FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36629

FusionGeneSummary for STX12_WDTC1

check button Fusion gene summary
Fusion gene informationFusion gene name: STX12_WDTC1
Fusion gene ID: 36629
HgeneTgene
Gene symbol

STX12

WDTC1

Gene ID

23673

23038

Gene namesyntaxin 12WD and tetratricopeptide repeats 1
SynonymsSTX13|STX14ADP|DCAF9
Cytomap

1p35.3

1p36.11

Type of geneprotein-codingprotein-coding
Descriptionsyntaxin-12WD and tetratricopeptide repeats protein 1DDB1 and CUL4 associated factor 9adipose homolog
Modification date2018052320180519
UniProtAcc

Q86Y82

Q8N5D0

Ensembl transtripts involved in fusion geneENST00000373943, ENST00000468761, 
ENST00000319394, ENST00000361771, 
Fusion gene scores* DoF score4 X 5 X 4=809 X 7 X 9=567
# samples 511
** MAII scorelog2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/567*10)=-2.36584521141757
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STX12 [Title/Abstract] AND WDTC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTX12

GO:0033344

cholesterol efflux

15469992

HgeneSTX12

GO:0050821

protein stabilization

15469992


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-VS-A9V3-01ASTX12chr1

28099936

+WDTC1chr1

27630112

+
TCGARVLUSCTCGA-85-8287-01ASTX12chr1

28146243

+WDTC1chr1

27608730

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373943ENST00000319394STX12chr1

28099936

+WDTC1chr1

27630112

+
In-frameENST00000373943ENST00000361771STX12chr1

28099936

+WDTC1chr1

27630112

+
3UTR-3CDSENST00000468761ENST00000319394STX12chr1

28099936

+WDTC1chr1

27630112

+
3UTR-3CDSENST00000468761ENST00000361771STX12chr1

28099936

+WDTC1chr1

27630112

+
In-frameENST00000373943ENST00000319394STX12chr1

28146243

+WDTC1chr1

27608730

+
In-frameENST00000373943ENST00000361771STX12chr1

28146243

+WDTC1chr1

27608730

+
intron-3CDSENST00000468761ENST00000319394STX12chr1

28146243

+WDTC1chr1

27608730

+
intron-3CDSENST00000468761ENST00000361771STX12chr1

28146243

+WDTC1chr1

27608730

+

Top

FusionProtFeatures for STX12_WDTC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STX12

Q86Y82

WDTC1

Q8N5D0

SNARE that acts to regulate protein transport betweenlate endosomes and the trans-Golgi network. The SNARE complexcontaining STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion(in vitro) (By similarity). Through complex formation with GRIP1,GRIA2 and NSG1 controls the intracellular fate of AMPAR and theendosomal sorting of the GRIA2 subunit toward recycling andmembrane targeting (By similarity). {ECO:0000250,ECO:0000250|UniProtKB:G3V7P1}. May function as a substrate receptor for CUL4-DDB1 E3ubiquitin-protein ligase complex. {ECO:0000269|PubMed:16964240}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTX12chr1:28146243chr1:27608730ENST00000373943+8933_131244277Coiled coilOntology_term=ECO:0000255
HgeneSTX12chr1:28146243chr1:27608730ENST00000373943+89178_240244277Domaint-SNARE coiled-coil homology
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216535_575489678RepeatNote=WD 6
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216578_617489678RepeatNote=WD 7
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216535_575488677RepeatNote=WD 6
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216578_617488677RepeatNote=WD 7
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216132_17244678RepeatNote=WD 3
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216182_22244678RepeatNote=WD 4
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216265_30544678RepeatNote=WD 5
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216362_39544678RepeatNote=TPR 1
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216397_43244678RepeatNote=TPR 2
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+21645_8444678RepeatNote=WD 1
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216535_57544678RepeatNote=WD 6
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+216578_61744678RepeatNote=WD 7
TgeneWDTC1chr1:28146243chr1:27608730ENST00000319394+21688_12944678RepeatNote=WD 2
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216132_17244677RepeatNote=WD 3
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216182_22244677RepeatNote=WD 4
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216265_30544677RepeatNote=WD 5
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216362_39544677RepeatNote=TPR 1
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216397_43244677RepeatNote=TPR 2
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+21645_8444677RepeatNote=WD 1
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216535_57544677RepeatNote=WD 6
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+216578_61744677RepeatNote=WD 7
TgeneWDTC1chr1:28146243chr1:27608730ENST00000361771+21688_12944677RepeatNote=WD 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTX12chr1:28099936chr1:27630112ENST00000373943+1933_13139277Coiled coilOntology_term=ECO:0000255
HgeneSTX12chr1:28099936chr1:27630112ENST00000373943+19178_24039277Domaint-SNARE coiled-coil homology
HgeneSTX12chr1:28099936chr1:27630112ENST00000373943+19270_27639277Topological domainVesicular
HgeneSTX12chr1:28099936chr1:27630112ENST00000373943+192_24839277Topological domainCytoplasmic
HgeneSTX12chr1:28146243chr1:27608730ENST00000373943+89270_276244277Topological domainVesicular
HgeneSTX12chr1:28146243chr1:27608730ENST00000373943+892_248244277Topological domainCytoplasmic
HgeneSTX12chr1:28099936chr1:27630112ENST00000373943+19249_26939277TransmembraneHelical%3B Anchor for type IV membrane protein
HgeneSTX12chr1:28146243chr1:27608730ENST00000373943+89249_269244277TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216132_172489678RepeatNote=WD 3
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216182_222489678RepeatNote=WD 4
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216265_305489678RepeatNote=WD 5
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216362_395489678RepeatNote=TPR 1
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+1216397_432489678RepeatNote=TPR 2
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+121645_84489678RepeatNote=WD 1
TgeneWDTC1chr1:28099936chr1:27630112ENST00000319394+121688_129489678RepeatNote=WD 2
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216132_172488677RepeatNote=WD 3
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216182_222488677RepeatNote=WD 4
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216265_305488677RepeatNote=WD 5
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216362_395488677RepeatNote=TPR 1
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+1216397_432488677RepeatNote=TPR 2
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+121645_84488677RepeatNote=WD 1
TgeneWDTC1chr1:28099936chr1:27630112ENST00000361771+121688_129488677RepeatNote=WD 2


