FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36545

FusionGeneSummary for STK3_SULT1A3

check button Fusion gene summary
Fusion gene informationFusion gene name: STK3_SULT1A3
Fusion gene ID: 36545
HgeneTgene
Gene symbol

STK3

SULT1A3

Gene ID

8428

6818

Gene nameserine/threonine kinase 24sulfotransferase family 1A member 3
SynonymsHEL-S-95|MST3|MST3B|STE20|STK3HAST|HAST3|M-PST|ST1A3|ST1A3/ST1A4|ST1A5|STM|TL-PST
Cytomap

13q32.2

16p11.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase 24STE20-like kinase 3STE20-like kinase MST3epididymis secretory protein Li 95mammalian STE20-like protein kinase 3serine/threonine kinase 24 (STE20 homolog, yeast)sterile 20-like kinase 3sulfotransferase 1A3aryl sulfotransferase 1A3/1A4catecholamine-sulfating phenol sulfotransferasedopamine-specific sulfotransferasemonoamine-sulfating phenosulfotransferasephenol sulfotransferase 1A5placental estrogen sulfotransferasesulfokinasesul
Modification date2018052320180519
UniProtAcc

Q13188

Ensembl transtripts involved in fusion geneENST00000419617, ENST00000523601, 
ENST00000521768, 
ENST00000354723, 
ENST00000355544, ENST00000395137, 
ENST00000338971, ENST00000395138, 
ENST00000563322, 
Fusion gene scores* DoF score15 X 8 X 8=9601 X 1 X 1=1
# samples 131
** MAII scorelog2(13/960*10)=-2.88452278258006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: STK3 [Title/Abstract] AND SULT1A3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTK3

GO:0006468

protein phosphorylation

19604147

HgeneSTK3

GO:0042542

response to hydrogen peroxide

22291017

HgeneSTK3

GO:0046777

protein autophosphorylation

17046825|17657516

TgeneSULT1A3

GO:0006068

ethanol catabolic process

23207770

TgeneSULT1A3

GO:0006805

xenobiotic metabolic process

20056724

TgeneSULT1A3

GO:0007212

dopamine receptor signaling pathway

24136195

TgeneSULT1A3

GO:0009812

flavonoid metabolic process

20056724

TgeneSULT1A3

GO:0042420

dopamine catabolic process

23207770

TgeneSULT1A3

GO:0050427

3'-phosphoadenosine 5'-phosphosulfate metabolic process

23207770

TgeneSULT1A3

GO:0051923

sulfation

20056724|23207770

TgeneSULT1A3

GO:0070371

ERK1 and ERK2 cascade

24136195

TgeneSULT1A3

GO:0097720

calcineurin-mediated signaling

24136195

TgeneSULT1A3

GO:0098989

NMDA selective glutamate receptor signaling pathway

24136195


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-66-2766-01ASTK3chr8

99718695

-SULT1A3chr16

30214011

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000419617ENST00000354723STK3chr8

