FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36472

FusionGeneSummary for STK10_SLIT3

check button Fusion gene summary
Fusion gene informationFusion gene name: STK10_SLIT3
Fusion gene ID: 36472
HgeneTgene
Gene symbol

STK10

SLIT3

Gene ID

6793

6586

Gene nameserine/threonine kinase 10slit guidance ligand 3
SynonymsLOK|PRO2729MEGF5|SLIL2|SLIT1|Slit-3|slit2
Cytomap

5q35.1

5q34-q35.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase 10lymphocyte-oriented kinaseslit homolog 3 proteinmultiple EGF-like domains protein 5multiple epidermal growth factor-like domains protein 5slit homolog 3
Modification date2018052320180522
UniProtAcc

O94804

O75094

Ensembl transtripts involved in fusion geneENST00000176763, ENST00000517775, 
ENST00000519560, ENST00000332966, 
ENST00000404867, ENST00000521130, 
Fusion gene scores* DoF score5 X 5 X 5=1254 X 4 X 4=64
# samples 64
** MAII scorelog2(6/125*10)=-1.05889368905357
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STK10 [Title/Abstract] AND SLIT3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTK10

GO:0046777

protein autophosphorylation

12639966|18239682

TgeneSLIT3

GO:0007411

axon guidance

11748139

TgeneSLIT3

GO:0021834

chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration

11748139

TgeneSLIT3

GO:0048846

axon extension involved in axon guidance

16840550

TgeneSLIT3

GO:0050919

negative chemotaxis

11748139


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-86-8056-01ASTK10chr5

171583628

-SLIT3chr5

168127684

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000176763ENST00000519560STK10chr5

171583628

-SLIT3chr5

168127684

-
In-frameENST00000176763ENST00000332966STK10chr5

171583628

-SLIT3chr5

168127684

-
In-frameENST00000176763ENST00000404867STK10chr5

171583628

-SLIT3chr5

168127684

-
5CDS-intronENST00000176763ENST00000521130STK10chr5

171583628

-SLIT3chr5

168127684

-
intron-3CDSENST00000517775ENST00000519560STK10chr5

171583628

-SLIT3chr5

168127684

-
intron-3CDSENST00000517775ENST00000332966STK10chr5

171583628

-SLIT3chr5

168127684

-
intron-3CDSENST00000517775ENST00000404867STK10chr5

171583628

-SLIT3chr5

168127684

-
intron-intronENST00000517775ENST00000521130STK10chr5

171583628

-SLIT3chr5

168127684

-

Top

FusionProtFeatures for STK10_SLIT3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STK10

