FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36606

FusionGeneSummary for STRN_ALK

check button Fusion gene summary
Fusion gene informationFusion gene name: STRN_ALK
Fusion gene ID: 36606
HgeneTgene
Gene symbol

STRN

ALK

Gene ID

6801

238

Gene namestriatinALK receptor tyrosine kinase
SynonymsPPP2R6A|SG2NA|STRN1CD246|NBLST3
Cytomap

2p22.2

2p23.2-p23.1

Type of geneprotein-codingprotein-coding
Descriptionstriatinprotein phosphatase 2 regulatory subunit B'''alphastriatin, calmodulin binding proteinALK tyrosine kinase receptorCD246 antigenanaplastic lymphoma receptor tyrosine kinasemutant anaplastic lymphoma kinase
Modification date2018052320180527
UniProtAcc

O43815

Q9UM73

Ensembl transtripts involved in fusion geneENST00000263918, ENST00000379213, 
ENST00000389048, ENST00000431873, 
ENST00000498037, 
Fusion gene scores* DoF score5 X 6 X 7=21024 X 23 X 10=5520
# samples 846
** MAII scorelog2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(46/5520*10)=-3.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STRN [Title/Abstract] AND ALK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneALK

GO:0016310

phosphorylation

9174053

TgeneALK

GO:0046777

protein autophosphorylation

9174053


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-G7-6792-01ASTRNchr2

37143221

-ALKchr2

29446394

-
TCGARVTHCATCGA-DJ-A3US-01ASTRNchr2

37143221

-ALKchr2

29446394

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000263918ENST00000389048STRNchr2

37143221

-ALKchr2

29446394

-
5CDS-intronENST00000263918ENST00000431873STRNchr2

37143221

-ALKchr2

29446394

-
5CDS-intronENST00000263918ENST00000498037STRNchr2

37143221

-ALKchr2

29446394

-
In-frameENST00000379213ENST00000389048STRNchr2

37143221

-ALKchr2

29446394

-
5CDS-intronENST00000379213ENST00000431873STRNchr2

37143221

-ALKchr2

29446394

-
5CDS-intronENST00000379213ENST00000498037STRNchr2

37143221

-ALKchr2

29446394

-

Top

FusionProtFeatures for STRN_ALK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STRN

O43815

ALK

Q9UM73

Calmodulin-binding protein which may function asscaffolding or signaling protein and may play a role in dendriticCa(2+) signaling. Neuronal receptor tyrosine kinase that is essentiallyand transiently expressed in specific regions of the central andperipheral nervous systems and plays an important role in thegenesis and differentiation of the nervous system. Transducessignals from ligands at the cell surface, through specificactivation of the mitogen-activated protein kinase (MAPK) pathway.Phosphorylates almost exclusively at the first tyrosine of the Y-x-x-x-Y-Y motif. Following activation by ligand, ALK inducestyrosine phosphorylation of CBL, FRS2, IRS1 and SHC1, as well asof the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Acts as a receptorfor ligands pleiotrophin (PTN), a secreted growth factor, andmidkine (MDK), a PTN-related factor, thus participating in PTN andMDK signal transduction. PTN-binding induces MAPK pathwayactivation, which is important for the anti-apoptotic signaling ofPTN and regulation of cell proliferation. MDK-binding inducesphosphorylation of the ALK target insulin receptor substrate(IRS1), activates mitogen-activated protein kinases (MAPKs) andPI3-kinase, resulting also in cell proliferation induction. DrivesNF-kappa-B activation, probably through IRS1 and the activation ofthe AKT serine/threonine kinase. Recruitment of IRS1 to activatedALK and the activation of NF-kappa-B are essential for theautocrine growth and survival signaling of MDK.{ECO:0000269|PubMed:11121404, ECO:0000269|PubMed:11278720,ECO:0000269|PubMed:11387242, ECO:0000269|PubMed:11809760,ECO:0000269|PubMed:12107166, ECO:0000269|PubMed:12122009,ECO:0000269|PubMed:15226403, ECO:0000269|PubMed:15908427,ECO:0000269|PubMed:16317043, ECO:0000269|PubMed:16878150,ECO:0000269|PubMed:17274988}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-31853_120137781Coiled coilOntology_term=ECO:0000255
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-41853_120125732Coiled coilOntology_term=ECO:0000255
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-31855_63137781RegionCaveolin-binding
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-41855_63125732RegionCaveolin-binding
TgeneALKchr2:37143221chr2:29446394ENST00000389048-18291116_139210571621DomainProtein kinase
TgeneALKchr2:37143221chr2:29446394ENST00000389048-18291197_119910571621RegionNote=Inhibitor binding
TgeneALKchr2:37143221chr2:29446394ENST00000389048-18291060_162010571621Topological domainCytoplasmic