99718695

-SULT1A3chr16

30214011

+
In-frameENST00000419617ENST00000355544STK3chr8

99718695

-SULT1A3chr16

30214011

+
In-frameENST00000419617ENST00000395137STK3chr8

99718695

-SULT1A3chr16

30214011

+
In-frameENST00000419617ENST00000338971STK3chr8

99718695

-SULT1A3chr16

30214011

+
In-frameENST00000419617ENST00000395138STK3chr8

99718695

-SULT1A3chr16

30214011

+
In-frameENST00000419617ENST00000563322STK3chr8

99718695

-SULT1A3chr16

30214011

+
Frame-shiftENST00000523601ENST00000354723STK3chr8

99718695

-SULT1A3chr16

30214011

+
Frame-shiftENST00000523601ENST00000355544STK3chr8

99718695

-SULT1A3chr16

30214011

+
Frame-shiftENST00000523601ENST00000395137STK3chr8

99718695

-SULT1A3chr16

30214011

+
Frame-shiftENST00000523601ENST00000338971STK3chr8

99718695

-SULT1A3chr16

30214011

+
Frame-shiftENST00000523601ENST00000395138STK3chr8

99718695

-SULT1A3chr16

30214011

+
Frame-shiftENST00000523601ENST00000563322STK3chr8

99718695

-SULT1A3chr16

30214011

+
intron-3CDSENST00000521768ENST00000354723STK3chr8

99718695

-SULT1A3chr16

30214011

+
intron-3CDSENST00000521768ENST00000355544STK3chr8

99718695

-SULT1A3chr16

30214011

+
intron-3CDSENST00000521768ENST00000395137STK3chr8

99718695

-SULT1A3chr16

30214011

+
intron-3CDSENST00000521768ENST00000338971STK3chr8

99718695

-SULT1A3chr16

30214011

+
intron-3CDSENST00000521768ENST00000395138STK3chr8

99718695

-SULT1A3chr16

30214011

+
intron-3CDSENST00000521768ENST00000563322STK3chr8

99718695

-SULT1A3chr16

30214011

+

Top

FusionProtFeatures for STK3_SULT1A3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STK3

Q13188

SULT1A3

Stress-activated, pro-apoptotic kinase which, followingcaspase-cleavage, enters the nucleus and induces chromatincondensation followed by internucleosomal DNA fragmentation. Keycomponent of the Hippo signaling pathway which plays a pivotalrole in organ size control and tumor suppression by restrictingproliferation and promoting apoptosis. The core of this pathway iscomposed of a kinase cascade wherein STK3/MST2 and STK4/MST1, incomplex with its regulatory protein SAV1, phosphorylates andactivates LATS1/2 in complex with its regulatory protein MOB1,which in turn phosphorylates and inactivates YAP1 oncoprotein andWWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits itstranslocation into the nucleus to regulate cellular genesimportant for cell proliferation, cell death, and cell migration.STK3/MST2 and STK4/MST1 are required to repress proliferation ofmature hepatocytes, to prevent activation of facultative adultliver stem cells (oval cells), and to inhibit tumor formation.Phosphorylates NKX2-1 (By similarity). Phosphorylates NEK2 andplays a role in centrosome disjunction by regulating thelocalization of NEK2 to centrosome, and its ability tophosphorylate CROCC and CEP250. In conjunction with SAV1,activates the transcriptional activity of ESR1 through themodulation of its phosphorylation. Positively regulates RAF1activation via suppression of the inhibitory phosphorylation ofRAF1 on 'Ser-259'. Phosphorylates MOBKL1A and RASSF2.Phosphorylates MOBKL1B on 'Thr-74'. Acts cooperatively withMOBKL1B to activate STK38. {ECO:0000250|UniProtKB:Q9JI10,ECO:0000269|PubMed:15688006, ECO:0000269|PubMed:16930133,ECO:0000269|PubMed:18328708, ECO:0000269|PubMed:18362890,ECO:0000269|PubMed:19525978, ECO:0000269|PubMed:20212043,ECO:0000269|PubMed:21076410, ECO:0000269|PubMed:21104395,ECO:0000269|PubMed:28087714, ECO:0000269|PubMed:8566796,ECO:0000269|PubMed:8816758}. Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-61133_41228492Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-611287_328228492Coiled coilOntology_term=ECO:0000255
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-611442_475228492Coiled coilOntology_term=ECO:0000255
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-611308_314228492Compositional biasNote=Poly-Glu
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-611370_375228492Compositional biasNote=Poly-Glu
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-61127_278228492DomainProtein kinase
HgeneSTK3chr8:99718695chr16:30214011ENST00000419617-611437_484228492DomainSARAH


Top

FusionGeneSequence for STK3_SULT1A3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000354723_chr16_30214011_+_400aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYF
KNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGE
VSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFM

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000355544_chr16_30214011_+_400aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYF
KNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGE
VSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFM

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000395137_chr16_30214011_+_400aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYF
KNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGE
VSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFM

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000338971_chr16_30214011_+_400aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYF
KNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGE
VSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFM

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000395138_chr16_30214011_+_400aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYF
KNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGE
VSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFM

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000563322_chr16_30214011_+_406aa
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYF
KNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGE
VSYGSWYQHVQEWWELSRTHPVLYLFYEDMKEEPSAAQNPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000354723_chr16_30214011_+_1200nt
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTA
GAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTT
GAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTT
AAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAA
GATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGACTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGA
AATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACT
GTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACT
TCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCG
GTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCACCCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAA
GTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATG
AAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCAC
ACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATG
AGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGC

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000355544_chr16_30214011_+_1200nt
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTA
GAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTT
GAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTT
AAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAA
GATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGACTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGA
AATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACT
GTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACT
TCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCG
GTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCACCCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAA
GTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATG
AAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCAC
ACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATG
AGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGC

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000395137_chr16_30214011_+_1200nt
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTA
GAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTT
GAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTT
AAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAA
GATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGACTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGA
AATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACT
GTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACT
TCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCG
GTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCACCCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAA
GTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATG
AAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCAC
ACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATG
AGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGC

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000338971_chr16_30214011_+_1200nt
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTA
GAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTT
GAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTT
AAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAA
GATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGACTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGA
AATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACT
GTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACT
TCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCG
GTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCACCCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAA
GTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATG
AAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCAC
ACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATG
AGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGC

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000395138_chr16_30214011_+_1200nt
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTA
GAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTT
GAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTT
AAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAA
GATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGACTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGA
AATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACT
GTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACT
TCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCG
GTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCACCCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAA
GTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATG
AAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCAC
ACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATG
AGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGC

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000563322_chr16_30214011_+_1218nt
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTA
GAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTT
GAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTT
AAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAA
GATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGACTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGA
AATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACT
GTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACT
TCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCG
GTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCACCCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAA
GTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATG
AAGGAGGAGCCCTCTGCTGCTCAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATG
GACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCAC
AGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000354723_chr16_30214011_+_1727nt
CCGCGGAGTTACGGGAAAGTTGGTCCGAGTTCCCAGAGTTTCCCTCTGTGGTGCCCTAGGCTCGGCCGGCCGGTGCCCCGGCTCCTTTCC
TCCTTTCGGCCTTCGCCGTCCACCAGGTCCCTCTCTCTGTCCCCGGCCGCCATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAG
CTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAA
GCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATA
ATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGC
GCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGA
CTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCA
GATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATT
CAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGAT
ATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCGGTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCAC
CCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAAGTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGG
TGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATGAAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAG
TTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAAC
TACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACC
GTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGCTGCAGCCTCAGCTTCCGCTCTGAGCTGTGAGAGGGGCTC
CTGGAGTCACTGCAGAGGGAGTGTGCGAATCTACCCTGACCAATGGGCTCAAGAATAAAGTATGATTTTTGAGTCAGGCACAGTGGCTCA
TGTCTGCAATCCCAGCGATTTGGGAGGTTGAGCTGGTAGGATCACAATAGGCCACGAATTTGAGACCAGCCTGGTAAAATAGTGAGACCT
CATCTCTACAAAGATGTAAAAAAATTAGCCACATGTGCTGGCACTTACCTGTAGTCCCAGCTACTTGGGAAGCAGAGGCTGGAGGATCAT
TTCAGCCCAGGAGGTTGTGGATACAGTGAGTTATGACATGCCCATTCACTACAGCCTGGATGACAAGCAAGACCCTCCCTCCAAAGAAAA