O94804

SLIT3

O75094

Serine/threonine-protein kinase involved in regulationof lymphocyte migration. Phosphorylates MSN, and possibly PLK1.Involved in regulation of lymphocyte migration by mediatingphosphorylation of ERM proteins such as MSN. Acts as a negativeregulator of MAP3K1/MEKK1. May also act as a cell cycle regulatorby acting as a polo kinase kinase: mediates phosphorylation ofPLK1 in vitro; however such data require additional evidences invivo. {ECO:0000269|PubMed:11903060, ECO:0000269|PubMed:12639966,ECO:0000269|PubMed:19255442}. May act as molecular guidance cue in cellular migration,and function may be mediated by interaction with roundabouthomolog receptors.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTK10chr5:171583628chr5:168127684ENST00000176763-21942_50107969Nucleotide bindingATP
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361034_10729481473DomainEGF-like 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361074_11109481473DomainEGF-like 5
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361119_11559481473DomainEGF-like 6
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361158_13329481473DomainLaminin G-like
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361340_13659481473DomainEGF-like 7
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361368_14039481473DomainEGF-like 8
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361408_14449481473DomainEGF-like 9
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-25361449_15239481473DomainCTCK
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536955_9949481473DomainEGF-like 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536996_10329481473DomainEGF-like 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361034_10729481524DomainEGF-like 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361074_11109481524DomainEGF-like 5
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361119_11559481524DomainEGF-like 6
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361158_13329481524DomainLaminin G-like
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361340_13659481524DomainEGF-like 7
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361368_14039481524DomainEGF-like 8
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361408_14449481524DomainEGF-like 9
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-25361449_15239481524DomainCTCK
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536955_9949481524DomainEGF-like 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536996_10329481524DomainEGF-like 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTK10chr5:171583628chr5:168127684ENST00000176763-219573_947107969Coiled coilOntology_term=ECO:0000255
HgeneSTK10chr5:171583628chr5:168127684ENST00000176763-219750_884107969Compositional biasNote=Gln-rich
HgeneSTK10chr5:171583628chr5:168127684ENST00000176763-21936_294107969DomainProtein kinase
HgeneSTK10chr5:171583628chr5:168127684ENST00000176763-219175_224107969RegionNote=Activation segment
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536215_2659481473DomainNote=LRRCT 1
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536271_3079481473DomainNote=LRRNT 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-253634_619481473DomainNote=LRRNT
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536437_4879481473DomainNote=LRRCT 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536496_5329481473DomainNote=LRRNT 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536663_7139481473DomainNote=LRRCT 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536716_7529481473DomainNote=LRRNT 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536857_9079481473DomainNote=LRRCT 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536918_9539481473DomainEGF-like 1
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536215_2659481524DomainNote=LRRCT 1
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536271_3079481524DomainNote=LRRNT 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-253634_619481524DomainNote=LRRNT
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536437_4879481524DomainNote=LRRCT 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536496_5329481524DomainNote=LRRNT 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536663_7139481524DomainNote=LRRCT 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536716_7529481524DomainNote=LRRNT 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536857_9079481524DomainNote=LRRCT 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536918_9539481524DomainEGF-like 1
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536110_1319481473RepeatNote=LRR 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536134_1559481473RepeatNote=LRR 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536158_1799481473RepeatNote=LRR 5
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536182_2039481473RepeatNote=LRR 6
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536308_3299481473RepeatNote=LRR 7
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536332_3539481473RepeatNote=LRR 8
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536356_3779481473RepeatNote=LRR 9
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536380_4019481473RepeatNote=LRR 10
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536404_4259481473RepeatNote=LRR 11
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536533_5549481473RepeatNote=LRR 12
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536558_5799481473RepeatNote=LRR 13
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536582_6039481473RepeatNote=LRR 14
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536606_6279481473RepeatNote=LRR 15
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-253662_839481473RepeatNote=LRR 1
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536630_6519481473RepeatNote=LRR 16
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536753_7759481473RepeatNote=LRR 17
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536776_7979481473RepeatNote=LRR 18
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536800_8219481473RepeatNote=LRR 19
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-2536824_8459481473RepeatNote=LRR 20
TgeneSLIT3chr5:171583628chr5:168127684ENST00000404867-253686_1079481473RepeatNote=LRR 2
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536110_1319481524RepeatNote=LRR 3
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536134_1559481524RepeatNote=LRR 4
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536158_1799481524RepeatNote=LRR 5
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536182_2039481524RepeatNote=LRR 6
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536308_3299481524RepeatNote=LRR 7
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536332_3539481524RepeatNote=LRR 8
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536356_3779481524RepeatNote=LRR 9
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536380_4019481524RepeatNote=LRR 10
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536404_4259481524RepeatNote=LRR 11
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536533_5549481524RepeatNote=LRR 12
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536558_5799481524RepeatNote=LRR 13
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536582_6039481524RepeatNote=LRR 14
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536606_6279481524RepeatNote=LRR 15
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-253662_839481524RepeatNote=LRR 1
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536630_6519481524RepeatNote=LRR 16
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536753_7759481524RepeatNote=LRR 17
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536776_7979481524RepeatNote=LRR 18
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536800_8219481524RepeatNote=LRR 19
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-2536824_8459481524RepeatNote=LRR 20
TgeneSLIT3chr5:171583628chr5:168127684ENST00000519560-253686_1079481524RepeatNote=LRR 2


Top

FusionGeneSequence for STK10_SLIT3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000519560_chr5_168127684_-_683aa
MAFANFRRILRLSTFEKRKSRETEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDH
PYIVKLLGAYTHDGKLWGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCI
CPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH
PPPMVLLQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDN
DPLALELYQGHVRLVTDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSAL
RQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGK
CVATGTSYMCKCAEGTGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGTASCATAS

>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000332966_chr5_168127684_-_683aa
MAFANFRRILRLSTFEKRKSRETEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDH
PYIVKLLGAYTHDGKLWGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCI
CPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH
PPPMVLLQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDN
DPLALELYQGHVRLVTDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSAL
RQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGK
CVATGTSYMCKCAEGTGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGTASCATAS

>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000404867_chr5_168127684_-_632aa
MAFANFRRILRLSTFEKRKSRETEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDH
PYIVKLLGAYTHDGKLWGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCI
CPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEH
PPPMVLLQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDN
DPLALELYQGHVRLVTDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSAL
RQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGK
CVATGTSYMCKCAEGTGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQVFRAQVFQSSLPGNCSWSCWPPRPPM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000519560_chr5_168127684_-_2049nt
ATGGCTTTTGCCAATTTCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCCCGCGAATATGAGCACGTCCGCCGCGACCTG
GACCCCAACGAGGTGTGGGAGATCGTGGGCGAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCT
TTGGCTGCGGCCAAAGTCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTGGAGATTGAGATCCTGGCCACCTGCGACCAC
CCCTACATTGTGAAGCTCCTGGGAGCCTACTATCACGACGGGAAGCTGTGGGGCAAGGACTGCACTGTGCCCATCAACACCTGCATCCAG
AACCCCTGTCAGCATGGAGGCACCTGCCACCTGAGTGACAGCCACAAGGATGGGTTCAGCTGCTCCTGCCCTCTGGGCTTTGAGGGGCAG
CGGTGTGAGATCAACCCAGATGACTGTGAGGACAACGACTGCGAAAACAATGCCACCTGCGTGGACGGGATCAACAACTACGTGTGTATC
TGTCCGCCTAACTACACAGGTGAGCTATGCGACGAGGTGATTGACCACTGTGTGCCTGAGCTGAACCTCTGTCAGCATGAGGCCAAGTGC
ATCCCCCTGGACAAAGGATTCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCAC
AAGTGCCGCCACGGGGCCCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACAC
CCCCCACCCATGGTCCTACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCC
ACCTGCCGCTGCCCACCAGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTG
GCCTCCGCCAAGGTCCGACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAAT
GACCCCCTGGCACTGGAGCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAG
ACAGTGAATGATGGGCAGTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGC
CTGGGGAAGCTCCAGAAGCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTG
CGCCAGGGCACGGACCGGCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTC
CCACCACAGTCCCTGGGGGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTG
GTGTGCGAGTGCCGCCCAGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAA
TGTGTGGCAACTGGGACCTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCC
TGCTCAGCCTTCAAGTGTCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAG
CACTGCCAACAAGAGAATCCGTGCCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCC
AAGGTGCCCATCATGGAATGTCGTGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGC

>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000332966_chr5_168127684_-_2049nt
ATGGCTTTTGCCAATTTCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCCCGCGAATATGAGCACGTCCGCCGCGACCTG
GACCCCAACGAGGTGTGGGAGATCGTGGGCGAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCT
TTGGCTGCGGCCAAAGTCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTGGAGATTGAGATCCTGGCCACCTGCGACCAC
CCCTACATTGTGAAGCTCCTGGGAGCCTACTATCACGACGGGAAGCTGTGGGGCAAGGACTGCACTGTGCCCATCAACACCTGCATCCAG
AACCCCTGTCAGCATGGAGGCACCTGCCACCTGAGTGACAGCCACAAGGATGGGTTCAGCTGCTCCTGCCCTCTGGGCTTTGAGGGGCAG
CGGTGTGAGATCAACCCAGATGACTGTGAGGACAACGACTGCGAAAACAATGCCACCTGCGTGGACGGGATCAACAACTACGTGTGTATC
TGTCCGCCTAACTACACAGGTGAGCTATGCGACGAGGTGATTGACCACTGTGTGCCTGAGCTGAACCTCTGTCAGCATGAGGCCAAGTGC
ATCCCCCTGGACAAAGGATTCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCAC
AAGTGCCGCCACGGGGCCCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACAC
CCCCCACCCATGGTCCTACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCC
ACCTGCCGCTGCCCACCAGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTG
GCCTCCGCCAAGGTCCGACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAAT
GACCCCCTGGCACTGGAGCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAG
ACAGTGAATGATGGGCAGTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGC
CTGGGGAAGCTCCAGAAGCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTG
CGCCAGGGCACGGACCGGCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTC
CCACCACAGTCCCTGGGGGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTG
GTGTGCGAGTGCCGCCCAGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAA
TGTGTGGCAACTGGGACCTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCC
TGCTCAGCCTTCAAGTGTCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAG
CACTGCCAACAAGAGAATCCGTGCCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCC
AAGGTGCCCATCATGGAATGTCGTGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGC

>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000404867_chr5_168127684_-_1896nt
ATGGCTTTTGCCAATTTCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCCCGCGAATATGAGCACGTCCGCCGCGACCTG
GACCCCAACGAGGTGTGGGAGATCGTGGGCGAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCT
TTGGCTGCGGCCAAAGTCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTGGAGATTGAGATCCTGGCCACCTGCGACCAC
CCCTACATTGTGAAGCTCCTGGGAGCCTACTATCACGACGGGAAGCTGTGGGGCAAGGACTGCACTGTGCCCATCAACACCTGCATCCAG
AACCCCTGTCAGCATGGAGGCACCTGCCACCTGAGTGACAGCCACAAGGATGGGTTCAGCTGCTCCTGCCCTCTGGGCTTTGAGGGGCAG
CGGTGTGAGATCAACCCAGATGACTGTGAGGACAACGACTGCGAAAACAATGCCACCTGCGTGGACGGGATCAACAACTACGTGTGTATC
TGTCCGCCTAACTACACAGGTGAGCTATGCGACGAGGTGATTGACCACTGTGTGCCTGAGCTGAACCTCTGTCAGCATGAGGCCAAGTGC
ATCCCCCTGGACAAAGGATTCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCAC
AAGTGCCGCCACGGGGCCCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACAC
CCCCCACCCATGGTCCTACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCC
ACCTGCCGCTGCCCACCAGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTG
GCCTCCGCCAAGGTCCGACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAAT
GACCCCCTGGCACTGGAGCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAG
ACAGTGAATGATGGGCAGTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGC
CTGGGGAAGCTCCAGAAGCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTG
CGCCAGGGCACGGACCGGCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTC
CCACCACAGTCCCTGGGGGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTG
GTGTGCGAGTGCCGCCCAGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAA
TGTGTGGCAACTGGGACCTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCC
TGCTCAGCCTTCAAGTGTCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAG
CACTGCCAACAAGTCTTCAGAGCACAAGTATTTCAAAGCAGCCTACCTGGGAACTGCTCATGGTCCTGCTGGCCACCTAGACCACCAATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000519560_chr5_168127684_-_7107nt
CGGTGGGCGGGCGCGGGGACGGTCCCCTGGAACGGGTCCGAGGCTCTCGCAGGCAGGGCTGGGCCGGGCAGGAGCTGCGAGGCCGGCACA
AGGGAGGCGGCCCTGGGGACCTGACAGGGCGGGGGCGGGGGCGGGCACGCCGCCGCCTGCGCGGTTCCGGGTGCTCCCGGCGCGGCGCTG
CCCAGGGCACACTTGACCGAGGTCGGGCTGCGGGGAAAGGCGGGTCTGGGGAGAACCCCGAGAGACGCGGCGTCCTCCAACTCCTCCTCC
TTCTCCTCGCGGCCGCCGAAGCCACAGCCCGAGCCCGAGCCCGAGCCCGAGCCGGCGCCACCGCGCCCCCGGCCATGGCTTTTGCCAATT
TCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCCCGCGAATATGAGCACGTCCGCCGCGACCTGGACCCCAACGAGGTGT
GGGAGATCGTGGGCGAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCTTTGGCTGCGGCCAAAG
TCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTGGAGATTGAGATCCTGGCCACCTGCGACCACCCCTACATTGTGAAGC
TCCTGGGAGCCTACTATCACGACGGGAAGCTGTGGGGCAAGGACTGCACTGTGCCCATCAACACCTGCATCCAGAACCCCTGTCAGCATG
GAGGCACCTGCCACCTGAGTGACAGCCACAAGGATGGGTTCAGCTGCTCCTGCCCTCTGGGCTTTGAGGGGCAGCGGTGTGAGATCAACC
CAGATGACTGTGAGGACAACGACTGCGAAAACAATGCCACCTGCGTGGACGGGATCAACAACTACGTGTGTATCTGTCCGCCTAACTACA