Top

FusionGeneSequence for STX12_WDTC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STX12_ENST00000373943_chr1_28099936_+_WDTC1_ENST00000319394_chr1_27630112_+_228aa
MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQAKEKKGPGGGAPVRLRSTSRKDSISEDEMVLRERSYDTQFRYCGHCNTTTDI
KEANFFGSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTGRVVEDMEGASQA

>In-frame_STX12_ENST00000373943_chr1_28099936_+_WDTC1_ENST00000361771_chr1_27630112_+_228aa
MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQAKEKKGPGGGAPVRLRSTSRKDSISEDEMVLRERSYDTQFRYCGHCNTTTDI
KEANFFGSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTGRVVEDMEGASQA

>In-frame_STX12_ENST00000373943_chr1_28146243_+_WDTC1_ENST00000319394_chr1_27608730_+_878aa
MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLP
LSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLEL
IKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYTQGHSGCVNCLEWNEKGDLLASGSDDQH
TIVWDPLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTFWSAAEDGLIR
QTDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLTDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQTY
VAGHLPVKLPDYNNRLRVLVATTVTFSPNGTELLVNMGGEQVTLFDLTYKQRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHS
NGFRLPESRGHVSPQVELPPYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLTGNRAAAYMKRKWDGDHTDALRDCLKAISLNP
CHLKAHFRLARCLFELKTVAEALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGEEKKGPGGGAPVRLRSTSRKDSISEDEMVLR
ERSYDTQFRYCGHCNTTTDIKEANFFGSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPR

>In-frame_STX12_ENST00000373943_chr1_28146243_+_WDTC1_ENST00000361771_chr1_27608730_+_877aa
MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLP
LSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLEL
IKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRAAYTQGHSGCVNCLEWNEKGDLLASGSDDQH
TIVWDPLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTFWSAAEDGLIR
QTDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLTDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQTY
VAGHLPVKLPDYNNRLRVLVATTVTFSPNGTELLVNMGGEQVTLFDLTYKQRPYTFLLPRKCHSSGVQNGKMSTNGVSNGVSNGLHLHSN
GFRLPESRGHVSPQVELPPYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLTGNRAAAYMKRKWDGDHTDALRDCLKAISLNPC
HLKAHFRLARCLFELKTVAEALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGEEKKGPGGGAPVRLRSTSRKDSISEDEMVLRE
RSYDTQFRYCGHCNTTTDIKEANFFGSNAQTIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STX12_ENST00000373943_chr1_28099936_+_WDTC1_ENST00000319394_chr1_27630112_+_684nt
ATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGCTCCGGGACTTCAGCAGCATCATCCAGACGTGCAGC
GGCAACATCCAGCGGATCAGCCAAGCCAAGGAGAAGAAGGGACCTGGTGGCGGCGCCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGGAC
TCCATCTCAGAGGATGAAATGGTGCTGCGGGAGCGAAGCTACGACTATCAGTTCCGCTACTGCGGCCACTGCAACACCACCACGGATATC
AAAGAGGCCAATTTCTTTGGCAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACC
AACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATC
GATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCC
AACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGG

>In-frame_STX12_ENST00000373943_chr1_28099936_+_WDTC1_ENST00000361771_chr1_27630112_+_684nt
ATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGCTCCGGGACTTCAGCAGCATCATCCAGACGTGCAGC
GGCAACATCCAGCGGATCAGCCAAGCCAAGGAGAAGAAGGGACCTGGTGGCGGCGCCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGGAC
TCCATCTCAGAGGATGAAATGGTGCTGCGGGAGCGAAGCTACGACTATCAGTTCCGCTACTGCGGCCACTGCAACACCACCACGGATATC
AAAGAGGCCAATTTCTTTGGCAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACC
AACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATC
GATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCC
AACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGG

>In-frame_STX12_ENST00000373943_chr1_28146243_+_WDTC1_ENST00000319394_chr1_27608730_+_2634nt
ATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGCTCCGGGACTTCAGCAGCATCATCCAGACGTGCAGC
GGCAACATCCAGCGGATCAGCCAAGCCACTGCTCAGATAAAGAATTTGATGAGCCAGCTAGGAACTAAGCAGGACTCAAGCAAGCTACAG
GAAAATCTGCAACAGTTACAACACTCCACAAATCAGCTCGCCAAGGAAACAAATGAATTGCTGAAAGAATTAGGGTCCTTGCCCCTTCCC
TTATCTACTTCAGAACAGCGCCAGCAGAGACTTCAGAAGGAACGCCTCATGAATGACTTCTCTGCAGCCTTAAACAATTTCCAGGCTGTG
CAGAGAAGGGTATCTGAAAAGGAAAAGGAGAGTATTGCCAGAGCAAGAGCTGGATCTCGTCTTTCTGCAGAAGAGAGGCAAAGAGAGGAG
CAGCTGGTCTCATTTGACAGCCATGAGGAGTGGAACCAGATGCAGAGCCAGGAGGATGAGGTGGCCATCACTGAGCAGGATTTGGAACTT
ATTAAAGAAAGAGAAACGGCAATTCGGCAGCTGGAGGCTGACATTTTGGATGTCAATCAGATATTTAAAGATTTGGCCATGATGATCCAT
GACCAGGGTGATCTGATTGATAGCATAGAAGCCAATGTGGAAAGCTCAGAGGTGCACGTCGAAAGAGCCACTGAACAGTTACAGCGAGCT
GCTTACTATCAGGGTCACTCAGGATGTGTCAACTGTCTGGAGTGGAATGAGAAAGGAGACTTGCTGGCCTCTGGTTCCGATGACCAGCAC
ACGATTGTGTGGGACCCGCTGCACCACAAGAAGCTGCTCTCCATGCACACGGGACACACCGCAAATATCTTCTCTGTCAAGTTCCTGCCT
CACGCTGGGGACCGCATCTTGATCACGGGGGCAGCCGACTCTAAGGTGCATGTGCACGACCTGACAGTAAAGGAGACCATCCACATGTTT
GGAGACCACACAAACCGGGTGAAGCGCATCGCCACAGCGCCCATGTGGCCCAACACATTCTGGAGTGCTGCTGAGGATGGGCTTATCCGC
CAGTATGACCTTCGAGAGAACAGCAAACACTCGGAGGTGCTGATTGACCTGACAGAGTACTGTGGCCAGCTGGTGGAGGCCAAGTGCCTC
ACTGTCAACCCCCAGGACAACAACTGCCTGGCAGTTGGGGCCAGCGGGCCCTTCGTGAGGCTCTATGACATCCGCATGATCCATAACCAC
AGAAAGAGCATGAAGCAGAGCCCTTCAGCGGGTGTGCACACCTTCTGTGACCGGCAGAAACCCCTTCCGGACGGTGCAGCCCAGTATTAC
GTAGCAGGTCACCTGCCAGTGAAGCTTCCTGACTACAACAACCGTTTGAGAGTGCTGGTTGCCACCTATGTGACCTTCAGCCCCAATGGC
ACAGAGCTACTAGTCAACATGGGGGGGGAACAGGTCTATTTGTTTGACTTGACTTACAAGCAGCGGCCGTACACCTTCCTCTTGCCTAGA
AAATGCCACTCCTCGGGGGAAGTCCAGAATGGCAAGATGTCCACCAACGGTGTGTCCAACGGTGTGTCCAATGGCCTGCACCTTCATAGC
AATGGCTTCCGGCTGCCGGAGAGTAGGGGACATGTCAGCCCCCAAGTAGAGCTACCACCATACCTGGAGCGTGTGAAACAGCAAGCCAAT
GAGGCTTTTGCCTGCCAGCAGTGGACCCAAGCCATTCAGCTTTACAGCAAGGCTGTGCAGAGGGCCCCTCACAATGCCATGCTTTATGGA
AACCGAGCAGCAGCCTACATGAAGCGCAAGTGGGATGGTGACCACTATGATGCCCTGAGGGACTGCCTCAAGGCCATCTCCCTAAACCCA
TGCCACCTGAAGGCACACTTTCGCCTGGCCCGCTGCCTCTTTGAGCTCAAGTATGTGGCTGAAGCCCTGGAGTGCCTGGACGACTTCAAA
GGGAAATTTCCGGAGCAGGCCCACAGCAGCGCTTGTGATGCATTGGGCCGCGACATCACAGCTGCCCTCTTCTCTAAAAATGATGGTGAG
GAGAAGAAGGGACCTGGTGGCGGCGCCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGGACTCCATCTCAGAGGATGAAATGGTGCTGCGG
GAGCGAAGCTACGACTATCAGTTCCGCTACTGCGGCCACTGCAACACCACCACGGATATCAAAGAGGCCAATTTCTTTGGCAGCAACGCT
CAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAG
TCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGA
CCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTG
GAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGC

>In-frame_STX12_ENST00000373943_chr1_28146243_+_WDTC1_ENST00000361771_chr1_27608730_+_2631nt
ATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGCTCCGGGACTTCAGCAGCATCATCCAGACGTGCAGC
GGCAACATCCAGCGGATCAGCCAAGCCACTGCTCAGATAAAGAATTTGATGAGCCAGCTAGGAACTAAGCAGGACTCAAGCAAGCTACAG
GAAAATCTGCAACAGTTACAACACTCCACAAATCAGCTCGCCAAGGAAACAAATGAATTGCTGAAAGAATTAGGGTCCTTGCCCCTTCCC
TTATCTACTTCAGAACAGCGCCAGCAGAGACTTCAGAAGGAACGCCTCATGAATGACTTCTCTGCAGCCTTAAACAATTTCCAGGCTGTG
CAGAGAAGGGTATCTGAAAAGGAAAAGGAGAGTATTGCCAGAGCAAGAGCTGGATCTCGTCTTTCTGCAGAAGAGAGGCAAAGAGAGGAG
CAGCTGGTCTCATTTGACAGCCATGAGGAGTGGAACCAGATGCAGAGCCAGGAGGATGAGGTGGCCATCACTGAGCAGGATTTGGAACTT
ATTAAAGAAAGAGAAACGGCAATTCGGCAGCTGGAGGCTGACATTTTGGATGTCAATCAGATATTTAAAGATTTGGCCATGATGATCCAT
GACCAGGGTGATCTGATTGATAGCATAGAAGCCAATGTGGAAAGCTCAGAGGTGCACGTCGAAAGAGCCACTGAACAGTTACAGCGAGCT
GCTTACTATCAGGGTCACTCAGGATGTGTCAACTGTCTGGAGTGGAATGAGAAAGGAGACTTGCTGGCCTCTGGTTCCGATGACCAGCAC
ACGATTGTGTGGGACCCGCTGCACCACAAGAAGCTGCTCTCCATGCACACGGGACACACCGCAAATATCTTCTCTGTCAAGTTCCTGCCT
CACGCTGGGGACCGCATCTTGATCACGGGGGCAGCCGACTCTAAGGTGCATGTGCACGACCTGACAGTAAAGGAGACCATCCACATGTTT
GGAGACCACACAAACCGGGTGAAGCGCATCGCCACAGCGCCCATGTGGCCCAACACATTCTGGAGTGCTGCTGAGGATGGGCTTATCCGC
CAGTATGACCTTCGAGAGAACAGCAAACACTCGGAGGTGCTGATTGACCTGACAGAGTACTGTGGCCAGCTGGTGGAGGCCAAGTGCCTC
ACTGTCAACCCCCAGGACAACAACTGCCTGGCAGTTGGGGCCAGCGGGCCCTTCGTGAGGCTCTATGACATCCGCATGATCCATAACCAC
AGAAAGAGCATGAAGCAGAGCCCTTCAGCGGGTGTGCACACCTTCTGTGACCGGCAGAAACCCCTTCCGGACGGTGCAGCCCAGTATTAC
GTAGCAGGTCACCTGCCAGTGAAGCTTCCTGACTACAACAACCGTTTGAGAGTGCTGGTTGCCACCTATGTGACCTTCAGCCCCAATGGC
ACAGAGCTACTAGTCAACATGGGGGGGGAACAGGTCTATTTGTTTGACTTGACTTACAAGCAGCGGCCGTACACCTTCCTCTTGCCTAGA
AAATGCCACTCCTCGGGGGTCCAGAATGGCAAGATGTCCACCAACGGTGTGTCCAACGGTGTGTCCAATGGCCTGCACCTTCATAGCAAT
GGCTTCCGGCTGCCGGAGAGTAGGGGACATGTCAGCCCCCAAGTAGAGCTACCACCATACCTGGAGCGTGTGAAACAGCAAGCCAATGAG
GCTTTTGCCTGCCAGCAGTGGACCCAAGCCATTCAGCTTTACAGCAAGGCTGTGCAGAGGGCCCCTCACAATGCCATGCTTTATGGAAAC
CGAGCAGCAGCCTACATGAAGCGCAAGTGGGATGGTGACCACTATGATGCCCTGAGGGACTGCCTCAAGGCCATCTCCCTAAACCCATGC
CACCTGAAGGCACACTTTCGCCTGGCCCGCTGCCTCTTTGAGCTCAAGTATGTGGCTGAAGCCCTGGAGTGCCTGGACGACTTCAAAGGG
AAATTTCCGGAGCAGGCCCACAGCAGCGCTTGTGATGCATTGGGCCGCGACATCACAGCTGCCCTCTTCTCTAAAAATGATGGTGAGGAG
AAGAAGGGACCTGGTGGCGGCGCCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGGACTCCATCTCAGAGGATGAAATGGTGCTGCGGGAG
CGAAGCTACGACTATCAGTTCCGCTACTGCGGCCACTGCAACACCACCACGGATATCAAAGAGGCCAATTTCTTTGGCAGCAACGCTCAG
TATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCC
ATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCA
GAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAG
GTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_STX12_ENST00000373943_chr1_28099936_+_WDTC1_ENST00000319394_chr1_27630112_+_3045nt
GCACGCAGCCTTAGCTCCTTCCCCGCCCTTGCTCTTCCCAGTTTCTCCGTCAGCCTGCGGGTCCCGGCTGGCGGCTGCTTCCGGTAGGAG
AGCGGTGTAGAGCGAGCAGGTCTCAGCTCCTCGTCATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGC
TCCGGGACTTCAGCAGCATCATCCAGACGTGCAGCGGCAACATCCAGCGGATCAGCCAAGCCAAGGAGAAGAAGGGACCTGGTGGCGGCG
CCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGGACTCCATCTCAGAGGATGAAATGGTGCTGCGGGAGCGAAGCTACGACTATCAGTTCC
GCTACTGCGGCCACTGCAACACCACCACGGATATCAAAGAGGCCAATTTCTTTGGCAGCAACGCTCAGTATATCGTCAGTGGCTCTGACG
ATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCAC
ACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCC
GAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCT
ACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGA
CCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCTGGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCC
CACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTGTTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTG
GGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAAAAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCAT
GTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTTCTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCT
TTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAATTGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCT
AGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAAGGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGG
AAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCACCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGG
CCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCTCTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCC
ATCCATGCCAGCACTTCTGCACTACGGCCATTCTCCTCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGG
CCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCCCTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAG
ACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTGCTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTA
CTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTACACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCC
CGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTCATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAG
CCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCCCTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAG
GTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGGAGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAG
GGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCATTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCC
AGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAATGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGG
GACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTCTAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGG
ACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGCCACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCT
TCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGTGTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTT
GTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGCAATTGATTAAAACCATTTTGTTCTAGGTGTGGCTGGTGGCATTTGTGGGGTGCAGAT
GGGTCTTGGAACCAAAGTGAGGGCACCTGGTCCCTCACCTCTGTAGCTCTATGACTTAGTAACCACACCTCTACTGGACAGAATGAGGCC
TGCCTTGAAGGGTCACCGTGAGCAGCGGCCACCCAGCCCAGCAGGGCTGAGTGCAGAGCCCAGCTCTCATGGCTGTGATTTGTAATCATC
AGCTTTCACTCTCTGGCTGTTTTCTCATCAGTAAAATAAGGGACTTGGAATCTTAGTGGTTTTTCAAACCATTTTACATTGTGACCCAAT