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000355544_chr16_30214011_+_1722nt
CCGCGGAGTTACGGGAAAGTTGGTCCGAGTTCCCAGAGTTTCCCTCTGTGGTGCCCTAGGCTCGGCCGGCCGGTGCCCCGGCTCCTTTCC
TCCTTTCGGCCTTCGCCGTCCACCAGGTCCCTCTCTCTGTCCCCGGCCGCCATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAG
CTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAA
GCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATA
ATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGC
GCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGA
CTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCA
GATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATT
CAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGAT
ATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCGGTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCAC
CCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAAGTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGG
TGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATGAAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAG
TTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAAC
TACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACC
GTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGCTGCAGCCTCAGCTTCCGCTCTGAGCTGTGAGAGGGGCTC
CTGGAGTCACTGCAGAGGGAGTGTGCGAATCTACCCTGACCAATGGGCTCAAGAATAAAGTATGATTTTTGAGTCAGGCACAGTGGCTCA
TGTCTGCAATCCCAGCGATTTGGGAGGTTGAGCTGGTAGGATCACAATAGGCCACGAATTTGAGACCAGCCTGGTAAAATAGTGAGACCT
CATCTCTACAAAGATGTAAAAAAATTAGCCACATGTGCTGGCACTTACCTGTAGTCCCAGCTACTTGGGAAGCAGAGGCTGGAGGATCAT
TTCAGCCCAGGAGGTTGTGGATACAGTGAGTTATGACATGCCCATTCACTACAGCCTGGATGACAAGCAAGACCCTCCCTCCAAAGAAAA

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000395137_chr16_30214011_+_1429nt
CCGCGGAGTTACGGGAAAGTTGGTCCGAGTTCCCAGAGTTTCCCTCTGTGGTGCCCTAGGCTCGGCCGGCCGGTGCCCCGGCTCCTTTCC
TCCTTTCGGCCTTCGCCGTCCACCAGGTCCCTCTCTCTGTCCCCGGCCGCCATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAG
CTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAA
GCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATA
ATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGC
GCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGA
CTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCA
GATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATT
CAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGAT
ATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCGGTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCAC
CCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAAGTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGG
TGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATGAAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAG
TTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAAC
TACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACC
GTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGCTGCAGCCTCAGCTTCCGCTCTGAGCTGTGAGAGGGGCTC

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000338971_chr16_30214011_+_1449nt
CCGCGGAGTTACGGGAAAGTTGGTCCGAGTTCCCAGAGTTTCCCTCTGTGGTGCCCTAGGCTCGGCCGGCCGGTGCCCCGGCTCCTTTCC
TCCTTTCGGCCTTCGCCGTCCACCAGGTCCCTCTCTCTGTCCCCGGCCGCCATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAG
CTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAA
GCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATA
ATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGC
GCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGA
CTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCA
GATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATT
CAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGAT
ATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCGGTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCAC
CCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAAGTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGG
TGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATGAAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAG
TTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAAC
TACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACC
GTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGCTGCAGCCTCAGCTTCCGCTCTGAGCTGTGAGAGGGGCTC
CTGGAGTCACTGCAGAGGGAGTGTGCGAATCTACCCTGACCAATGGGCTCAAGAATAAAGTATGATTTTTGAGTCAGGCACAGTGGCTCA

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000395138_chr16_30214011_+_1731nt
CCGCGGAGTTACGGGAAAGTTGGTCCGAGTTCCCAGAGTTTCCCTCTGTGGTGCCCTAGGCTCGGCCGGCCGGTGCCCCGGCTCCTTTCC
TCCTTTCGGCCTTCGCCGTCCACCAGGTCCCTCTCTCTGTCCCCGGCCGCCATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAG
CTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAA
GCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATA
ATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGC
GCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGA
CTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCA
GATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATT
CAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGAT
ATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCGGTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCAC
CCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAAGTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGG
TGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATGAAGGAGAACCCCAAAAGGGAGATTCAAAAGATCCTGGAG
TTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAGAAGAACCCTATGACCAAC
TACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGACTGGAAGACCACCTTCACC
GTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGCTGCAGCCTCAGCTTCCGCTCTGAGCTGTGAGAGGGGCTC
CTGGAGTCACTGCAGAGGGAGTGTGCGAATCTACCCTGACCAATGGGCTCAAGAATAAAGTATGATTTTTGAGTCAGGCACAGTGGCTCA
TGTCTGCAATCCCAGCGATTTGGGAGGTTGAGCTGGTAGGATCACAATAGGCCACGAATTTGAGACCAGCCTGGTAAAATAGTGAGACCT
CATCTCTACAAAGATGTAAAAAAATTAGCCACATGTGCTGGCACTTACCTGTAGTCCCAGCTACTTGGGAAGCAGAGGCTGGAGGATCAT
TTCAGCCCAGGAGGTTGTGGATACAGTGAGTTATGACATGCCCATTCACTACAGCCTGGATGACAAGCAAGACCCTCCCTCCAAAGAAAA

