FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36426

FusionGeneSummary for STAU2_PAWR

check button Fusion gene summary
Fusion gene informationFusion gene name: STAU2_PAWR
Fusion gene ID: 36426
HgeneTgene
Gene symbol

STAU2

PAWR

Gene ID

27067

5074

Gene namestaufen double-stranded RNA binding protein 2pro-apoptotic WT1 regulator
Synonyms39K2|39K3PAR4|Par-4
Cytomap

8q21.11

12q21.2

Type of geneprotein-codingprotein-coding
Descriptiondouble-stranded RNA-binding protein Staufen homolog 2staufen homolog 2staufen, RNA binding protein, homolog 2PRKC apoptosis WT1 regulator proteinPRKC, apoptosis, WT1, regulatorWT1-interacting proteinprostate apoptosis response protein 4prostate apoptosis response protein PAR-4prostate apoptosis response-4transcriptional repressor PAR4
Modification date2018051920180523
UniProtAcc

Q9NUL3

Q96IZ0

Ensembl transtripts involved in fusion geneENST00000522695, ENST00000524300, 
ENST00000523558, ENST00000521210, 
ENST00000355780, ENST00000519961, 
ENST00000521727, ENST00000521451, 
ENST00000522509, ENST00000517542, 
ENST00000524104, ENST00000522962, 
ENST00000521419, 
ENST00000328827, 
ENST00000547571, 
Fusion gene scores* DoF score11 X 8 X 9=7928 X 6 X 5=240
# samples 138
** MAII scorelog2(13/792*10)=-2.60698880705116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/240*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STAU2 [Title/Abstract] AND PAWR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-29-1702-01ASTAU2chr8

74650519

-PAWRchr12

80014987

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000522695ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5CDS-intronENST00000522695ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-3CDSENST00000524300ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-intronENST00000524300ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-3CDSENST00000523558ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-intronENST00000523558ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-3CDSENST00000521210ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-intronENST00000521210ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
Frame-shitENST00000355780ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5CDS-intronENST00000355780ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-3CDSENST00000519961ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-intronENST00000519961ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-3CDSENST00000521727ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-intronENST00000521727ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-3CDSENST00000521451ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-intronENST00000521451ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
Frame-shitENST00000522509ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5CDS-intronENST00000522509ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-3CDSENST00000517542ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
intron-intronENST00000517542ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
Frame-shitENST00000524104ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5CDS-intronENST00000524104ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-3CDSENST00000522962ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-intronENST00000522962ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-3CDSENST00000521419ENST00000328827STAU2chr8

74650519

-PAWRchr12

80014987

-
5UTR-intronENST00000521419ENST00000547571STAU2chr8

74650519

-PAWRchr12

80014987

-

Top

FusionProtFeatures for STAU2_PAWR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STAU2

Q9NUL3

PAWR

Q96IZ0

Pro-apoptopic protein capable of selectively inducingapoptosis in cancer cells, sensitizing the cells to diverseapoptotic stimuli and causing regression of tumors in animalmodels. Induces apoptosis in certain cancer cells by activation ofthe Fas prodeath pathway and coparallel inhibition of NF-kappa-Btranscriptional activity. Inhibits the transcriptional activationand augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction withWT1. Seems also to be a transcriptional repressor by itself. Maybe directly involved in regulating the amyloid precursor protein(APP) cleavage activity of BACE1. {ECO:0000269|PubMed:11585763}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePAWRchr8:74650519chr12:80014987ENST00000328827-17186_206172341Coiled coilOntology_term=ECO:0000255
TgenePAWRchr8:74650519chr12:80014987ENST00000328827-17300_340172341RegionNote=Leucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-36207_2746106DomainDRBM 3
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-36307_3756106DomainDRBM 4
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-368_756106DomainDRBM 1
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-3695_1816106DomainDRBM 2
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-36273_2916106MotifNuclear localization signal 1
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-36373_4126106MotifNuclear localization signal 2
HgeneSTAU2chr8:74650519chr12:80014987ENST00000524104-36381_5706106RegionRequired for dendritic transport
TgenePAWRchr8:74650519chr12:80014987ENST00000328827-1749_120172341Compositional biasNote=Ala-rich
TgenePAWRchr8:74650519chr12:80014987ENST00000328827-17145_161172341MotifNuclear localization signal
TgenePAWRchr8:74650519chr12:80014987ENST00000328827-1768_72172341MotifB30.2/SPRY domain-binding motif
TgenePAWRchr8:74650519chr12:80014987ENST00000328827-17145_203172341RegionNote=Selective for apoptosis induction in cancer cells (SAC)