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318149_166137781RegionCalmodulin-binding
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418149_166125732RegionCalmodulin-binding
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318461_500137781RepeatNote=WD 1
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318514_553137781RepeatNote=WD 2
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318567_606137781RepeatNote=WD 3
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318662_701137781RepeatNote=WD 4
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318704_743137781RepeatNote=WD 5
HgeneSTRNchr2:37143221chr2:29446394ENST00000263918-318750_779137781RepeatNote=WD 6
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418461_500125732RepeatNote=WD 1
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418514_553125732RepeatNote=WD 2
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418567_606125732RepeatNote=WD 3
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418662_701125732RepeatNote=WD 4
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418704_743125732RepeatNote=WD 5
HgeneSTRNchr2:37143221chr2:29446394ENST00000379213-418750_779125732RepeatNote=WD 6
TgeneALKchr2:37143221chr2:29446394ENST00000389048-1829816_94010571621Compositional biasNote=Gly-rich
TgeneALKchr2:37143221chr2:29446394ENST00000389048-1829264_42710571621DomainMAM 1
TgeneALKchr2:37143221chr2:29446394ENST00000389048-1829437_47310571621DomainNote=LDL-receptor class A
TgeneALKchr2:37143221chr2:29446394ENST00000389048-1829478_63610571621DomainMAM 2
TgeneALKchr2:37143221chr2:29446394ENST00000389048-182919_103810571621Topological domainExtracellular
TgeneALKchr2:37143221chr2:29446394ENST00000389048-18291039_105910571621TransmembraneHelical


Top

FusionGeneSequence for STRN_ALK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STRN_ENST00000263918_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_701aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKG
QENLKKDLVRRIKMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAG
KTSSISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSL
PRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRA
SYTRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQP
EDRPNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAE
ISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRL

>In-frame_STRN_ENST00000379213_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_689aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRI
KMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVP
RKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGG
DLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYTRKGGCAMLP
VKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILER
IEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVE
GGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSL

>In-frame_STRN_ENST00000263918_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_701aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKG
QENLKKDLVRRIKMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAG
KTSSISDLKEVPRKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSL
PRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRA
SYTRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQP
EDRPNFAIILERIEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAE
ISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRL

>In-frame_STRN_ENST00000379213_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_689aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRI
KMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVP
RKNITLIRGLGHGAFGEVTEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGG
DLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQTLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYTRKGGCAMLP
VKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGTMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILER
IEYCTQDPDVINTALPIETGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVE
GGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STRN_ENST00000263918_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2103nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGAGGCT
GCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGG
GCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGC
CAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAA
TACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAG
ATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGC
AAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTG
TATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGAC
GAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTG
CCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCC
CTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATT
GCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCG
AGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACA
GACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAG
TTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCT
GAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAA
TATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCA
AAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAG
ATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCAC
AAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAAT
CCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTT
CCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGG
AATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAA

>In-frame_STRN_ENST00000379213_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2067nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAG
CTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCG
CGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCA
AGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGC
AAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGA
GACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGAC
ATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCT
GGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCA
GTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATC
TTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAG
AACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGG
ATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCT
GTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCA
CCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAA
GGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTG
TGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAAC
CTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTG
ACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCC

>In-frame_STRN_ENST00000263918_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2103nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGAGGCT
GCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGG
GCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGC
CAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAA
TACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAG
ATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGC
AAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTG
TATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGAC
GAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTG
CCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCC
CTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATT
GCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCG
AGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACA
GACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAG
TTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCT
GAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAA
TATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCA
AAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAG
ATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCAC
AAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAAT
CCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTT
CCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGG
AATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAA

>In-frame_STRN_ENST00000379213_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2067nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAG
CTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCG
CGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCA
AGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGC
AAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGA
GACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGAC
ATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCT
GGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCA
GTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATC
TTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAG
AACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGG
ATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCT
GTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCA
CCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAA
GGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTG
TGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAAC
CTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTG
ACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_STRN_ENST00000263918_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2562nt
GCGGCCGCCATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTG
GCGGAGGCTGCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAG
CACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAA
AGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCAC
AAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAA
GCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGC
TTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTT
GGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCT
GAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTG
CAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAG
CCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCAC
CGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATC
TACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACT
TCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAA
GTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAA
CATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTG
CCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCT
CAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACA
GCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCG
GAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAA
AAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACT
GGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTC
CCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACC
ATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGG
AGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAA
GCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAA
ATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTT
CAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAG

>In-frame_STRN_ENST00000379213_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2517nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAG
CTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCG
CGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCA
AGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGC
AAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGA
GACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGAC
ATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCT
GGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCA
GTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATC
TTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAG
AACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGG
ATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCT
GTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCA
CCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAA
GGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTG
TGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAAC
CTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTG
ACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCC
TTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCT
CGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGT
CACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCA
TCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTG
TTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTC

>In-frame_STRN_ENST00000263918_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2562nt
GCGGCCGCCATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTG
GCGGAGGCTGCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAG
CACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAA
AGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCAC
AAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAA
GCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGC
TTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTT
GGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCT
GAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTG
CAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAG
CCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCAC
CGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATC
TACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACT
TCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAA
GTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAA
CATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTG
CCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCT
CAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACA
GCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCG
GAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAA
AAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACT
GGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTC
CCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACC
ATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGG
AGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAA
GCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAA
ATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTT
CAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGATGTGGACATGAGCCATTTGAG

>In-frame_STRN_ENST00000379213_chr2_37143221_-_ALK_ENST00000389048_chr2_29446394_-_2517nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGTGTACCGCCGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAG
CTCCGCACCTCGACCATCATGACCGACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCG
CGGAAAAACATCACCCTCATTCGGGGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCA
AGCCCCCTGCAAGTGGCTGTGAAGACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGC
AAATTCAACCACCAGAACATTGTTCGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGA
GACCTCAAGTCCTTCCTCCGAGAGACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGAC
ATTGCCTGTGGCTGTCAGTATTTGGAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCT
GGAAGAGTGGCCAAGATTGGAGACTTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCA
GTTAAGTGGATGCCCCCAGAGGCCTTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATC
TTTTCTCTTGGATATATGCCATACCCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAG
AACTGCCCTGGGCCTGTATACCGGATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGG
ATTGAATACTGCACCCAGGACCCGGATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCT
GTGAGGCCCAAGGACCCTGAGGGGGTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCA
CCTCTGCCTACCACCTCCTCTGGCAAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAA
GGGGGACACGTGAATATGGCATTCTCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTG
TGGAACCCAACGTACGGCTCCTGGTTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAAC
CTGGGGCTGGAGGGAAGCTGTACTGTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTG
ACTGCCAATATGAAGGAGGTACCTCTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCC
TTAGAAGCCGCTACTGCCCCTGGAGCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCT
CGGTCGCACACTCACTTCTCTTCCTTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGT
CACGTTTTGTTTTGTGCCAACCTATTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCA
TCCTATTCTTTCGAAAGAAGAAAATATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTG
TTGTATACTTCCTTATGCTTCTTTCAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTC


Top

FusionGenePPI for STRN_ALK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STRNSTK24, MCC, CTTNBP2, CTTNBP2NL, STRIP1, MOB4, PDCD10, PPP2CA, PPP2R1A, STK26, SIKE1, STK25, STRN3, PPP2R1B, STRN4, STRIP2, SLMAP, CCT2, CCT8, CCT3, TCP1, CCT5, FGFR1OP2, CCT6A, CCT7, CCT4, CCT6B, TRAF3IP3, PPP2CB, ZRANB1, ELAVL1, LNX1, APC, TJP1, DDX1, DYNC1H1, CPSF6, EIF2S1, SF3B5, BRCA1, ECT2, PAXIP1, STK3, STK4, TFIP11, RINT1, PCOLCE2, LYPD3, NR1H3, PPP2R2C, RASSF3, PGAM5, NTRK1, HSPB1, DYNLL1, MAP4K4, EEF1E1, BAG2, SLC43A3, AHNAK, PRDM14, TNFRSF1A, NHSL2, PSMC5, PLP1, ZNF550, SNX24, LRRCC1, ZNF331, PRPF19, SPINK2, EXOC1, PKN3, NCKAP5L, TFPT, CCHCR1, YEATS4, TUFT1, RABGAP1L, GOLGA5ALKPTN, SHC1, PLCG1, JAK3, SHC3, RAB35, HSPD1, MAP3K4, GRB2, SOCS1, PIK3CB, RAD17, IRF7, EPHB2, EIF4B, MAPK8IP3, CENPF, PLCB2, PDX1, STAT3, MAP2K7, JAK2, MAP3K5, MEP1B, GAK, EPHA1, UBASH3A, MTIF2, MYLK, MAP3K1, MAPK1, SOCS5, CDK13, SMC6, IRS4, KRT18, KRT74, IRS1, IKBKG, ZC3HC1, TNK2, ERRFI1, PIK3R1, HSP90AA1, BCAR1, ACTB, PDLIM3, VIM, TUBB4B, MYO6, MYH10, MYH9, TUBGCP2, ACTN4, CORO1C, FLII, BICD2, GNB2L1, SRC, PXN, PRKCQ, MYBPC2, CDK9, PPM1A, DUSP19


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STRN_ALK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneALKQ9UM73DB08865CrizotinibALK tyrosine kinase receptorsmall moleculeapproved
TgeneALKQ9UM73DB09063CeritinibALK tyrosine kinase receptorsmall moleculeapproved

Top

RelatedDiseases for STRN_ALK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneALKC0007131Non-Small Cell Lung Carcinoma28CTD_human
TgeneALKC0027819Neuroblastoma12CTD_human;ORPHANET
TgeneALKC0152013Adenocarcinoma of lung (disorder)8CTD_human
TgeneALKC0206180Ki-1+ Anaplastic Large Cell Lymphoma6CTD_human
TgeneALKC2751681NEUROBLASTOMA, SUSCEPTIBILITY TO, 34UNIPROT
TgeneALKC0018199Granuloma, Plasma Cell3CTD_human
TgeneALKC0007621Neoplastic Cell Transformation2CTD_human
TgeneALKC0027627Neoplasm Metastasis2CTD_human
TgeneALKC0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneALKC0006118Brain Neoplasms1CTD_human
TgeneALKC0007134Renal Cell Carcinoma1CTD_human
TgeneALKC0011570Mental Depression1PSYGENET
TgeneALKC0011581Depressive disorder1PSYGENET
TgeneALKC0027643Neoplasm Recurrence, Local1CTD_human
TgeneALKC0036341Schizophrenia1PSYGENET
TgeneALKC0079744Diffuse Large B-Cell Lymphoma1CTD_human
TgeneALKC0085269Plasma Cell Granuloma, Pulmonary1CTD_human
TgeneALKC0278601Inflammatory Breast Carcinoma1CTD_human