CAGGTGAGCTATGCGACGAGGTGATTGACCACTGTGTGCCTGAGCTGAACCTCTGTCAGCATGAGGCCAAGTGCATCCCCCTGGACAAAG
GATTCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGG
CCCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCC
TACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCAC
CAGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCC
GACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGG
AGCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGC
AGTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGA
AGCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACC
GGCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGG
GGGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCC
CAGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGA
CCTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGT
GTCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGAGA
ATCCGTGCCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCCAAGGTGCCCATCATGG
AATGTCGTGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGCACGGACGGCTCCTCGT
TTGTAGAAGAGGTGGAGAGACACTTAGAGTGCGGCTGCCTCGCGTGTTCCTAAGCCCCTGCCCGCCTGCCTGCCACCTCTCGGACTCCAG
CTTGATGGAGTTGGGACAGCCATGTGGGACCCCCTGGTGATTCAGCATGAAGGAAATGAAGCTGGAGAGGAAGGTAAAGAAGAAGAGAAT
ATTAAGTATATTGTAAAATAAACAAAAAATAGAACTTATTTTTATTATGGAAAGTGACTATTTTCATCTTTTATTATATAAATATATTAC
ACCATCTGCGTATATGTACCATATAGTGAGTTATTTTTACCAAGTTTTGTGTTGTGTATTTGTTGTGTTTTTAAAAATAGCTGTTTAAAA
ATTTAAGAAAAAAATAGACTAATAAAAATGCTTTAAAACAAAAGGATAAGAATAAAGAATGATAGCCTGTCTGAGGAAGGAGGAAGATGT
TTTCATGTTTATGAAACGGTATTATGTCGGCAGTAGACCAAGAGCTGCTCATTGAGATCAGAAAAAGGAATAAGAGGAAGAGAGAGAAGG
AAAAGACCTTTGTTTCTTGTTTTTTAACTCCCTTTTATTTTTCCTCCCCTAAAATTACCCAGCTTTTCGGAGTCCTGGATGTCAGTGCCC
AAAATGCCCAGTTCTTCCAGGAAAAGCTGCTGAGCCCTGGCCTTCTCAGTCTCACTGCCACTCAAAAATATTGCTGTCCCTGTCTGTCCC
AGACCCCCCTTCAGGGTATCTGAACCCACTGGGGGACCCCTCTTCTCCTTCCTGGGTGGCCCTGGCTTCCGTATCTGAACCCACTGGGGG
ACCCCTCTTCTCCTTCCTGGCTGGCCCTGGCTTCCAATCGAGGACTGACTATTGAAGTCTGCTACAGGTGTCATTTGGAACTGTCTTACC
AAATTTTAAAACAGCTGCTATTTTTCCTGCTCCTCCCCAGGAGAGGGGTCTTCCTAGAGGAGGCGAGGGAAGAGAATATCATGGTGTCTC
CTCAGGACCCATGCACTGGCCCTCTCTCCTCCTTCCAGGTAATTTTTCATTGGAATGTATCCCAGTAGAGAAGGTAGTCAGCCCTTCTTG
GAAGCGGAAGGCTGGGAGCCAAGTCAAGTCTGCCCACAGCGCTAGATGTCCAACTCTGGAAGGTTCTTGGAGGCTCTTGTTGTAAGACAG
GCCTCTGCCACCTGATCCTCCAGGTCACCAGCATGACGATAGAGACTCCTTGCCCATCTGTGACACTTTCCAATGCATATCCAAACTTTA
CCTTATTTTATCTATGCAACCCCTGCCTCCCTGGGAAGGATAAGGGAGTAGAGCTGGGTTCACTAAGAAGGAAGTTTAGGCCCTCACAGG
CTCTGGAACTTGCCTTAAGCCACACACCAGATAAGTGGAGGAGCCAGACCAGAAGTCCAGACCCAAAGCTTGAGATTCTTCCTCTAGAAT
GGGTGAGCACAGGTGATTCAGGCGGCTTAAATCCATCAGAGCAGCCCTGCCGGAAAAGGAAATAATATGATGTTTTTTCCTGCTCTTGTT
CTGCCTTGCTCACTCCTTCTCCCTCCGCAGTATCTGGAAAGATTCTGGAGACCAGGGCTTATGCATCTAGGGAAAGTGACCAAGGGCAGC
CTATCCAGCCTCTGCCTCCATTCCTGAAGGGGACTTCCCTGCCCCTGTTTCTTTCCATGTCTCTCCCTCCCTCACTCCCATTTGCCCCCT
TCCACCCCATCAGGTTAGCCACATATCTTCCAGGGCTCAGCTGTTCACACCAACTCCCTGGCTCTTATCATCCATCCCTCCTTCCCCCAG
GAGCTTCCACTGTAGGAGTTTCAGGGAGAAGAGTTTGGAATTCATTGGACCTTTCAGCCCTCAGGTTCCCTAGAGGAGCCTAGTTGATCT