Top

FusionGeneSequence for STAU2_PAWR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STAU2_ENST00000522695_chr8_74650519_-_PAWR_ENST00000328827_chr12_80014987_-_175aa
MLQINQCLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STAU2_ENST00000522695_chr8_74650519_-_PAWR_ENST00000328827_chr12_80014987_-_525nt
ATGCTTCAAATAAATCAGTGCTTAGATGAGTACGAAGATGATGAAGCAGGGCAGAAAGAGCGGAAACGAGAAGATGCAATTACACAACAG
AACACTATTCAGAATGAAGCTGTAAACTTACTAGATCCAGGCAGTTCCTATCTGCTACAGGAGCCACCTAGAACAGTTTCAGGCAGATAT
AAAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTTCCCTAGATATAACAGGGATGCA
AATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGTAGTAAGAGAAAGACAAGAAAAC
CTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTTATTAAATAGAGACCTAGATGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_STAU2_ENST00000522695_chr8_74650519_-_PAWR_ENST00000328827_chr12_80014987_-_8284nt
AGCAGTTTGGTCAATATTGTCTTAACATGCTTCAAATAAATCAGTGCTTAGATGAGTACGAAGATGATGAAGCAGGGCAGAAAGAGCGGA
AACGAGAAGATGCAATTACACAACAGAACACTATTCAGAATGAAGCTGTAAACTTACTAGATCCAGGCAGTTCCTATCTGCTACAGGAGC
CACCTAGAACAGTTTCAGGCAGATATAAAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTG
GGTTCCCTAGATATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGG
AAGTAGTAAGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTG
ATTTATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGC
TGACCAGGTAGAGGATTCAAGACTCAATGTGGAAAAAATATTTTAAACTACTGATTGAATGTTAATGGTCAATGCTAGCACAATATTCCT
ATGCTGCAATACATTAAAATAACTAAGCAAGTATATTTATTTCTAGCAAACAGATGTTTGTTTTCAAAATACTTCTTTTTCATTATTGGT
TTTAAAAAAGCATTATCCTTTTATCTCACAAATAAGTAATATCTTTCAGTTATTAAATGATAGATAATGCCTTTTTGGTTTTGTGTGGTA
TTCAACTAATACATGGTTTAAAGTCACAGCCGTTTGAATATATTTTATCTTGGTAGTACATTTTCTCCCTTAGGAATATACATAGTCTTT
GTTTACATGAGTTCAAATACTTTTGGGATGTTACCTTCACATGTCCTATTACTGATGTGTGCAACCTTTTATGTGTTGATGACTCACTCA
TAAAGGTTTTTGTCTACTGTCATTTGTTCTTTCCACTTATTCTAAGCATTTAGAGTAATAGAGTCATACTTTTTTATAACAGCAACCTTT
TAAAAGGAAAGCTCTTATAAAGTCACTGTCATGTTTTAGTTGACTAAATATAAATTTAAGAGAATACTTGAATTGTGCTATAGTAAATAA
AAATTTACTATTTTGTGTTTGAATATTGAAAAATTGAATCACTTTAACTCCTGAAAAACATACAATTGTAATTTCAATGTAAAATTTCTT
ATGTAGGTACTACCTTTTTTTATCGTTCCAAGGTTTGCTAGTGAACACAGGATATTTTAAAAGTTTTTTATTCTTCGGGCCTGGAAAGTG
TACAAAGTCAGTGTAGGAGAAAAAAATCCATATTTTTATATTAGCATGCACACTAAAAACCAAAATATTATTCATACTTAAAACATTCAT
ACAAAACAATATGTAAGCAGAAATAGTACTAAAATACTTTGCCTAATTTCTAAGTTGAAGAATAACACTGGGACACAGTTTTTTCATATG
AGAGAATATTCCGCTATTTCAAATTTAAGGGATTTTCTTCCTAACATTGAAATTTTAAAAACAGAGTTACTTCTAAATAATTATACAGAT
TTTTTCTTCTATTAAATATTATTATTTAGAATTGTTTTTGTATTACATATTCATGTTAAGAACCCCGTCTTCCCTTAAAATACATTAAAA
TTATGACATTTTTGCTTTGTGATTGAATTTCAAATAGCAGTATGGTATCCTTTTATCTAGTTAATATATGAAAGTGGCTTGAATATAGTC
AAATCCATTTTAGGTACTCTACTGACTTTTTCCTTCACTTGCCAAGCCCTTTTATTGTTCACTGTTAGAAAAATAGAGAAGGTGAGACAG
CTGGGGGAAAATGTGGAGTAAATGATAATCAAATGTTGAATTCTAAAAGTCTCTACATTTACCTAGGTTGGCTTTCTCCCCCAGTTCAGA
AGTTTCCAGCTTGGCCAATCATCAGAATCACTTGAGGAACTTAGAAAGAACTCCCTGGCTGTAGCTCCTATGTAGGTTTAGGTTGAGACT
CTGGATTCCACAATTTTTAAAGGTTACCATCTGAGGTTTCTGATCATAGTCTACTTTTGAAGCAGCTGCTGCTGTTTCTTTATTCCATTG
AACACCCTGGAATTGACATAATTTTATCTATCAGCATTTCTCCCCTTTTAGTTTATTTAATAATTAACCCGGTCTCCAGGGCAGTTTTCA
TATGACCATGTGTATATTCACTGCTCACGAAAAAGTTTAATGTTAGATTACCAAATTTAATATAGTTACAGAATTACTGCATAAGGGCTT
CCCTTCTTGGAGACTCTTACCCAGCATGGGAACAGTGATCTGCCCACATGACAGGGTGGTATGCCAGGCATAGTTAACTGCTTTTGGTTG
TGAGGTACTCATCTTCCTTTAGTTACCCTTAGTTATGTGGCACACATGTCCTTATTGCCTAGTTCGTCATCCACACTTTGGATCTTGTGA
AAATGCTGTTAGTATCCAACCTTAAAATATATTAGTATATGGGTTTTTATTAAAAGAATTACTTTGAATTTTCTATTTAATTCATATGTA
AATAAAGGAACATTTCATTTCACTTAAAAAAATTATATCAGTTATTAGGCTGGGTGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGG
AGGCCAAGGCGGGTGGATTACCAGAGTTCGGGAGTTTGAGACCAGCTTGACCAACATGGAGAAACCCCGTCTCTACTAAAAATACAAAAT
TAGCCAGGTGTGGTGGCGCATGCCTGTAATCCTGGCTACTCAGGAGGCTGAGGCAGGAGAATCGCTTGAAAACCCAGGAGACAGAGGTTG
CGGTGAGCTGAGATTGCGCCATTGTACTCCAGCCTGGGCAAGAAGAGCGAAACTCTGTCTCCAAAAAAAAAAAAAAAAAAATTATTAATA
CTTTTAAAGACTGAGCTGTTTAAGAATTTTTTGGGGAACATTTCTAGCAGTGATTTTTTTGGCCTTTAATGATAGCGTAAAGACAGGAGC
CTTACAACTTAGGCAAAGCATTTCACATGCAGTCCTTCTTCCATCTCAAAATATGTACTTATTTTACATACAGAATTTTACACTAACCAT
TGAAAAATAAAGTAGGATCTGCTACAGTTTCACCTGAAAATTTATAAAAAGTGTTGAGATTGGTAGAAGGTAGTTTTTAAGTACATGTGC
ACTACCCTAAAAGACTTGTCTATTGTCAATAAAGTGTTAGTATTTGTGAAATTATTATTCCTGTTCAGAAATACTATTTCTTAAATCTCC
TGGGAATTTGTGGCATAATAAAGCACATTCAAAGTTCTAATGTATTTATGAGCTCATTTTCAAAATAGTAAGTTTGTCATCTTTAAAATG
AACATGACTTGCCTCCTTGATTTCTGAAATGAATTAATTGAAGATTGCTATAGTAATCTTTATTTCATCTTTCTAGAGTTGTTGACAATT
TTATTATACAACAGTTACCATTAGAGAAGGAGGGAAGGGCTTTTGGGTGTGTATTTATAGGTACTAAGGGATTTACTAAATATAGTAGAT
TAGCACTGTCACACTTGTTCAAGTAGTTTCAAACATAGAAAATTAAGTATCAGGTATGTGGAGCAATGTAGTTTTTTTTTTTCTTCAGTT
TAAAAAATTTTTAATTGTGGTAGAAGCAATGTATTCTTAAGGTGAAAAACCTACCTCGGTTACATGTGGTTTGTGTTTTTTGGATTAATC
TGGATTTTATAATTAGAAATAAAAATGTAAGATTTTGAATCCACTTAATTTCTTGAAAATAGTACAAGTCAGTGTAATAGAGAAGCATTC
ATATATTCAACACTGTAAGACAAAACAGCAGAGACCTTGGATTTGATAATTGATCTGATATCCTGGACAGTATTCATATGTACAGTGATA
GGTATCTTTCTTTGGAGTTTTTTTTTTGTGCATATGTGTATAGTTTTATGGGTTCTGAGTTGGTGACCAGTAAGTTGCATGTAGTGCTGG
CACTTACTTAATAACTATTCATGATATTGTTAATAACTTGTTATAGGATTGTATTCCCAATTACAGTCTCTAAGATTGTAATTGATATTA
TCTGAGAGGTAGTGTGACAACTTTCTTTTGTTGTTACATTAAGCCGAAAACATAATACTAATAGACAACTAACAGTTTGCTTATCAGGCA
CATCAACTAAGGCACCTCCCCCCATGCTAAGTTTCTCCTGGATATATGGAAGTTGATTGTTTCCCAGTTTAAAAACTTGAACTAATATCT
CCTAAGAAAATCTGAGTCCATATTGTTTTTATTTTACTTAGCTAGAATCTCATAGCATGTTAAAGTCATATCCTTATCCCCACTAAAAAT
AACTATGTCTATGTGAGAGGAATATAGTATGTGGGAGCTGTATTAAATACTATTACAGGTGTTACAGAATCTTTAAATAAATGGACATGG
ACCAACTTTCCATCTAGTAGTGTACGATCTATATAGTGCATGTCAGTAGCACAAAATGCAGTCTTAGCATTAGCCTGTCTAATCTGAATA
GTTTACTCAAAAGTACTTCTTTGTGTTAAGTATTCAGCCACTGTTTTTAGATCTAGTTAATAGGTTCTATTTAATTTGCTACAACATTTA
CTGAATGGTGGAGTGAAAAAACTGATGCATACTGGGAAATATCTACCATTTTTTAAAGATAATGTTAATTAGGAAAAGAACACTTTTAAG
GAATTTATAGCAGTGATGAAATGAATTCAGTTATATCAGATACACCAAACTGTTGATGGTATTTAAATGTGACTTCAAGTTAGTATTTCT
GTATATATTATTGATTACTGGTTTGTTTTTAGATATGTAAGTCTGTTCTAATCTACAGTTCACATATCGACAGTTACTCTGGTAATAATA
GAATGTTAGTGATGATCACTTGGTGGATGTTGATTAAGTGCCTGTGTTTTGTTTCCTCCTCTGGATACCAAATAGGTGTATGCTACTTTT
TTGGTGAACTTATTTCTTGGAAGATTTGGCTATGCTATTCAGGGTTTTTATTCTTATGTTTTTCTTCTAAATTTAAGTAGCATCCTGCTG
CTACCATATTAAAGCTAAAATTTAACTTTTGCTGAAGAATCAGCTAATTCAGGTAATCCAAATATTTGTGGAAAAACATCTGGATAATTT
ATTGAACACATTAGTATTGTGTTAGACAGCTTTGATCATTCCCATTTCATAGGTTTTTATTGTGGAATAGTCAACTTAATATAGATTCAC
TTTCAATTTGCATGTATAAAGTAATACTCAATAAAATTTTTTTCATTTATTTTTCAACAGTGGTTATTTTTTTTCTTCCTGTACTATCAG
TAAAATCCTGACTATGAGTTTTACTTTTGAAGCTAAAGGATAATGCTGGTAATCTAATTATGTACCTCTTACAGAAACCATATGCAGCAC
TTTAAAAATCTTTATTTGGTATATTATTTTAGGTGGACAATGATTTAAGACTCAAAGCCATCATATTAAGGTCTAAATACATTAGTGGTG
GGGTTTCTCGAATAAATGAGGAAGTGCACAAAAGTTCAGCCTGACTGAAAATTTTAATTGTGTTTTAAAACTACATGAATAATTTCTTGA
TTCAAAATCAGAACTCTTATAAACTAAATCTGATGGTGTCCAAAGAATTTCAGGTCCTTCAAAGTTTGTAAAAGATAAGTAGGGGCCTAG
GAATATAAAAATTTAGACTTTTTTAGTAAATGGTTTACATAACCTTTTGTCTTAATTTGTCATTCTTCATACACAGGCACAAGCTAATCA
GTCTTCTCTACTTCTAGAACTCTAAATCTTCTCAGTAATGTCATACAAGTCTAACAAGAGGAAAAGCATCCTTAAGTCAGTCTATTTAGA
TAAACTCTTCAAGTCCCTATATAAGGACGTATTCCACTAGCAAGCCAGTAAATTTTTCCAAGGTCACATAATCTTACATGAAATGGAACC
TTTCATCTTAGACTTCATCAAACTCAATTTTTTCCCTTCTAGATTCACTTTGTGTTTATGCATGCATGCACGCGTGCACACAATTCTATC
AGCAGCTGTAAACTACCCACATATTTTCTTAATCTCATTTTTTCAGTTTTTCTTCATCTTTAAAAGAGGTTACATTTCATTCCTGGTCAA
CTCTTAAAAAGAATTATGTAATGTTGGGCCTTCATATTAAAGAGAGAGACTGGTTATAAGATCCTTTACAGTCCATTCATTTTATTCTGA
TGTCTAACCAGATAGACACTAGCAAGCAAAACTTCCCTCTTAATCCTGGACCAAATGCATAATTTTACTGTCACTTTCAAAAATCTGTTA
TGACTGAATCAAAATCCTTTTAAAGAAAGGAAAAAGCTCCTTTTGTGTCAAATAGTTGAACAACATGAAAACAGTATGAGCCGGTTAAAG
ATAGATTGAATTTTTACTTTACACATATGAAAAACAGTAAGTTTTGACTGCTGTGTATGTTATTCATGTTAATATGTGCTCAGTTATTCA
CTATTGTTAATCCACATATAATCAGTTGCTATCCCTGGTTAGACACACTATGGAACTTGAAATGCACAATATTTACATTGTTAGAGGCTT
CTATCCAAATATCTGCATTCCTTTAAAATGTGAACTATTTGCTGTGATTAACCAAAGGTAGATTATGTCATCAGTGGACATTTTAGCTTT
ATGGAAACAAATTATTAAGAAATGAATAGAAAGGTGTCTTTTTCTTTGTGTAGTGCAAAAGCCTAAAGCTATCAGTCAAAGGCCTAAGAA
ATCCACATTTGAAAAACGTAAATCATGATTGGTAAGAATACATTCATCTGATAGTATTGAGAAAAGTTGAAAAACTGTTAGCCTTCCATA
ACACATTAAACATTTTATGTATGGATGGCTGAAAGTATTGAGAAAAGCTGAAAAACTGTTAGCCTTCCATAACACATTAAACGTTTTGTG
TATGGATGGCTTAGGACAATAAACAACATCATTAAAGTAAAATTATGTCAGTCTGTTCATATTAACTTATTTAAATCAATGAAAATTTTG
ATGAGATGACTAAATGGATGCTTTGGAAATGCAGGATTATAGGAGGCCTAAAAGTGCATCTTGTTTCTTGTAACCCTTTTAAAACCAATA
TGCCTGGCTAGGTGCAGTGGCTCATGCCTGTAATACCAACGGGGTAACACAGGGTTATGCCGTCTATACAAAAAAATAAATGAGCTGGGC
AAGATGGCATGCACCTGTAGTCCCAGCTGCTTGGTAGGCTGAGGGGGAAGGATTGCTTGAGCCTGGGAGGTCGAGACTGCAGTGAGCCAA
GATCACACCACTGCACTCCAGCCTGGGTGACAGAGCAAGACTCTACCTCAAAAATAAAAATAATCAATATAGTTTCAATGAAGCAAAGCA
TCTCAGGTAACAATTTGAGCATAACTTTAACCATAACTTATGATAGCATAATAACATTCATTAGTAATTCAGTAGCCGTATGTGCCAGGC
TGTGTTAGGTGCTTTATATATTGTTTAATTTTTAAAAACTTGTGGAGTGTACAGATTGGTAAGGTGACATTGTATCACAAAGCTAGTCTT
TGAGTCCAAAGTTTTGTGGTTTTATGTTATGATATACTTTTATCATGGAATTGTCTTATTAAATGTTTTGCCAGTGGTTCTTAAAGTGTG
TTTCTGACACCAGTAGCATTGACTTCACTTAGAAACCTGTTAGAAATACAAATTATTTGGCCCCACCCAACACTTGAGTCACAAACTTTG
CAGATGGGGCTCAATCTGTTTTAACAAGCGCTTCATGTAATTTTGATGCAGGCCTAAGTTTTTGAGCCACTGCAGTATGCATTTCTATTT
TTAAGCAAAGATCTTGGTCTTTCTTTTTGGACATTGTAGAAATAACATGAACTTGTTTTTTGTTTGTTTTTGTTTTGTTTTGTTTTAAGC
TCCTGATCTTTGTTGGTTATGTTGCAAAAGATTGTATCAGGAGAAGCCTCAGCATGGACATTGGCATCCTGACATAACCCCCATTAATTT
AGTATTCTTTCTGAAACTCAAATGGATTCTCAAGTCCAAGAGACTATGGAATAAAATCATTGTTTGTCTGTGTTAAGTTTTATCTCTGTT
ATTGCCTGAAGACTTTTGGTAACAATAATGCGCTTTCATCAAACTTTTAAGACTTGATTGGAAAAAATAAATGTATGTTTCATCAGTTAT


Top

FusionGenePPI for STAU2_PAWR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STAU2KIAA1377, DHX58, EIF2AK2, ELAVL1, COPS5, DICER1, PRKRA, UPF1, ZNF346, ADAR, SHMT2, MOV10, NXF1, BMI1, HIST1H1A, RPL14, RPL8, RPL6, NIFK, RPS2, PRR11, RBM4B, ILF2, PAIP1, HNRNPU, MATR3, STRBP, STAU1, GLTSCR2, WDR46, ELAVL2, PPAN, ZCRB1, ZC3HAV1, E4F1, DGCR8, ZNF324B, NXF2, CDX1, RPL37A, ZNF169, HIST1H1E, RPF1, ZNF2, GPATCH4, G3BP1PAWRTHAP1, SLC5A7, SLC5A1, AATF, DAPK3, PRKCZ, WT1, HSPA5, FBXO25, SPSB1, SPSB2, SPSB4, SQSTM1, DRD2, PAN2, APEH, CAND1, CARS, FAM129B, H3F3A, IDE, JMJD6, ATP6V1C1, SHMT1, PPM1G, SHMT2, SNX2, SNX6, STAT1, VPS29, FBXO45, CCDC8, EED, LUZP4, DDX39A, CEP290, CEP128, MYH9, HMG20A, IKBIP, SCOC, SLC25A41, G3BP1, HDAC6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STAU2_PAWR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STAU2_PAWR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSTAU2C0023893Liver Cirrhosis, Experimental1CTD_human
TgenePAWRC0036341Schizophrenia2PSYGENET
TgenePAWRC0041696Unipolar Depression2PSYGENET
TgenePAWRC1269683Major Depressive Disorder2PSYGENET
TgenePAWRC0001418Adenocarcinoma1CTD_human
TgenePAWRC0005586Bipolar Disorder1PSYGENET
TgenePAWRC0014170Endometrial Neoplasms1CTD_human
TgenePAWRC0033578Prostatic Neoplasms1CTD_human
TgenePAWRC0033975Psychotic Disorders1PSYGENET
TgenePAWRC0525045Mood Disorders1PSYGENET
TgenePAWRC0600427Cocaine Dependence1PSYGENET