>In-frame_STX12_ENST00000373943_chr1_28099936_+_WDTC1_ENST00000361771_chr1_27630112_+_2670nt
GCACGCAGCCTTAGCTCCTTCCCCGCCCTTGCTCTTCCCAGTTTCTCCGTCAGCCTGCGGGTCCCGGCTGGCGGCTGCTTCCGGTAGGAG
AGCGGTGTAGAGCGAGCAGGTCTCAGCTCCTCGTCATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGC
TCCGGGACTTCAGCAGCATCATCCAGACGTGCAGCGGCAACATCCAGCGGATCAGCCAAGCCAAGGAGAAGAAGGGACCTGGTGGCGGCG
CCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGGACTCCATCTCAGAGGATGAAATGGTGCTGCGGGAGCGAAGCTACGACTATCAGTTCC
GCTACTGCGGCCACTGCAACACCACCACGGATATCAAAGAGGCCAATTTCTTTGGCAGCAACGCTCAGTATATCGTCAGTGGCTCTGACG
ATGGCTCCTTCTTCATCTGGGAAAAGGAGACCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCAC
ACCCCAGCTACTGCTTCCTGGCCACCAGTGGCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCC
GAGTCGTGGAAGATATGGAGGGTGCTTCACAGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCT
ACCGGATCACGGGCCTGAGCAGTGGGGGTGCCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGA
CCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTGGCTGGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCC
CACCACCCTTTTTTTTCATTTCCCCTGTTTTGTTTGTTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTG
GGCTGATTGTCCCCTGACTATCCCCAGCCCTGAAAAAAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCAT
GTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCCCTTCTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCT
TTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCCAATTGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCT
AGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAAAAAGGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGG
AAGGATGGGAGCCCTGGAGTGGGCAAGACCAGGCCACCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGG
CCCTGCACCTACTCTCACTGGCCACCTCTGGAGGCTCTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCC
ATCCATGCCAGCACTTCTGCACTACGGCCATTCTCCTCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGG
CCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGGGCCCTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAG
ACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTGCTGCTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTA
CTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTTTACACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCC
CGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGGTTCATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAG
CCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCCTCCCTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAG
GTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCCTGGAGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAG
GGTGAGGATAGTGGTGGGGGGTCTGGCACCATCTCATTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCC
AGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGGTAATGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGG
GACCTGCTCCCCTGTCTCTTCTCCGTGACCTTTCTCTAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGG
ACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCCAGCCACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCT
TCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGCAGTGTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTT

>In-frame_STX12_ENST00000373943_chr1_28146243_+_WDTC1_ENST00000319394_chr1_27608730_+_4995nt
GCACGCAGCCTTAGCTCCTTCCCCGCCCTTGCTCTTCCCAGTTTCTCCGTCAGCCTGCGGGTCCCGGCTGGCGGCTGCTTCCGGTAGGAG
AGCGGTGTAGAGCGAGCAGGTCTCAGCTCCTCGTCATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGC
TCCGGGACTTCAGCAGCATCATCCAGACGTGCAGCGGCAACATCCAGCGGATCAGCCAAGCCACTGCTCAGATAAAGAATTTGATGAGCC
AGCTAGGAACTAAGCAGGACTCAAGCAAGCTACAGGAAAATCTGCAACAGTTACAACACTCCACAAATCAGCTCGCCAAGGAAACAAATG
AATTGCTGAAAGAATTAGGGTCCTTGCCCCTTCCCTTATCTACTTCAGAACAGCGCCAGCAGAGACTTCAGAAGGAACGCCTCATGAATG
ACTTCTCTGCAGCCTTAAACAATTTCCAGGCTGTGCAGAGAAGGGTATCTGAAAAGGAAAAGGAGAGTATTGCCAGAGCAAGAGCTGGAT
CTCGTCTTTCTGCAGAAGAGAGGCAAAGAGAGGAGCAGCTGGTCTCATTTGACAGCCATGAGGAGTGGAACCAGATGCAGAGCCAGGAGG
ATGAGGTGGCCATCACTGAGCAGGATTTGGAACTTATTAAAGAAAGAGAAACGGCAATTCGGCAGCTGGAGGCTGACATTTTGGATGTCA
ATCAGATATTTAAAGATTTGGCCATGATGATCCATGACCAGGGTGATCTGATTGATAGCATAGAAGCCAATGTGGAAAGCTCAGAGGTGC
ACGTCGAAAGAGCCACTGAACAGTTACAGCGAGCTGCTTACTATCAGGGTCACTCAGGATGTGTCAACTGTCTGGAGTGGAATGAGAAAG
GAGACTTGCTGGCCTCTGGTTCCGATGACCAGCACACGATTGTGTGGGACCCGCTGCACCACAAGAAGCTGCTCTCCATGCACACGGGAC
ACACCGCAAATATCTTCTCTGTCAAGTTCCTGCCTCACGCTGGGGACCGCATCTTGATCACGGGGGCAGCCGACTCTAAGGTGCATGTGC
ACGACCTGACAGTAAAGGAGACCATCCACATGTTTGGAGACCACACAAACCGGGTGAAGCGCATCGCCACAGCGCCCATGTGGCCCAACA
CATTCTGGAGTGCTGCTGAGGATGGGCTTATCCGCCAGTATGACCTTCGAGAGAACAGCAAACACTCGGAGGTGCTGATTGACCTGACAG
AGTACTGTGGCCAGCTGGTGGAGGCCAAGTGCCTCACTGTCAACCCCCAGGACAACAACTGCCTGGCAGTTGGGGCCAGCGGGCCCTTCG
TGAGGCTCTATGACATCCGCATGATCCATAACCACAGAAAGAGCATGAAGCAGAGCCCTTCAGCGGGTGTGCACACCTTCTGTGACCGGC
AGAAACCCCTTCCGGACGGTGCAGCCCAGTATTACGTAGCAGGTCACCTGCCAGTGAAGCTTCCTGACTACAACAACCGTTTGAGAGTGC
TGGTTGCCACCTATGTGACCTTCAGCCCCAATGGCACAGAGCTACTAGTCAACATGGGGGGGGAACAGGTCTATTTGTTTGACTTGACTT
ACAAGCAGCGGCCGTACACCTTCCTCTTGCCTAGAAAATGCCACTCCTCGGGGGAAGTCCAGAATGGCAAGATGTCCACCAACGGTGTGT
CCAACGGTGTGTCCAATGGCCTGCACCTTCATAGCAATGGCTTCCGGCTGCCGGAGAGTAGGGGACATGTCAGCCCCCAAGTAGAGCTAC
CACCATACCTGGAGCGTGTGAAACAGCAAGCCAATGAGGCTTTTGCCTGCCAGCAGTGGACCCAAGCCATTCAGCTTTACAGCAAGGCTG
TGCAGAGGGCCCCTCACAATGCCATGCTTTATGGAAACCGAGCAGCAGCCTACATGAAGCGCAAGTGGGATGGTGACCACTATGATGCCC
TGAGGGACTGCCTCAAGGCCATCTCCCTAAACCCATGCCACCTGAAGGCACACTTTCGCCTGGCCCGCTGCCTCTTTGAGCTCAAGTATG
TGGCTGAAGCCCTGGAGTGCCTGGACGACTTCAAAGGGAAATTTCCGGAGCAGGCCCACAGCAGCGCTTGTGATGCATTGGGCCGCGACA
TCACAGCTGCCCTCTTCTCTAAAAATGATGGTGAGGAGAAGAAGGGACCTGGTGGCGGCGCCCCAGTCCGCCTCCGCAGCACGAGCCGCA
AGGACTCCATCTCAGAGGATGAAATGGTGCTGCGGGAGCGAAGCTACGACTATCAGTTCCGCTACTGCGGCCACTGCAACACCACCACGG
ATATCAAAGAGGCCAATTTCTTTGGCAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGA
CCACCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTG
GCATCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCAC
AGGCCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTG
CCGGGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTA
CTGGCTGGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTT
TGTTTGTTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCC
TGAAAAAAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAA
CCCCTTCTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATT
CCCAATTGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTT
GAAAAAGGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACC
AGGCCACCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTG
GAGGCTCTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCA
TTCTCCTCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTA
AGGGCCCTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCC
CTGCTGCTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAG
CTTTACACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGT
TGGTTCATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCA
GCCTCCCTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAG
CCCTGGAGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACC
ATCTCATTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCT
TGGTAATGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACC
TTTCTCTAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGT
TCCAGCCACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCC
TGCAGTGTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGA
CGCAATTGATTAAAACCATTTTGTTCTAGGTGTGGCTGGTGGCATTTGTGGGGTGCAGATGGGTCTTGGAACCAAAGTGAGGGCACCTGG
TCCCTCACCTCTGTAGCTCTATGACTTAGTAACCACACCTCTACTGGACAGAATGAGGCCTGCCTTGAAGGGTCACCGTGAGCAGCGGCC
ACCCAGCCCAGCAGGGCTGAGTGCAGAGCCCAGCTCTCATGGCTGTGATTTGTAATCATCAGCTTTCACTCTCTGGCTGTTTTCTCATCA
GTAAAATAAGGGACTTGGAATCTTAGTGGTTTTTCAAACCATTTTACATTGTGACCCAATATACACATGATTACTTGTAGATATGTGTGT