GTGAGTACCAATGGTGGGCCAAAGACGCAGGGAATAATGAAGGGAGAAAGAAAAGAAAGGAAGATGGAGGAAAACGAGGCAACTGGAAGA
AGGAAGGAAGGAAAGAAGGAAGGGATGGAGGGGATGAAGAGAAGGGAGAGAGGGATATAGCTGAGGAATTTATCTAAAAATGTGCATGTA
AATCTCCATTATGTTCCAGGTACTGTGCCTTATGATGGCTTTGTTTTTTGTTGTCATTAGAGACAAGGTCTTGCTTTGTCACCCAGGCTG
GAGTAGAGTGGTTCGATCATAGCTCACCGCAGCCTCAACCTCCTAGGCTCAAGCCATCTTCCTGCCTCAGTCTCCCAAAATGCTGGGATT
ACAGGTGTGAGCCACTATGCTCAGCCTGTTTCAAACATTATTATAATAGCAGATTTATTTAGTACTTTATTATACATCAGATACCACTCT
AATTGTGAAATAGATATATATTCATTTAATTATTGAAACAACCATGTAGTTAAAACACTATTAACTCATTTTACAGTTGAGTAGACTGAG
ACACAGAGAAGTTAAAGAACTTGCCCAAGAGTAAATGTCTAATAAACCGTAGAGCCAGGATCTGGGCCCAGGCTGTCTGACTCCAGAACT
TGCTCACTCAACCACTAAACCATCCTGCTTCTCATGGGAAAGAAACACATCCTGCCTTTGAGGATCCTACAGCCTGTGACAAAAACAGTC
ATAAAAATGGACAATTGCCTTATTACACAAGGAGCTCTTAAGTGGCAATACAAGCAATGGAAGTGGCTGTCCAGAGGAGGGAACTTCTAG
TCCTAGGTCTTTAAGGATGAATAGGAGTTTGCCAGAGTGAGAAAGGGAATTGAACTTTCCTGGGAGTGGCCTTTTAAAAAGCAATGAGAT
ATGGCCAGGCCTGGCTTGTTTGGGGAAGAGTCAAAATCTAGGGTGGCAAGAGTATGGGAAGCACACTGAGGAGCAGAGAGAAATGGGGTA
GGTAGGAAGGTAGGGTTTTGACCACAAAGAGCTGTGCATGCTAAACTGGGCCACAGGTGCCAGCAGGGTTGTTTGAGGAAGGGAAGAGCA
AGACAAGCTCTGGTTTAGGAAGAGAGCTGTGGCAGCATAAAGGCCTGAAAGAGGAGACAGAGCTGTCACCCAAAATGGACTTGAGAGCTC
CCTGTGGTTTACTCTGTGGCTAGAAAACACTGCCGGCCAGATGGATCACAAATGTCTATGGTAGCTTAGAAGCTCTGCTCTTGAAGAGGA
TCCTGGGATCTGCCCAACACCCTTCCCAACCTCCATTTCCCCATCCCCACCTCCATTGCCCCATCCCCCCTCTCCCCCTAGGCAGGTGGA
TCTGAGCCTTATCCCACCACCAATGCCCCTGCTAGCCTCTCCCCACCCAGCCCAGAGCCTACTCAGCCTGCCATCTCAAGAGCCCCACCG
AGGGTCACTGGCTTCCTGGGAGGAGTCACCAGGCTGCCAGCTTTCCCTCTGCCTCCCCAAGGAACCTGAGACCTCCCTCTGCTCATCACC
CTGGGCCCAATCCTGAATCCAGCCCCCATCAACCAAGACAGCAAAAGGGCCAGGTCTGTCCCTTATAATTTTGAGCCTTCTCCCTCAAGT
TTGGAAGCCCTGACTTTAAGAAATGCCAAATGCAAGGACCATTAAGAAAATTCTCCCCGAAATGAGGCTCCTCTAACAAATGATGATTAA
AACGCTCTCTCCTTGAGCAGTCACATTCTAGAAACAGGACATTCCATGAGGCAGGAAGAGTTCAGTTAATTTGCTCCTGAAAAAGTGTGG
TTCAGTGTTTGTGTGGCAATGTACGTGGGCAGAAGAGGCCGCTCAAGCTGTGTCCCCCCTGAGCAGGATTCAGGAAAGGGAAAAGAAGTT
CTCTTCAACTCAGCCAAGGGGCCGTACGATGGCCGATGAGATTATGTATTTAAAAGTTCTTTGTAAAGTGTAAACTAAAAACCTTAAATG
TAAGATGCTGTTGTTATTATTACTGTTGTTGTTGCTGTTATGGACATGCCAAAAGGCCCTTGTTAGAAGACAGTTTTGCCTTTTCAATCT
CATAGCAAGGAACTCAAGTCTGATGCTTCAAAAAGATGAGAAGAAGGGCAAGAAGAGGGATAACTCCCAAGCTCAGAGGGAAAAAAAAGG
TGGGGGAAAAGAGCCCCAGGGTGACCTTCAGGAAAGGCCAGGACCAGGATGATCTAACCTTTCCCTTCACCAGAAACAAAGCTATTGCCA
GACTGAACCCTAAAGTCAAGCAGTCACCCACTGCCTTTGCTGGGAGCAGAAGCCCATAGCAACAAGTGACCTGCCCCTCAGACTCAAGAT
CCCAGATACCAGAGCTGGAGGAGTCATAGGGCATTACTGGTAGGCAGGAAAACTGAGGGTCGAACAAATGGAAGAATGCGGTGATCATAG
ACCAAAGACACACAGATAATTAACCCCATGTGTCCACCCAGGCCAAAGTTCTTCCTGCTACCCCACAGTGGATGTCCAGGCAGATGGTCC
CCACATGATGGGGAAGCAGAGGGCATAGTGTGGTTTTGTGGGACTTGTTCATGTTTTGTAGTGTGGGCTCAACAGTGCCAAAGGAAACAC
TAGGGAAAAGTTGGTGAAACATGCCAGCTAGCAGGACCAGTAAAGGCATAATCAGGCATTTGGCAAAGCTTGCTTTTCTAATTCAATGAT
AGGTTCTAATAGGAAATTTTTGAAGATTTTTTAAAACAATGTTATAGTGGCACTTCCCCAGTATGGAATAAATAACATGCATTCTTTTTT