>In-frame_STK3_ENST00000419617_chr8_99718695_-_SULT1A3_ENST00000563322_chr16_30214011_+_1359nt
CCGCGGAGTTACGGGAAAGTTGGTCCGAGTTCCCAGAGTTTCCCTCTGTGGTGCCCTAGGCTCGGCCGGCCGGTGCCCCGGCTCCTTTCC
TCCTTTCGGCCTTCGCCGTCCACCAGGTCCCTCTCTCTGTCCCCGGCCGCCATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAG
CTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTTTGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAA
GCAATACACAAGGAATCCGGTCAAGTTGTCGCAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATA
ATGCAGCAATGTGACAGCCCATATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGC
GCTGGCTCTGTCTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGA
CTAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCAAAATTGGCA
GATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTGGATGGCTCCTGAGGTGATT
CAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAATGGCTGAAGGAAAACCTCCTTATGCTGAT
ATACATCCAATGAGGGTGGTCTATGTTGCCCGAAACCCAAAGGACGTGGCGGTCTCCTACTACCATTTCCACCGTATGGAAAAGGCGCAC
CCTGAGCCTGGGACCTGGGACAGCTTCCTGGAAAAGTTCATGGCTGGAGAAGTGTCCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGG
TGGGAGCTGAGCCGCACCCACCCTGTTCTCTACCTCTTCTATGAAGACATGAAGGAGGAGCCCTCTGCTGCTCAGAACCCCAAAAGGGAG
ATTCAAAAGATCCTGGAGTTTGTGGGGCGCTCCCTGCCAGAGGAGACCATGGACTTCATGGTTCAGCACACGTCGTTCAAGGAGATGAAG
AAGAACCCTATGACCAACTACACCACCGTCCCCCAGGAGCTCATGGACCACAGCATCTCCCCCTTCATGAGGAAAGGCATGGCTGGGGAC
TGGAAGACCACCTTCACCGTGGCGCAGAATGAGCGCTTCGATGCGGACTATGCGGAGAAGATGGCAGGCTGCAGCCTCAGCTTCCGCTCT


Top

FusionGenePPI for STK3_SULT1A3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STK3CNKSR1, MAP1LC3A, MAP1LC3B, RASSF5, STK4, SAV1, ATG4B, PLK1, CACYBP, RASSF2, FREM1, KHSRP, DDAH2, PHAX, QARS, MPP1, GBP2, LATS1, RASSF6, MOB4, NRD1, MOB1A, RASSF1, RAF1, MBP, MOB1B, LATS2, PTPN14, LRRK2, EIF4EBP1, TAZ, STK3, AKT1, ORM2, CPNE1, PEX19, ZC3H7A, HSPE1, SULT2A1, SLMAP, CTTNBP2NL, RASSF3, AURKB, ERLIN2, STRIP1, FGFR1OP2, KIF2C, MAP1S, PRKRIR, RAE1, RASSF4, RUNDC3B, STRN, STRN3, STRN4, TSPYL1, YWHAB, CSNK1E, NEB, MAP1B, CDK3, DST, ACACA, VAPA, FBXW11, GAD1, TRAF1, TFPT, GMCL1, FAM9B, BTRC, ADCYAP1, MRPL40, NSUN5, IFI16, FGFR1OP, CEP128, XPO1, C21orf59, CENPO, CASP3, MTMR7, KIF2B, ZNF133, VAPB, ZIM2, ZNF420, ZNF695, SKP2, KIF3B, CDK1SULT1A3TK1, SMN1, APP, SHMT1, NIF3L1, KHDRBS2, SULT1A1, SULT1A2, MPPED2, SULT4A1, SULT1C2, TTC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STK3_SULT1A3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STK3_SULT1A3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource