FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36459

FusionGeneSummary for STIM1_VHL

check button Fusion gene summary
Fusion gene informationFusion gene name: STIM1_VHL
Fusion gene ID: 36459
HgeneTgene
Gene symbol

STIM1

VHL

Gene ID

6786

7428

Gene namestromal interaction molecule 1von Hippel-Lindau tumor suppressor
SynonymsD11S4896E|GOK|IMD10|STRMK|TAM|TAM1HRCA1|RCA1|VHL1|pVHL
Cytomap

11p15.4

3p25.3

Type of geneprotein-codingprotein-coding
Descriptionstromal interaction molecule 1von Hippel-Lindau disease tumor suppressorelongin binding proteinprotein G7von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase
Modification date2018052720180523
UniProtAcc

Q13586

P40337

Ensembl transtripts involved in fusion geneENST00000300737, ENST00000527651, 
ENST00000527484, ENST00000533977, 
ENST00000256474, ENST00000345392, 
ENST00000477538, 
Fusion gene scores* DoF score12 X 8 X 8=7683 X 2 X 3=18
# samples 123
** MAII scorelog2(12/768*10)=-2.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: STIM1 [Title/Abstract] AND VHL [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTIM1

GO:0002115

store-operated calcium entry

28219928

HgeneSTIM1

GO:0005513

detection of calcium ion

16005298

HgeneSTIM1

GO:0032237

activation of store-operated calcium channel activity

16005298|26322679|28219928

HgeneSTIM1

GO:0051924

regulation of calcium ion transport

16005298

TgeneVHL

GO:0016567

protein ubiquitination

24899725

TgeneVHL

GO:0061428

negative regulation of transcription from RNA polymerase II promoter in response to hypoxia

11641274


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-66-2766-01ASTIM1chr11

3877639

+VHLchr3

10191471

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000300737ENST00000256474STIM1chr11

3877639

+VHLchr3

10191471

+
In-frameENST00000300737ENST00000345392STIM1chr11

3877639

+VHLchr3

10191471

+
5CDS-3UTRENST00000300737ENST00000477538STIM1chr11

3877639

+VHLchr3

10191471

+
In-frameENST00000527651ENST00000256474STIM1chr11

3877639

+VHLchr3

10191471

+
In-frameENST00000527651ENST00000345392STIM1chr11

3877639

+VHLchr3

10191471

+
5CDS-3UTRENST00000527651ENST00000477538STIM1chr11

3877639

+VHLchr3

10191471

+
intron-3CDSENST00000527484ENST00000256474STIM1chr11

3877639

+VHLchr3

10191471

+
intron-3CDSENST00000527484ENST00000345392STIM1chr11

3877639

+VHLchr3

10191471

+
intron-3UTRENST00000527484ENST00000477538STIM1chr11

3877639

+VHLchr3

10191471

+
intron-3CDSENST00000533977ENST00000256474STIM1chr11

3877639

+VHLchr3

10191471

+
intron-3CDSENST00000533977ENST00000345392STIM1chr11

3877639

+VHLchr3

10191471

+
intron-3UTRENST00000533977ENST00000477538STIM1chr11

3877639

+VHLchr3

10191471

+

Top

FusionProtFeatures for STIM1_VHL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STIM1

Q13586

VHL

P40337

Plays a role in mediating store-operated Ca(2+) entry(SOCE), a Ca(2+) influx following depletion of intracellularCa(2+) stores (PubMed:15866891, PubMed:16005298, PubMed:16208375,PubMed:16537481, PubMed:16733527, PubMed:16766533,PubMed:16807233, PubMed:18854159, PubMed:19249086,PubMed:22464749, PubMed:24069340, PubMed:24351972,PubMed:24591628, PubMed:26322679, PubMed:25326555,PubMed:28219928). Acts as Ca(2+) sensor in the endoplasmicreticulum via its EF-hand domain. Upon Ca(2+) depletion,translocates from the endoplasmic reticulum to the plasma membranewhere it activates the Ca(2+) release-activated Ca(2+) (CRAC)channel subunit ORAI1 (PubMed:16208375, PubMed:16537481). Involvedin enamel formation (PubMed:24621671). Activated followinginteraction with STIMATE, leading to promote STIM1 conformationalswitch (PubMed:26322679). {ECO:0000269|PubMed:15866891,ECO:0000269|PubMed:16005298, ECO:0000269|PubMed:16208375,ECO:0000269|PubMed:16537481, ECO:0000269|PubMed:16733527,ECO:0000269|PubMed:16766533, ECO:0000269|PubMed:16807233,ECO:0000269|PubMed:18854159, ECO:0000269|PubMed:19249086,ECO:0000269|PubMed:22464749, ECO:0000269|PubMed:24069340,ECO:0000269|PubMed:24351972, ECO:0000269|PubMed:24591628,ECO:0000269|PubMed:24621671, ECO:0000269|PubMed:25326555,ECO:0000269|PubMed:26322679, ECO:0000269|PubMed:28219928}. Involved in the ubiquitination and subsequentproteasomal degradation via the von Hippel-Lindau ubiquitinationcomplex. Seems to act as a target recruitment subunit in the E3ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved intranscriptional repression through interaction with HIF1A, HIF1ANand histone deacetylases. Ubiquitinates, in an oxygen-responsivemanner, ADRB2. {ECO:0000269|PubMed:10944113,ECO:0000269|PubMed:17981124, ECO:0000269|PubMed:19584355}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+11276_8746686Calcium binding.
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112248_44246686Coiled coilOntology_term=ECO:0000269,ECO:0000269,ECO:0000269
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112270_33646686Compositional biasNote=Glu-rich
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112600_62946686Compositional biasNote=Pro/Ser-rich
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112672_68546686Compositional biasNote=Lys-rich
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112132_20046686DomainSAM
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+11263_9846686DomainNote=EF-hand
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112642_64546686MotifNote=Microtubule tip localization signal
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112334_44446686RegionNote=SOAR/CAD
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112235_68546686Topological domainCytoplasmic
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+11223_21346686Topological domainExtracellular
HgeneSTIM1chr11:3877639chr3:10191471ENST00000300737+112214_23446686TransmembraneHelical
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+13100_155154214RegionNote=Involved in binding to CCT complex
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1314_53154214RegionNote=8 X 5 AA tandem repeats of G-[PAVG]-E-E-[DAYSLE]
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+02100_155113173RegionNote=Involved in binding to CCT complex
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0214_53113173RegionNote=8 X 5 AA tandem repeats of G-[PAVG]-E-E-[DAYSLE]
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1314_18154214RepeatNote=1
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1319_23154214RepeatNote=2
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1324_28154214RepeatNote=3
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1329_33154214RepeatNote=4
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1334_38154214RepeatNote=5
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1339_43154214RepeatNote=6
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1344_48154214RepeatNote=7
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+1349_53154214RepeatNote=8
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0214_18113173RepeatNote=1
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0219_23113173RepeatNote=2
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0224_28113173RepeatNote=3
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0229_33113173RepeatNote=4
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0234_38113173RepeatNote=5
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0239_43113173RepeatNote=6
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0244_48113173RepeatNote=7
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+0249_53113173RepeatNote=8


Top

FusionGeneSequence for STIM1_VHL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STIM1_ENST00000300737_chr11_3877639_+_VHL_ENST00000256474_chr3_10191471_+_106aa
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAVTTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDL

>In-frame_STIM1_ENST00000300737_chr11_3877639_+_VHL_ENST00000345392_chr3_10191471_+_106aa
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAVTTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDL

>In-frame_STIM1_ENST00000527651_chr11_3877639_+_VHL_ENST00000256474_chr3_10191471_+_106aa
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAVTTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDL

>In-frame_STIM1_ENST00000527651_chr11_3877639_+_VHL_ENST00000345392_chr3_10191471_+_106aa
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAVTTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STIM1_ENST00000300737_chr11_3877639_+_VHL_ENST00000256474_chr3_10191471_+_318nt
ATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCAGCCATAGTCACAGTGAGAAG
GCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGC
CTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTG

>In-frame_STIM1_ENST00000300737_chr11_3877639_+_VHL_ENST00000345392_chr3_10191471_+_318nt
ATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCAGCCATAGTCACAGTGAGAAG
GCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGC
CTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTG

>In-frame_STIM1_ENST00000527651_chr11_3877639_+_VHL_ENST00000256474_chr3_10191471_+_318nt
ATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCAGCCATAGTCACAGTGAGAAG
GCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGC
CTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTG

>In-frame_STIM1_ENST00000527651_chr11_3877639_+_VHL_ENST00000345392_chr3_10191471_+_318nt
ATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCAGCCATAGTCACAGTGAGAAG
GCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGC
CTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_STIM1_ENST00000300737_chr11_3877639_+_VHL_ENST00000256474_chr3_10191471_+_3142nt
GCTGGACCTGGGCACCGCCAGCCGCCTGGGCACGGGACTGGGCGGGGGCGCTGACCTCGGCCTAGGAGGCCCAGGATCCCGGAGACGCCC
GCGCCCTCAGGACCCTGCGGGTCGCACGCCCTCCCCAGCTTCTGCTGCTCGCCGCTCTTCGGCAGGGCGAGGTCAGGTGCCCCCTTCTCG
CCTCTCTTCTCTTCTCTTCTCTTCCTCCTCCACTTCTGTGCCCGCGGAGACTCCGGCCGCCCCCTTCCGCAGGGGTGTAGTAATCTGCGG
AGCTGACAGCAGCCCCGCAGCCACCCTGCCCGAAGTCTCCGGAAGCGGCACGAGCTCAGGCCGCCGCAGCCCCGGCGGACCCACTGTTGG
ACCTGAGGAGCCAGCCCTCCTCCCGCACCCAAACTTGGAGCACTTGACCTTTGGCTGTTGGAGGGGGCAGGCTCGCGGGTGGCTGGACAG
CTGCGGAGCCGCGAGGGCATCTTGCCTGGAGACCGTCGGCTGCACTCCCGGGCTCCTGGCTTTGCCTCTGGGATCCCGAGGTGTCCACAT
CAGACGCATGTTGACTGAGACCTAGAGTCATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCC
AGAGCCTCAGCCATAGTCACAGTGAGAAGGCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGA
AAGAGCGATGCCTCCAGGTTGTCCGGAGCCTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGG
AAGACCACCCAAATGTGCAGAAAGACCTGGAGCGGCTGACACAGGAGCGCATTGCACATCAACGGATGGGAGATTGAAGATTTCTGTTGA
AACTTACACTGTTTCATCTCAGCTTTTGATGGTACTGATGAGTCTTGATCTAGATACAGGACTGGTTCCTTCCTTAGTTTCAAAGTGTCT
CATTCTCAGAGTAAAATAGGCACCATTGCTTAAAAGAAAGTTAACTGACTTCACTAGGCATTGTGATGTTTAGGGGCAAACATCACAAAA
TGTAATTTAATGCCTGCCCATTAGAGAAGTATTTATCAGGAGAAGGTGGTGGCATTTTTGCTTCCTAGTAAGTCAGGACAGCTTGTATGT
AAGGAGGTTTGTATAAGTAATTCAGTGGGAATTGCAGCATATCGTTTAATTTTAAGAAGGCATTGGCATCTGCTTTTAATGGATGTATAA
TACATCCATTCTACATCCGTAGCGGTTGGTGACTTGTCTGCCTCCTGCTTTGGGAAGACTGAGGCATCCGTGAGGCAGGGACAAGTCTTT
CTCCTCTTTGAGACCCCAGTGCCTGCACATCATGAGCCTTCAGTCAGGGTTTGTCAGAGGAACAAACCAGGGGACACTTTGTTAGAAAGT
GCTTAGAGGTTCTGCCTCTATTTTTGTTGGGGGGTGGGAGAGGGGACCTTAAAATGTGTACAGTGAACAAATGTCTTAAAGGGAATCATT
TTTGTAGGAAGCATTTTTTATAATTTTCTAAGTCGTGCACTTTCTCGGTCCACTCTTGTTGAAGTGCTGTTTTATTACTGTTTCTAAACT
AGGATTGACATTCTACAGTTGTGATAATAGCATTTTTGTAACTTGCCATCCGCACAGAAAATACGAGAAAATCTGCATGTTTGATTATAG
TATTAATGGACAAATAAGTTTTTGCTAAATGTGAGTATTTCTGTTCCTTTTTGTAAATATGTGACATTCCTGATTGATTTGGGTTTTTTT
GTTGTTGTTGTTTTGTTTTGTTTTGTTTTTTTGAGATGGAGTCTCACTCTTGTCACCCAGGCTGGAGTGCAGTGGCGCCATCTCGGCTCA
CTGCAACCTCTGCCTCCTGGGTTCACGTAATCCTCCTGAGTAGCTGGGATTACAGGCGCCTGCCACCACGCTGGCCAATTTTTGTACTTT
TAGTAGAGACAGTGTTTCGTCATGTTGGCCAGGCTGGTTTCAAACTCCTGACCTCAGGTGATCCGCCCACCTCAGCCTCCCAAAATGGTG
GGATTACAGGTGTGTGGGCCACCGTGCCTGGCTGATTCAGCATTTTTTATCAGGCAGGACCAGGTGGCACTTCCACCTCCAGCCTCTGGT
CCTACCAATGGATTCATGGAGTAGCCTGGACTGTTTCATAGTTTTCTAAATGTACAAATTCTTATAGGCTAGACTTAGATTCATTAACTC
AAATTCAATGCTTCTATCAGACTCAGTTTTTTGTAACTAATAGATTTTTTTTTCCACTTTTGTTCTACTCCTTCCCTAATAGCTTTTTAA
AAAAATCTCCCCAGTAGAGAAACATTTGGAAAAGACAGAAAACTAAAAAGGAAGAAAAAAGATCCCTATTAGATACACTTCTTAAATACA
ATCACATTAACATTTTGAGCTATTTCCTTCCAGCCTTTTTAGGGCAGATTTTGGTTGGTTTTTACATAGTTGAGATTGTACTGTTCATAC
AGTTTTATACCCTTTTTCATTTAACTTTATAACTTAAATATTGCTCTATGTTAGTATAAGCTTTTCACAAACATTAGTATAGTCTCCCTT
TTATAATTAATGTTTGTGGGTATTTCTTGGCATGCATCTTTAATTCCTTATCCTAGCCTTTGGGCACAATTCCTGTGCTCAAAAATGAGA
GTGACGGCTGGCATGGTGGCTCCCGCCTGTAATCCCAGTACTTTGGAAAGCCAAGGTAAGAGGATTGCTTGAGCCCAGAACTTCAAGATG
AGCCTGGGCTCATAGTGAGAACCCATCTATACAAAAAATTTTTAAAAATTAGCATGGCGGCACACATCTGTAATCCTAGCTACTTGGCAG
GCTGAGGTGAGAAGATCATTGGAGTTTAGGAATTGGAGGCTGCAGTGAGCCATGAGTATGCCACTGCACTCCAGCCTGGGGGACAGAGCA
AGACCCTGCCTCAAAAAAAAAAAAAAAAAAAAAATCAGGCCGGGCATGGTGGCTCACGCCTGTAATCCCAGCACTTTGGGAGGTCGAGGT

>In-frame_STIM1_ENST00000300737_chr11_3877639_+_VHL_ENST00000345392_chr3_10191471_+_3004nt
GCTGGACCTGGGCACCGCCAGCCGCCTGGGCACGGGACTGGGCGGGGGCGCTGACCTCGGCCTAGGAGGCCCAGGATCCCGGAGACGCCC
GCGCCCTCAGGACCCTGCGGGTCGCACGCCCTCCCCAGCTTCTGCTGCTCGCCGCTCTTCGGCAGGGCGAGGTCAGGTGCCCCCTTCTCG
CCTCTCTTCTCTTCTCTTCTCTTCCTCCTCCACTTCTGTGCCCGCGGAGACTCCGGCCGCCCCCTTCCGCAGGGGTGTAGTAATCTGCGG
AGCTGACAGCAGCCCCGCAGCCACCCTGCCCGAAGTCTCCGGAAGCGGCACGAGCTCAGGCCGCCGCAGCCCCGGCGGACCCACTGTTGG
ACCTGAGGAGCCAGCCCTCCTCCCGCACCCAAACTTGGAGCACTTGACCTTTGGCTGTTGGAGGGGGCAGGCTCGCGGGTGGCTGGACAG
CTGCGGAGCCGCGAGGGCATCTTGCCTGGAGACCGTCGGCTGCACTCCCGGGCTCCTGGCTTTGCCTCTGGGATCCCGAGGTGTCCACAT
CAGACGCATGTTGACTGAGACCTAGAGTCATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCC
AGAGCCTCAGCCATAGTCACAGTGAGAAGGCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGA
AAGAGCGATGCCTCCAGGTTGTCCGGAGCCTAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGG
AAGACCACCCAAATGTGCAGAAAGACCTGGAGCGGCTGACACAGGAGCGCATTGCACATCAACGGATGGGAGATTGAAGATTTCTGTTGA
AACTTACACTGTTTCATCTCAGCTTTTGATGGTACTGATGAGTCTTGATCTAGATACAGGACTGGTTCCTTCCTTAGTTTCAAAGTGTCT
CATTCTCAGAGTAAAATAGGCACCATTGCTTAAAAGAAAGTTAACTGACTTCACTAGGCATTGTGATGTTTAGGGGCAAACATCACAAAA
TGTAATTTAATGCCTGCCCATTAGAGAAGTATTTATCAGGAGAAGGTGGTGGCATTTTTGCTTCCTAGTAAGTCAGGACAGCTTGTATGT
AAGGAGGTTTGTATAAGTAATTCAGTGGGAATTGCAGCATATCGTTTAATTTTAAGAAGGCATTGGCATCTGCTTTTAATGGATGTATAA
TACATCCATTCTACATCCGTAGCGGTTGGTGACTTGTCTGCCTCCTGCTTTGGGAAGACTGAGGCATCCGTGAGGCAGGGACAAGTCTTT
CTCCTCTTTGAGACCCCAGTGCCTGCACATCATGAGCCTTCAGTCAGGGTTTGTCAGAGGAACAAACCAGGGGACACTTTGTTAGAAAGT
GCTTAGAGGTTCTGCCTCTATTTTTGTTGGGGGGTGGGAGAGGGGACCTTAAAATGTGTACAGTGAACAAATGTCTTAAAGGGAATCATT
TTTGTAGGAAGCATTTTTTATAATTTTCTAAGTCGTGCACTTTCTCGGTCCACTCTTGTTGAAGTGCTGTTTTATTACTGTTTCTAAACT
AGGATTGACATTCTACAGTTGTGATAATAGCATTTTTGTAACTTGCCATCCGCACAGAAAATACGAGAAAATCTGCATGTTTGATTATAG
TATTAATGGACAAATAAGTTTTTGCTAAATGTGAGTATTTCTGTTCCTTTTTGTAAATATGTGACATTCCTGATTGATTTGGGTTTTTTT
GTTGTTGTTGTTTTGTTTTGTTTTGTTTTTTTGAGATGGAGTCTCACTCTTGTCACCCAGGCTGGAGTGCAGTGGCGCCATCTCGGCTCA
CTGCAACCTCTGCCTCCTGGGTTCACGTAATCCTCCTGAGTAGCTGGGATTACAGGCGCCTGCCACCACGCTGGCCAATTTTTGTACTTT
TAGTAGAGACAGTGTTTCGTCATGTTGGCCAGGCTGGTTTCAAACTCCTGACCTCAGGTGATCCGCCCACCTCAGCCTCCCAAAATGGTG
GGATTACAGGTGTGTGGGCCACCGTGCCTGGCTGATTCAGCATTTTTTATCAGGCAGGACCAGGTGGCACTTCCACCTCCAGCCTCTGGT
CCTACCAATGGATTCATGGAGTAGCCTGGACTGTTTCATAGTTTTCTAAATGTACAAATTCTTATAGGCTAGACTTAGATTCATTAACTC
AAATTCAATGCTTCTATCAGACTCAGTTTTTTGTAACTAATAGATTTTTTTTTCCACTTTTGTTCTACTCCTTCCCTAATAGCTTTTTAA
AAAAATCTCCCCAGTAGAGAAACATTTGGAAAAGACAGAAAACTAAAAAGGAAGAAAAAAGATCCCTATTAGATACACTTCTTAAATACA
ATCACATTAACATTTTGAGCTATTTCCTTCCAGCCTTTTTAGGGCAGATTTTGGTTGGTTTTTACATAGTTGAGATTGTACTGTTCATAC
AGTTTTATACCCTTTTTCATTTAACTTTATAACTTAAATATTGCTCTATGTTAGTATAAGCTTTTCACAAACATTAGTATAGTCTCCCTT
TTATAATTAATGTTTGTGGGTATTTCTTGGCATGCATCTTTAATTCCTTATCCTAGCCTTTGGGCACAATTCCTGTGCTCAAAAATGAGA
GTGACGGCTGGCATGGTGGCTCCCGCCTGTAATCCCAGTACTTTGGAAAGCCAAGGTAAGAGGATTGCTTGAGCCCAGAACTTCAAGATG
AGCCTGGGCTCATAGTGAGAACCCATCTATACAAAAAATTTTTAAAAATTAGCATGGCGGCACACATCTGTAATCCTAGCTACTTGGCAG
GCTGAGGTGAGAAGATCATTGGAGTTTAGGAATTGGAGGCTGCAGTGAGCCATGAGTATGCCACTGCACTCCAGCCTGGGGGACAGAGCA

>In-frame_STIM1_ENST00000527651_chr11_3877639_+_VHL_ENST00000256474_chr3_10191471_+_2662nt
GACCGTCGGCTGCACTCCCGGGCTCCTGGCTTTGCCTCTGGGATCCCGAGGTGTCCACATCAGACGCATGTTGACTGAGACCTAGAGTCA
TGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCAGCCATAGTCACAGTGAGAAGG
CGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGCC
TAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTGG
AGCGGCTGACACAGGAGCGCATTGCACATCAACGGATGGGAGATTGAAGATTTCTGTTGAAACTTACACTGTTTCATCTCAGCTTTTGAT
GGTACTGATGAGTCTTGATCTAGATACAGGACTGGTTCCTTCCTTAGTTTCAAAGTGTCTCATTCTCAGAGTAAAATAGGCACCATTGCT
TAAAAGAAAGTTAACTGACTTCACTAGGCATTGTGATGTTTAGGGGCAAACATCACAAAATGTAATTTAATGCCTGCCCATTAGAGAAGT
ATTTATCAGGAGAAGGTGGTGGCATTTTTGCTTCCTAGTAAGTCAGGACAGCTTGTATGTAAGGAGGTTTGTATAAGTAATTCAGTGGGA
ATTGCAGCATATCGTTTAATTTTAAGAAGGCATTGGCATCTGCTTTTAATGGATGTATAATACATCCATTCTACATCCGTAGCGGTTGGT
GACTTGTCTGCCTCCTGCTTTGGGAAGACTGAGGCATCCGTGAGGCAGGGACAAGTCTTTCTCCTCTTTGAGACCCCAGTGCCTGCACAT
CATGAGCCTTCAGTCAGGGTTTGTCAGAGGAACAAACCAGGGGACACTTTGTTAGAAAGTGCTTAGAGGTTCTGCCTCTATTTTTGTTGG
GGGGTGGGAGAGGGGACCTTAAAATGTGTACAGTGAACAAATGTCTTAAAGGGAATCATTTTTGTAGGAAGCATTTTTTATAATTTTCTA
AGTCGTGCACTTTCTCGGTCCACTCTTGTTGAAGTGCTGTTTTATTACTGTTTCTAAACTAGGATTGACATTCTACAGTTGTGATAATAG
CATTTTTGTAACTTGCCATCCGCACAGAAAATACGAGAAAATCTGCATGTTTGATTATAGTATTAATGGACAAATAAGTTTTTGCTAAAT
GTGAGTATTTCTGTTCCTTTTTGTAAATATGTGACATTCCTGATTGATTTGGGTTTTTTTGTTGTTGTTGTTTTGTTTTGTTTTGTTTTT
TTGAGATGGAGTCTCACTCTTGTCACCCAGGCTGGAGTGCAGTGGCGCCATCTCGGCTCACTGCAACCTCTGCCTCCTGGGTTCACGTAA
TCCTCCTGAGTAGCTGGGATTACAGGCGCCTGCCACCACGCTGGCCAATTTTTGTACTTTTAGTAGAGACAGTGTTTCGTCATGTTGGCC
AGGCTGGTTTCAAACTCCTGACCTCAGGTGATCCGCCCACCTCAGCCTCCCAAAATGGTGGGATTACAGGTGTGTGGGCCACCGTGCCTG
GCTGATTCAGCATTTTTTATCAGGCAGGACCAGGTGGCACTTCCACCTCCAGCCTCTGGTCCTACCAATGGATTCATGGAGTAGCCTGGA
CTGTTTCATAGTTTTCTAAATGTACAAATTCTTATAGGCTAGACTTAGATTCATTAACTCAAATTCAATGCTTCTATCAGACTCAGTTTT
TTGTAACTAATAGATTTTTTTTTCCACTTTTGTTCTACTCCTTCCCTAATAGCTTTTTAAAAAAATCTCCCCAGTAGAGAAACATTTGGA
AAAGACAGAAAACTAAAAAGGAAGAAAAAAGATCCCTATTAGATACACTTCTTAAATACAATCACATTAACATTTTGAGCTATTTCCTTC
CAGCCTTTTTAGGGCAGATTTTGGTTGGTTTTTACATAGTTGAGATTGTACTGTTCATACAGTTTTATACCCTTTTTCATTTAACTTTAT
AACTTAAATATTGCTCTATGTTAGTATAAGCTTTTCACAAACATTAGTATAGTCTCCCTTTTATAATTAATGTTTGTGGGTATTTCTTGG
CATGCATCTTTAATTCCTTATCCTAGCCTTTGGGCACAATTCCTGTGCTCAAAAATGAGAGTGACGGCTGGCATGGTGGCTCCCGCCTGT
AATCCCAGTACTTTGGAAAGCCAAGGTAAGAGGATTGCTTGAGCCCAGAACTTCAAGATGAGCCTGGGCTCATAGTGAGAACCCATCTAT
ACAAAAAATTTTTAAAAATTAGCATGGCGGCACACATCTGTAATCCTAGCTACTTGGCAGGCTGAGGTGAGAAGATCATTGGAGTTTAGG
AATTGGAGGCTGCAGTGAGCCATGAGTATGCCACTGCACTCCAGCCTGGGGGACAGAGCAAGACCCTGCCTCAAAAAAAAAAAAAAAAAA
AAAATCAGGCCGGGCATGGTGGCTCACGCCTGTAATCCCAGCACTTTGGGAGGTCGAGGTGGGCAGATCACCTGAGGTCAGGAGTTCGAG

>In-frame_STIM1_ENST00000527651_chr11_3877639_+_VHL_ENST00000345392_chr3_10191471_+_2524nt
GACCGTCGGCTGCACTCCCGGGCTCCTGGCTTTGCCTCTGGGATCCCGAGGTGTCCACATCAGACGCATGTTGACTGAGACCTAGAGTCA
TGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCAGCCATAGTCACAGTGAGAAGG
CGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGTGTATACTCTGAAAGAGCGATGCCTCCAGGTTGTCCGGAGCC
TAGTCAAGCCTGAGAATTACAGGAGACTGGACATCGTCAGGTCGCTCTACGAAGATCTGGAAGACCACCCAAATGTGCAGAAAGACCTGG
AGCGGCTGACACAGGAGCGCATTGCACATCAACGGATGGGAGATTGAAGATTTCTGTTGAAACTTACACTGTTTCATCTCAGCTTTTGAT
GGTACTGATGAGTCTTGATCTAGATACAGGACTGGTTCCTTCCTTAGTTTCAAAGTGTCTCATTCTCAGAGTAAAATAGGCACCATTGCT
TAAAAGAAAGTTAACTGACTTCACTAGGCATTGTGATGTTTAGGGGCAAACATCACAAAATGTAATTTAATGCCTGCCCATTAGAGAAGT
ATTTATCAGGAGAAGGTGGTGGCATTTTTGCTTCCTAGTAAGTCAGGACAGCTTGTATGTAAGGAGGTTTGTATAAGTAATTCAGTGGGA
ATTGCAGCATATCGTTTAATTTTAAGAAGGCATTGGCATCTGCTTTTAATGGATGTATAATACATCCATTCTACATCCGTAGCGGTTGGT
GACTTGTCTGCCTCCTGCTTTGGGAAGACTGAGGCATCCGTGAGGCAGGGACAAGTCTTTCTCCTCTTTGAGACCCCAGTGCCTGCACAT
CATGAGCCTTCAGTCAGGGTTTGTCAGAGGAACAAACCAGGGGACACTTTGTTAGAAAGTGCTTAGAGGTTCTGCCTCTATTTTTGTTGG
GGGGTGGGAGAGGGGACCTTAAAATGTGTACAGTGAACAAATGTCTTAAAGGGAATCATTTTTGTAGGAAGCATTTTTTATAATTTTCTA
AGTCGTGCACTTTCTCGGTCCACTCTTGTTGAAGTGCTGTTTTATTACTGTTTCTAAACTAGGATTGACATTCTACAGTTGTGATAATAG
CATTTTTGTAACTTGCCATCCGCACAGAAAATACGAGAAAATCTGCATGTTTGATTATAGTATTAATGGACAAATAAGTTTTTGCTAAAT
GTGAGTATTTCTGTTCCTTTTTGTAAATATGTGACATTCCTGATTGATTTGGGTTTTTTTGTTGTTGTTGTTTTGTTTTGTTTTGTTTTT
TTGAGATGGAGTCTCACTCTTGTCACCCAGGCTGGAGTGCAGTGGCGCCATCTCGGCTCACTGCAACCTCTGCCTCCTGGGTTCACGTAA
TCCTCCTGAGTAGCTGGGATTACAGGCGCCTGCCACCACGCTGGCCAATTTTTGTACTTTTAGTAGAGACAGTGTTTCGTCATGTTGGCC
AGGCTGGTTTCAAACTCCTGACCTCAGGTGATCCGCCCACCTCAGCCTCCCAAAATGGTGGGATTACAGGTGTGTGGGCCACCGTGCCTG
GCTGATTCAGCATTTTTTATCAGGCAGGACCAGGTGGCACTTCCACCTCCAGCCTCTGGTCCTACCAATGGATTCATGGAGTAGCCTGGA
CTGTTTCATAGTTTTCTAAATGTACAAATTCTTATAGGCTAGACTTAGATTCATTAACTCAAATTCAATGCTTCTATCAGACTCAGTTTT
TTGTAACTAATAGATTTTTTTTTCCACTTTTGTTCTACTCCTTCCCTAATAGCTTTTTAAAAAAATCTCCCCAGTAGAGAAACATTTGGA
AAAGACAGAAAACTAAAAAGGAAGAAAAAAGATCCCTATTAGATACACTTCTTAAATACAATCACATTAACATTTTGAGCTATTTCCTTC
CAGCCTTTTTAGGGCAGATTTTGGTTGGTTTTTACATAGTTGAGATTGTACTGTTCATACAGTTTTATACCCTTTTTCATTTAACTTTAT
AACTTAAATATTGCTCTATGTTAGTATAAGCTTTTCACAAACATTAGTATAGTCTCCCTTTTATAATTAATGTTTGTGGGTATTTCTTGG
CATGCATCTTTAATTCCTTATCCTAGCCTTTGGGCACAATTCCTGTGCTCAAAAATGAGAGTGACGGCTGGCATGGTGGCTCCCGCCTGT
AATCCCAGTACTTTGGAAAGCCAAGGTAAGAGGATTGCTTGAGCCCAGAACTTCAAGATGAGCCTGGGCTCATAGTGAGAACCCATCTAT
ACAAAAAATTTTTAAAAATTAGCATGGCGGCACACATCTGTAATCCTAGCTACTTGGCAGGCTGAGGTGAGAAGATCATTGGAGTTTAGG
AATTGGAGGCTGCAGTGAGCCATGAGTATGCCACTGCACTCCAGCCTGGGGGACAGAGCAAGACCCTGCCTCAAAAAAAAAAAAAAAAAA


Top

FusionGenePPI for STIM1_VHL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STIM1STIM2, PRKAA2, SEPT11, S100A16, SEC22B, CAT, SF1, MAPRE1, HLA-DRA, METTL6, GABRE, IFNA14, HEXB, TCTN2, TCTN3, EVC2, TMEM17, TMEM216, CDH1, PTPRN2, CCDC40, HAUS1, LRRTM1, IL17RB, SLC39A9, CD1E, EXOC5VHLFLNA, VBP1, JADE1, CUL2, CAB39, TGFB1I1, STK16, PFAS, TCEB1, PSMB1, TCEB2, RHOC, CNTF, TXN, APRT, CDK2, PKD1L3, FSCN1, IARS, PSMB3, RASGRP1, RAB1B, RBX1, NEDD8, TAGLN2, MOB4, CCDC59, JMJD1C, CDO1, PAPSS2, HIST1H2BC, CCDC82, PSMD13, TARS, TPT1, RPA3, KNTC1, MCC, PCMT1, CSTB, CSTF3, HAS1, RPS9, IMPDH2, ATXN2, CHMP2B, MYL12A, PPIB, PIN1, PSMC3, HIF1A, ZNF197, TRIM28, HIF1AN, HDAC1, HDAC2, HDAC3, FN1, CUL5, HNRNPA2B1, USP33, RIT1, NR4A1, POLR2A, SAP130, EPAS1, OSR1, DGKZ, SAT2, CYBA, DNAJA3, IREB2, TP53, EP300, KAT2B, ATM, USP20, TCEB3, POLR2G, HIF3A, CCT3, MCM7, PRKCI, DVL2, MYBBP1A, UBXN7, ADRB2, SPRY2, ANKRD40, CDKN2A, STUB1, CMC2, DDX17, DDX3X, DDX3Y, DDX5, DNAJA1, DNAJA2, EPHA4, GRWD1, COLGALT1, HNRNPDL, HNRNPH1, HNRNPH2, HNRNPLL, HNRNPC, HNRNPD, HNRNPL, HNRNPM, HNRNPR, EIF5A, EIF5A2, NKRF, RALYL, RBBP4, RBBP7, RPL12, RPL14, RPL18A, HNRNPA3, RPS11, RPS14, RPS17, RPS27L, RPS27, RPS2, RPS3A, RPS3, RPSA, SNRNP70, TUBA1A, TUBA3C, TUBA3E, TUBA4A, TCP1, CCT2, CCT4, CCT5, CCT7, CCT8, CCT6A, TRAFD1, UBR5, PRMT3, ACTB, BSG, COL4A1, COL4A2, COL4A3, COL4A5, COL4A6, COL6A1, CRTAP, FASTKD3, GRN, HNRNPK, HNRNPU, HSPA8, MIF, IVNS1ABP, P3H1, PARP1, PLOD2, PLOD3, PPM1B, RPL10A, RPL30, RPL7A, RPLP0, HNRNPA1, HNRNPAB, RPS15A, RPS5, STK38, TUBA3D, TUBB4B, VHL, XRCC5, SKP2, CLU, ELAVL1, MYC, PIAS4, TOP2A, CBX5, BCL2L11, CSNK2A1, PRKCD, JAK2, SOCS1, SOCS3, LIMD1, EGLN1, AJUBA, WTIP, LPP, ZYX, COPS5, GNB2L1, PRKCH, PRKCZ, DGKI, KIF2C, SARNP, CAPN7, YY1AP1, RBPMS2, RB1CC1, FKBP8, PTPN14, EXOSC8, KIF3A, KIF3B, KIFAP3, HSPA1A, PARD6A, PARD3, KLF4, SP1, CARD9, RNF7, MKNK2, UBE2D1, ALAS1, CDC34, APP, DCUN1D1, TGM2, FZR1, PCGF2, ZNF512B, CHEK2, KAT5, RPS6, NOB1, RPL11, LTV1, PRMT1, MSH4, UXT, AR, SON, EEF1B2, RPL21, RBPMS, VAPB, NCL, SLC2A1, CD44, SLC3A2, HIST4H4, CBR1, HIST1H1C, CAPZB, HIST1H2BL, LANCL1, HSPA5, PRDX1, RPL5, CBX1, CBX3, PRMT8, ILF3, PDCD5, PARK7, AURKA, GLI1, E2F1, SIRT1, HSPA4, HSP90AA1, MDFI, PLD1, UBC, UBE2D2, C1QB, C1QTNF2, CER1, KIRREL2, BCL2L14, COL9A1, KNG1, ASTL, RWDD3, GOLGA4, TRIP12, ZNF350, ID2, ID1, ID3, PLD2, TARDBP, GPLD1, CERKL, EPOR, DACT1, DACT2, RHOBTB3, UBE2S, HUWE1, USP9X, SMURF1, MAP3K1, PRKDC, CDK4, TSC1, CHEK1, APC, CDKN1B, KDM5C, ARID2, PTEN, PDGFRA, BRAF, RRM2, ARID1A, MAP2K1, PIK3R1, FGFR3, SMARCB1, CDK6, ROR1, CASP8, PBRM1, RPS6KB1, FLT3, VEGFA, SQSTM1, CEP68, ATF7IP, SETDB1, ARL14EP, OXT, AVP, CHIT1, INHBE, C1QL4, UTRN, ACTBL2, FAM19A3, AKT1, AKT2, PPP2CA, FASN, CAD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneVHLchr11:3877639chr3:10191471ENST00000256474+13157_166154214Elongin BC complex
TgeneVHLchr11:3877639chr3:10191471ENST00000345392+02157_166113173Elongin BC complex


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STIM1_VHL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STIM1_VHL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSTIM1C1861451Stormorken Syndrome4ORPHANET;UNIPROT
HgeneSTIM1C4011726MYOPATHY, TUBULAR AGGREGATE, 14UNIPROT
HgeneSTIM1C0020538Hypertensive disease1CTD_human
HgeneSTIM1C2748557Immune dysfunction with T-cell inactivation due to calcium entry defect 21CTD_human;ORPHANET;UNIPROT
HgeneSTIM1C3495559Juvenile arthritis1CTD_human
TgeneVHLC0019562Von Hippel-Lindau Syndrome17CTD_human;ORPHANET;UNIPROT
TgeneVHLC0007134Renal Cell Carcinoma9CTD_human;HPO
TgeneVHLC0031511Pheochromocytoma9CTD_human;HPO;UNIPROT
TgeneVHLC1837915ERYTHROCYTOSIS, FAMILIAL, 25CTD_human;ORPHANET;UNIPROT
TgeneVHLC0001430Adenoma1CTD_human
TgeneVHLC0022665Kidney Neoplasm1CTD_human
TgeneVHLC0024121Lung Neoplasms1CTD_human
TgeneVHLC0027708Nephroblastoma1CTD_human
TgeneVHLC0279702Conventional (Clear Cell) Renal Cell Carcinoma1UNIPROT