>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000332966_chr5_168127684_-_2622nt
CGGTGGGCGGGCGCGGGGACGGTCCCCTGGAACGGGTCCGAGGCTCTCGCAGGCAGGGCTGGGCCGGGCAGGAGCTGCGAGGCCGGCACA
AGGGAGGCGGCCCTGGGGACCTGACAGGGCGGGGGCGGGGGCGGGCACGCCGCCGCCTGCGCGGTTCCGGGTGCTCCCGGCGCGGCGCTG
CCCAGGGCACACTTGACCGAGGTCGGGCTGCGGGGAAAGGCGGGTCTGGGGAGAACCCCGAGAGACGCGGCGTCCTCCAACTCCTCCTCC
TTCTCCTCGCGGCCGCCGAAGCCACAGCCCGAGCCCGAGCCCGAGCCCGAGCCGGCGCCACCGCGCCCCCGGCCATGGCTTTTGCCAATT
TCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCCCGCGAATATGAGCACGTCCGCCGCGACCTGGACCCCAACGAGGTGT
GGGAGATCGTGGGCGAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCTTTGGCTGCGGCCAAAG
TCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTGGAGATTGAGATCCTGGCCACCTGCGACCACCCCTACATTGTGAAGC
TCCTGGGAGCCTACTATCACGACGGGAAGCTGTGGGGCAAGGACTGCACTGTGCCCATCAACACCTGCATCCAGAACCCCTGTCAGCATG
GAGGCACCTGCCACCTGAGTGACAGCCACAAGGATGGGTTCAGCTGCTCCTGCCCTCTGGGCTTTGAGGGGCAGCGGTGTGAGATCAACC
CAGATGACTGTGAGGACAACGACTGCGAAAACAATGCCACCTGCGTGGACGGGATCAACAACTACGTGTGTATCTGTCCGCCTAACTACA
CAGGTGAGCTATGCGACGAGGTGATTGACCACTGTGTGCCTGAGCTGAACCTCTGTCAGCATGAGGCCAAGTGCATCCCCCTGGACAAAG
GATTCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGG
CCCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCC
TACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCAC
CAGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCC
GACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGG
AGCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGC
AGTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGA
AGCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACC
GGCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGG
GGGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCC
CAGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGA
CCTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGT
GTCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGAGA
ATCCGTGCCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCCAAGGTGCCCATCATGG
AATGTCGTGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGCACGGACGGCTCCTCGT
TTGTAGAAGAGGTGGAGAGACACTTAGAGTGCGGCTGCCTCGCGTGTTCCTAAGCCCCTGCCCGCCTGCCTGCCACCTCTCGGACTCCAG
CTTGATGGAGTTGGGACAGCCATGTGGGACCCCCTGGTGATTCAGCATGAAGGAAATGAAGCTGGAGAGGAAGGTAAAGAAGAAGAGAAT
ATTAAGTATATTGTAAAATAAACAAAAAATAGAACTTATTTTTATTATGGAAAGTGACTATTTTCATCTTTTATTATATAAATATATTAC

>In-frame_STK10_ENST00000176763_chr5_171583628_-_SLIT3_ENST00000404867_chr5_168127684_-_2240nt
CGGTGGGCGGGCGCGGGGACGGTCCCCTGGAACGGGTCCGAGGCTCTCGCAGGCAGGGCTGGGCCGGGCAGGAGCTGCGAGGCCGGCACA
AGGGAGGCGGCCCTGGGGACCTGACAGGGCGGGGGCGGGGGCGGGCACGCCGCCGCCTGCGCGGTTCCGGGTGCTCCCGGCGCGGCGCTG
CCCAGGGCACACTTGACCGAGGTCGGGCTGCGGGGAAAGGCGGGTCTGGGGAGAACCCCGAGAGACGCGGCGTCCTCCAACTCCTCCTCC
TTCTCCTCGCGGCCGCCGAAGCCACAGCCCGAGCCCGAGCCCGAGCCCGAGCCGGCGCCACCGCGCCCCCGGCCATGGCTTTTGCCAATT
TCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCCCGCGAATATGAGCACGTCCGCCGCGACCTGGACCCCAACGAGGTGT
GGGAGATCGTGGGCGAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCTTTGGCTGCGGCCAAAG
TCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTGGAGATTGAGATCCTGGCCACCTGCGACCACCCCTACATTGTGAAGC
TCCTGGGAGCCTACTATCACGACGGGAAGCTGTGGGGCAAGGACTGCACTGTGCCCATCAACACCTGCATCCAGAACCCCTGTCAGCATG
GAGGCACCTGCCACCTGAGTGACAGCCACAAGGATGGGTTCAGCTGCTCCTGCCCTCTGGGCTTTGAGGGGCAGCGGTGTGAGATCAACC
CAGATGACTGTGAGGACAACGACTGCGAAAACAATGCCACCTGCGTGGACGGGATCAACAACTACGTGTGTATCTGTCCGCCTAACTACA
CAGGTGAGCTATGCGACGAGGTGATTGACCACTGTGTGCCTGAGCTGAACCTCTGTCAGCATGAGGCCAAGTGCATCCCCCTGGACAAAG
GATTCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGG
CCCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCC
TACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCAC
CAGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCC
GACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGG
AGCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGC
AGTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGA
AGCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACC
GGCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGG
GGGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCC
CAGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGA
CCTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGT
GTCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGTCT


Top

FusionGenePPI for STK10_SLIT3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STK10CD81, ENO1, SHMT2, MOV10, NXF1, KIFC1, XPO1, TRIM25SLIT3CAPN1, OTUB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STK10_SLIT3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STK10_SLIT3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSTK10C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneSTK10C1336708Testicular Germ Cell Tumor1UNIPROT
TgeneSLIT3C0019284Diaphragmatic Hernia1CTD_human
TgeneSLIT3C0036341Schizophrenia1PSYGENET
TgeneSLIT3C0041696Unipolar Depression1PSYGENET
TgeneSLIT3C1269683Major Depressive Disorder1PSYGENET