>In-frame_STX12_ENST00000373943_chr1_28146243_+_WDTC1_ENST00000361771_chr1_27608730_+_4617nt
GCACGCAGCCTTAGCTCCTTCCCCGCCCTTGCTCTTCCCAGTTTCTCCGTCAGCCTGCGGGTCCCGGCTGGCGGCTGCTTCCGGTAGGAG
AGCGGTGTAGAGCGAGCAGGTCTCAGCTCCTCGTCATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGC
TCCGGGACTTCAGCAGCATCATCCAGACGTGCAGCGGCAACATCCAGCGGATCAGCCAAGCCACTGCTCAGATAAAGAATTTGATGAGCC
AGCTAGGAACTAAGCAGGACTCAAGCAAGCTACAGGAAAATCTGCAACAGTTACAACACTCCACAAATCAGCTCGCCAAGGAAACAAATG
AATTGCTGAAAGAATTAGGGTCCTTGCCCCTTCCCTTATCTACTTCAGAACAGCGCCAGCAGAGACTTCAGAAGGAACGCCTCATGAATG
ACTTCTCTGCAGCCTTAAACAATTTCCAGGCTGTGCAGAGAAGGGTATCTGAAAAGGAAAAGGAGAGTATTGCCAGAGCAAGAGCTGGAT
CTCGTCTTTCTGCAGAAGAGAGGCAAAGAGAGGAGCAGCTGGTCTCATTTGACAGCCATGAGGAGTGGAACCAGATGCAGAGCCAGGAGG
ATGAGGTGGCCATCACTGAGCAGGATTTGGAACTTATTAAAGAAAGAGAAACGGCAATTCGGCAGCTGGAGGCTGACATTTTGGATGTCA
ATCAGATATTTAAAGATTTGGCCATGATGATCCATGACCAGGGTGATCTGATTGATAGCATAGAAGCCAATGTGGAAAGCTCAGAGGTGC
ACGTCGAAAGAGCCACTGAACAGTTACAGCGAGCTGCTTACTATCAGGGTCACTCAGGATGTGTCAACTGTCTGGAGTGGAATGAGAAAG
GAGACTTGCTGGCCTCTGGTTCCGATGACCAGCACACGATTGTGTGGGACCCGCTGCACCACAAGAAGCTGCTCTCCATGCACACGGGAC
ACACCGCAAATATCTTCTCTGTCAAGTTCCTGCCTCACGCTGGGGACCGCATCTTGATCACGGGGGCAGCCGACTCTAAGGTGCATGTGC
ACGACCTGACAGTAAAGGAGACCATCCACATGTTTGGAGACCACACAAACCGGGTGAAGCGCATCGCCACAGCGCCCATGTGGCCCAACA
CATTCTGGAGTGCTGCTGAGGATGGGCTTATCCGCCAGTATGACCTTCGAGAGAACAGCAAACACTCGGAGGTGCTGATTGACCTGACAG
AGTACTGTGGCCAGCTGGTGGAGGCCAAGTGCCTCACTGTCAACCCCCAGGACAACAACTGCCTGGCAGTTGGGGCCAGCGGGCCCTTCG
TGAGGCTCTATGACATCCGCATGATCCATAACCACAGAAAGAGCATGAAGCAGAGCCCTTCAGCGGGTGTGCACACCTTCTGTGACCGGC
AGAAACCCCTTCCGGACGGTGCAGCCCAGTATTACGTAGCAGGTCACCTGCCAGTGAAGCTTCCTGACTACAACAACCGTTTGAGAGTGC
TGGTTGCCACCTATGTGACCTTCAGCCCCAATGGCACAGAGCTACTAGTCAACATGGGGGGGGAACAGGTCTATTTGTTTGACTTGACTT
ACAAGCAGCGGCCGTACACCTTCCTCTTGCCTAGAAAATGCCACTCCTCGGGGGTCCAGAATGGCAAGATGTCCACCAACGGTGTGTCCA
ACGGTGTGTCCAATGGCCTGCACCTTCATAGCAATGGCTTCCGGCTGCCGGAGAGTAGGGGACATGTCAGCCCCCAAGTAGAGCTACCAC
CATACCTGGAGCGTGTGAAACAGCAAGCCAATGAGGCTTTTGCCTGCCAGCAGTGGACCCAAGCCATTCAGCTTTACAGCAAGGCTGTGC
AGAGGGCCCCTCACAATGCCATGCTTTATGGAAACCGAGCAGCAGCCTACATGAAGCGCAAGTGGGATGGTGACCACTATGATGCCCTGA
GGGACTGCCTCAAGGCCATCTCCCTAAACCCATGCCACCTGAAGGCACACTTTCGCCTGGCCCGCTGCCTCTTTGAGCTCAAGTATGTGG
CTGAAGCCCTGGAGTGCCTGGACGACTTCAAAGGGAAATTTCCGGAGCAGGCCCACAGCAGCGCTTGTGATGCATTGGGCCGCGACATCA
CAGCTGCCCTCTTCTCTAAAAATGATGGTGAGGAGAAGAAGGGACCTGGTGGCGGCGCCCCAGTCCGCCTCCGCAGCACGAGCCGCAAGG
ACTCCATCTCAGAGGATGAAATGGTGCTGCGGGAGCGAAGCTACGACTATCAGTTCCGCTACTGCGGCCACTGCAACACCACCACGGATA
TCAAAGAGGCCAATTTCTTTGGCAGCAACGCTCAGTATATCGTCAGTGGCTCTGACGATGGCTCCTTCTTCATCTGGGAAAAGGAGACCA
CCAACCTGGTCCGTGTGCTCCAAGGGGATGAGTCCATTGTCAACTGCCTGCAGCCACACCCCAGCTACTGCTTCCTGGCCACCAGTGGCA
TCGATCCTGTTGTGCGGCTCTGGAACCCCCGACCAGAGAGTGAAGACCTCACAGGCCGAGTCGTGGAAGATATGGAGGGTGCTTCACAGG
CCAACCAGCGGCGCATGAATGCAGACCCGTTGGAGGTGATGCTGCTCAACATGGGCTACCGGATCACGGGCCTGAGCAGTGGGGGTGCCG
GGGCCTCTGATGATGAGGACAGCTCTGAGGGCCAGGTGCAGTGCCGGCCCAGCTAGACCCTCCAGCCCTGGTCCCCAGCCCCTGCTACTG
GCTGGACCCTCTGCCCTGGGCAGGAGGTCAGGGGATTCTGTTTTGGTTTGTCTTCCCCACCACCCTTTTTTTTCATTTCCCCTGTTTTGT
TTGTTAGTTTGGCGTTAGGGGTGGAGGTTGCTACAACTTGCTGGCTTTCGGACTCTGGGCTGATTGTCCCCTGACTATCCCCAGCCCTGA
AAAAAAGAGCAGGAGGGGACACCCCTCCATATGCCCCCCCCCATCTCCTGCTTTCATGTCCCTGGAGGGCTCTGGCCTGCCTCAAAACCC
CTTCTGCCTCAGGTGGGGAGGAACAAGCTGAACTGTCTTCAGGGACTGTCCTGCCCTTTAGCTGGCAGCAGCAGGAGGAGTGGGATTCCC
AATTGGTAAGGGCTCGCCTTGGCCTGTTGCCACTCTTGCTCCCTAGCCTGCAAGGCTAGCTCCCCTGTGGTCTTCAGGAAAGGTTTTGAA
AAAGGATGGGTCCCACCCTCCCTCCAGAGCCACCAGTGTTAGAGCGGAGCCCAAAGGAAGGATGGGAGCCCTGGAGTGGGCAAGACCAGG
CCACCTGCTGAGGTCGCTGTGGAGCACCCTCGCTCCTCTCCTGGCTACTAGCTCTGGCCCTGCACCTACTCTCACTGGCCACCTCTGGAG
GCTCTGCCTTTCCCAAGGGCCCTGGCAGAGGGTGGGGCACTGCACCTTACCCCACCCATCCATGCCAGCACTTCTGCACTACGGCCATTC
TCCTCTTGGGCGCTCCTCAGCCTCACTGTGACCTTTCTGCCAGAGCTCCCAGCCAGGCCTACTCTGCTGAGGTGGCGCTTCCTGCTAAGG
GCCCTTCTCTGCCCTTTCTGCCCTCCTTCCCATCCCACATGCTGAGCCGCCACAAAGACCAAAGAAGTGATGGCTTTTCTCTGTCCCCTG
CTGCTCTGAGGGGAGAGGGGTGGGTCTCCTGAGCCACTCAGATGGGAAAGTCCCTTACTCGGCCCCTCCCTCCCCAGCAGCCCCAAGCTT
TACACTGGATGCAGCGATCAACCCACCACTCACCAGGCCTCTCCTCCCCTCTGCCCCCGGCTCTTAGCTCCAGCTGCTCCAGGTAGTTGG
TTCATCCTTCCCCCTCTCTCCCTCCCTGCTTCCCCTTCAGTGCTTACTTGGCTCCAGCCCTCCAGCTGCAGCCCCTGGGGAAAAGCAGCC
TCCCTTCTCCTCTCCCTCCACTCCCTCGCTCCCTCCCTCAGCCCCTGTCTCTGCCAGGTGCCTCCTCTCAGTCAGGCTTCAGAGCAGCCC
TGGAGACAGGAGGGCCATGTTAAAAGCTTTTTCACAGTTTTAAGAAGACAAGTGGAGGGTGAGGATAGTGGTGGGGGGTCTGGCACCATC
TCATTGCTTTAATCCCAGCAACACAGGTGGCAGCTTCTCCCCCTTCCTTCCCACCCCAGTCCCTCTTCCCACCCCTCTCTTCTAGCTTGG
TAATGAAGTATATTTATTGGTGAAGGAAACAGCTGCTGCTGCTTCTCCTGCTGCTGGGACCTGCTCCCCTGTCTCTTCTCCGTGACCTTT
CTCTAGCCAGGGAGAAGGGAGAGCAGGAGTATTGGGGCTGGGCCCTGGGGCCCAAGGACCAGCTGGGTCCCCTTTGCTTTCTTGTGTTCC
AGCCACCTGCCATTTCCTCCCTGCCTCCCACCCTCCCTCCCTGCCCCCTGTCCTGCTTCCCACCCCCTGCCTGCCCAGCCTGGGCCCTGC
AGTGTGGAGAGACACATAAGCCTTACTGTCCTCTGGGGGCAGGAGCCGAGCCTTTTTGTTGCTCCGCTCCCAGGAGAGTGAGGGTGACGC


Top

FusionGenePPI for STX12_WDTC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STX12NAPA, SNAP23, BLOC1S6, EEA1, SNAP25, SNAP29, NSF, ABCA1, ELAVL1, HGS, ATP6V1B1, GOSR1, NDUFS1, ATP4A, STX4, DTX2, MOV10, VTI1B, STX6, STX7, EIF2B5, RNF13, KIAA1467, YKT6, EIF2B1, BNIP1, EIF2B4, GOLGA2, BZW2, ZKSCAN1, VPS45, NAPB, USE1, STX18, SCFD2, NOP14, GORASP1, NAPG, STX5, STXBP5, NBAS, STX10, ITFG3, TXLNA, TBC1D15, SNAP47, MOSPD2, TBK1, NOC4L, VTI1A, OPTN, ADPGK, EIF2B3, TBC1D17, VAMP4, STX8, GOSR2, VAMP2, VAMP3, EIF2B2, VAMP8, PRMT9, FRMD5, VAMP7, ZNF219, ACP2, CCDC138, F3, TNFRSF10B, OPN4, BET1, EHD1, ANXA11, ATP5L, CISD1, RAB1A, RAB1B, RAP1B, RER1, TM9SF4, VDAC1, VDAC2, VDAC3, EWSR1, TMEM17, TMEM216, MYH9, TMEM258, TRDN, STXBP6, SLC7A1, SEC22B, COG6, LMNAWDTC1USP3, DDB1, CUL4A, DDA1, TADA2A, MED4, CUL3, SLC25A22, BCKDK, MRPS11, FBXW11, XPO1, STXBP4, CUL4B, MIPEP, ETNK1, PPP1R21, CCT6A, CCT3, CCT2, TCP1, CCT4, PDCL, ARHGAP44, SEPT3, CCT7, CCT5, CCT6B, DFNB31


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STX12_WDTC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STX12_WDTC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource