTATGCAAATCAAACATATTCTAATGCCTGAAATGCTTCTGTTTTTTTTTTTTAGCCAT
AAATTGCTTTTGAGGAACATTATTTAATATAGTAACACACTTCCAGTGTCTGTCATTTCAGATATTCCAGGTTCATTGCGTGATTCAATG
AACCACAAAAAAGAAACTTGCTGATCCATGAGAATCTTAATTTTGTTTTAATCCTTAACACATTCAATAGCATATCACAGAGAGAATAAG
GATTTTCTAAAATGTGTTTTATCACTTCATTCACATTCAGAAGTAATTTGAATAGCCTGTTCCTTTAACCCCAAATTTGGCTAAAATTGG
CCTAAAACTGGCAAACATTTTTCCAGTAACTTTTCTTTTTTTCAAATGAATTTTCTTCATACTTAAAAAAGCCCTTTGCTAAAATATAAT
TTTCAAAAAGGTAAAATTATGTCTATGGCACTAATATAAAATGAGTAGAAGTTAATGATTTTACTTAACTCATTTTTTTCTTTCTTTCTT
TTTTTTTTTTTTTTTTTGAGACGGAGTCTTGCTCTGTCACCCAGGCTGGAGTACAGCAGAGCGATCTCGGCTCACTGCAAGCTCCTGCAA

>In-frame_STXBP5L_ENST00000492541_chr3_121100379_+_EPHA3_ENST00000494014_chr3_89444987_+_4394nt
GGCTAGAGGCGTCTGAGGAAGTGTTTAAAATGAAGAAGTTTAATTTCCGAAAAGTTTTGGATGGCTTAACTGCCTCCTCCCCTGGCAGTG
GTAGCAGCAGTGGCAGTAACAGTGGTGGTGGGGCTGGAAGTGGTTCCGTACATCCGGCGGGGACTGCAGGGGTTCTCAGAGAGGAAATTC
AGGAAACTTTGACTTCGGAGTATTTCCAGATTTGCAAGACAGTTCGGCATGGTTTTCCTCATCAGCCCACAGCATTAGCCTTTGATCCAG
TTCAGAAAATCTTGGCTATTGGGACGAGAACAGGTGCTATACGAATACTCGGGAGACCTGGTGTTGATTGCTATTGCCAACATGAAAGTG
GTGCAGCTGTCCTACAGCTCCAATTTTTGATCAATGAGGGTGCCTTGGTCAGTGCAAGTTCAGATGATACACTTCATTTGTGGAACCTTA
GACAAAAAAGGCCAGCCATACTCCATTCTCTTAAATTTAACCGGGAACGAATTACTTACTGTCATCTACCTTTCCAGAGTAAATGGCTTT
ATGTTGGAACAGAAAGAGGAAATACACATATTGTAAATATTGAATCTTTCATTCTTTCTGGATATGTTATCATGTGGAACAAGGCAATTG
AACTATCCACTAAGACTCATCCAGGTCCAGTTGTACATTTAAGCGATAGCCCAAGAGATGAAGGCAAACTGCTAATAGGTTATGAAAATG
GTACTGTAGTATTCTGGGACTTGAAATCTAAAAGAGCAGAACTGAGAGTTTATTATGATGAGGCTATTCATTCAATTGATTGGCATCATG
AGGGCAAACAGTTCATGTGCAGCCATTCAGATGGTAGTTTGACTTTATGGAACCTGAAAAGCCCAAGTCGCCCTTTCCAGACCACAATTC
CACATGGAAAAAGTCAAAGAGAAGGAAGAAAATCTGAATCTTGTAAACCAATTCTTAAAGTAGAATACAAGACCTGCAAAAACAGCGAAC
CATTCATAATATTCTCTGGTGGGCTGTCCTATGACAAAGCTTGTAGAAGACCAAGTTTAACCATCATGCATGGAAAAGCAATTACAGTAC
TTGAAATGGATCATCCTATTGTTGAATTTCTAACTTTATGTGAAACGCCCTATCCAAATGAATTTCAAGAACCCTATGCTGTCGTGGTAC
TTCTGGAGAAAGATCTCATTGTAGTTGATCTGACACAAAGCAATTTTCCAATCTTTGAAAATCCATATCCCATGGACATTCATGAATCAC
CAGTTACATGCACAGCATACTTTGCAGATTGTCCTCCGGATTTGATTCTAGTACTGTATTCTATAGGAGTCAAGCATAAAAAACAAGGAT
ACAGTAATAAGGAGTGGCCAATCAGTGGAGGAGCTTGGAACCTTGGAGCACAAACATATCCAGAAATTATTATTACTGGTCATGCAGATG
GATCAATAAAATTTTGGGATGCTTCTGCAATAACTCTGCAGATGCTGTACAAGCTAAAAACTTCAAAAGTGTTTGAAAAACAGAAGGTAG
GAGAAGGAAAACAAACATGTGAAATTGTAGAGGAAGACCCATTTGCCATTCAGATGATTTACTGGTGTCCAGAGAGCAGAATATTCTGTG
TATCAGGAGTCTCTGCATATGTCATAATTTATAAATTCAGCAGACATGAAATTACAACAGAAATAGTGTCATTAGAGGTACGACTTCAGT
ATGATGTTGAAGATATTATTACCCCTGAACCAGAAACAAGTCCTCCGTTTCCAGATCTCTCAGCCCAGCTTCCTTCTTCAAGGAGTCTTT
CTGGGAGCACTAACACTGTTGCTAGTGAAGGAGTAACAAAGGACAGTATTCCATGCCTCAATGTGAAGACACGGCCAGTGCGAATGCCTC
CAGGATATCAAGCAGAACTTGTTATTCAATTGGTGTGGGTAGATGGTGAACCTCCACAACAGATTACTAGTCTTGCTGTAAGCTCAGCAT
ATGGAATAGTTGCATTTGGGAACTGCAATGGGTTGGCTGTGGTGGATTTTATACAGAAGACAGTACTGTTAAGCATGGGGACCATTGACC
TATATAGATCAAGTGACTTATACCAGCGACAACCACGGTCTCCTCGAAAAAACAAACAGTTCATTGCAGACAACTTTTGCATGCGTGGCC
TGTCTAACTTTTATCCTGATTTAACGAAACGGATCCGTACTTCCTATCAGAGTTTAACTGAACTGAATGACAGTCCAGTTCCCCTAGAAC
TTGAGCGCTGCAAGTCTCCTACCTCAGACCATGTAAATGGACACTGCACAAGTCCAACTTCTCAGAGTTGCAGTTCTGGAAAACGTCTTT
CTAGTGCCGATGTTTCAAAAGTAAATCGCTGGGGTCCTGGAAGACCACCATTTCGAAAGGCCCAGTCAGCAGCCTGCATGGAGATTTCTT
TACCAGTTACAACAGAAGAAAACCGAGAAAATTCCTATAATCGTTCTAGAAGCTCTAGTATCTCCAGTATTGACAAAGATTCTAAAGAAG
CAATTACAGCACTATACTTCATGGACTCCTTTGCACGGAAAAATGACTCTACCATCTCTCCTTGTCTGTTCGTTGGAACCAGTCTGGGAA
TGGTGTTAATCATCTCCTTAAACCTACCATTAGCAGATGAACAAAGGTTTACAGAGCCAGTCATGGTATTGCCAAGTGCTCCATCACCTG
TCCTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCTGAACATCCTAATGGGATCATATTGGACT
ACGAGGTCAAATACTATGAAAAGCAGGAACAAGAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCA
AGCCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAACAGCCGCAAGTTTGAGTTTGAAACTAGTC
CAGACTCTTTCTCCATCTCTGGTGAAAGTAGCCAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCA
TCTATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGACTTCATTTTGGCAATGGGCATTTAAAAC
TTCCAGGTCTCAGGACTTATGTTGACCCACATACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCA
ACATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTAAAACTTCCTTCAAAAAAAGAGATTTCAG
TGGCCATTAAGACCCTGAAAGTTGGCTACACAGAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACC
CCAATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAATACATGGAGAATGGTTCCTTGGATAGTT
TCCTACGTAAACACGATGCCCAGTTTACTGTCATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACA
TGGGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGTAAGGTTTCTGATTTCGGACTTTCGCGTG
TCCTGGAGGATGACCCAGAAGCTGCTTATACAACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCA
AGTTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTATGGAGAGAGACCATACTGGGAGATGTCCA
ATCAGGATGTAATTAAAGCTGTAGATGAGGGCTATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACT
GCTGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAGCTTATCCGGAATCCCGGCAGCCTGAAGA
TCATCACCAGTGCAGCCGCAAGGCCATCAAACCTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGTGACATGAA
AAAGGTTGGTGTCACCGTGGTTGGGCCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCAGTTCC
CGTGTAAAGCACGGGACGGAAGTGCTTCTGGACGGAAGTGGTGGCTGTGGAAGGCGTAGCATCATCCTGCAGACAGACAATAATTCTGGA


Top

FusionGenePPI for STXBP5L_EPHA3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STXBP5LSYVN1, STX19EPHA3TP53, CRK, EFNB2, EFNA5, EFNA1, EFNB1, EFNA3, EFNA4, SRC, FYN, ABL1, RBM18, SRPK1, CDKN2A, HLA-DRA, CEACAM21, TMEM231, EPHA7, LRRIQ1, FAM118B, SLAMF1, ILKAP, CTDSP2, DUSP18, DUSP21, STYX, TPTE, MTMR11


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STXBP5L_EPHA3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STXBP5L_EPHA3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource