FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36361

FusionGeneSummary for STARD3_UVRAG

check button Fusion gene summary
Fusion gene informationFusion gene name: STARD3_UVRAG
Fusion gene ID: 36361
HgeneTgene
Gene symbol

STARD3

UVRAG

Gene ID

10948

7405

Gene nameStAR related lipid transfer domain containing 3UV radiation resistance associated
SynonymsCAB1|MLN64|es64DHTX|VPS38|p63
Cytomap

17q12

11q13.5

Type of geneprotein-codingprotein-coding
DescriptionstAR-related lipid transfer protein 3MLN 64START domain-containing protein 3StAR-related lipid transfer (START) domain containing 3metastatic lymph node gene 64 proteinmetastatic lymph node protein 64steroidogenic acute regulatory protein relatedUV radiation resistance-associated gene proteinbeclin 1 binding proteindisrupted in heterotaxy
Modification date2018052220180523
UniProtAcc

Q14849

Q9P2Y5

Ensembl transtripts involved in fusion geneENST00000336308, ENST00000578232, 
ENST00000544210, ENST00000394250, 
ENST00000580611, 
ENST00000356136, 
ENST00000528420, ENST00000533454, 
ENST00000531818, ENST00000532130, 
ENST00000539288, ENST00000525872, 
ENST00000538870, 
Fusion gene scores* DoF score21 X 6 X 7=88224 X 13 X 11=3432
# samples 2225
** MAII scorelog2(22/882*10)=-2.00327513203286
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(25/3432*10)=-3.77904955283746
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STARD3 [Title/Abstract] AND UVRAG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTARD3

GO:0030301

cholesterol transport

28377464

HgeneSTARD3

GO:0099044

vesicle tethering to endoplasmic reticulum

24105263|28377464

TgeneUVRAG

GO:0071900

regulation of protein serine/threonine kinase activity

22542840

TgeneUVRAG

GO:0097680

double-strand break repair via classical nonhomologous end joining

22542840


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A1-A0SM-01ASTARD3chr17

37810003

+UVRAGchr11

75599873

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336308ENST00000356136STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000336308ENST00000528420STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000336308ENST00000533454STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000336308ENST00000531818STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000336308ENST00000532130STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000336308ENST00000539288STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000336308ENST00000525872STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000336308ENST00000538870STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-3CDSENST00000578232ENST00000356136STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-3CDSENST00000578232ENST00000528420STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-intronENST00000578232ENST00000533454STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-intronENST00000578232ENST00000531818STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-intronENST00000578232ENST00000532130STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-intronENST00000578232ENST00000539288STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-intronENST00000578232ENST00000525872STARD3chr17

37810003

+UVRAGchr11

75599873

+
3UTR-intronENST00000578232ENST00000538870STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000544210ENST00000356136STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000544210ENST00000528420STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000544210ENST00000533454STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000544210ENST00000531818STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000544210ENST00000532130STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000544210ENST00000539288STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000544210ENST00000525872STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000544210ENST00000538870STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000394250ENST00000356136STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000394250ENST00000528420STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000394250ENST00000533454STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000394250ENST00000531818STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000394250ENST00000532130STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000394250ENST00000539288STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000394250ENST00000525872STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000394250ENST00000538870STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000580611ENST00000356136STARD3chr17

37810003

+UVRAGchr11

75599873

+
In-frameENST00000580611ENST00000528420STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000580611ENST00000533454STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000580611ENST00000531818STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000580611ENST00000532130STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000580611ENST00000539288STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000580611ENST00000525872STARD3chr17

37810003

+UVRAGchr11

75599873

+
5CDS-intronENST00000580611ENST00000538870STARD3chr17

37810003

+UVRAGchr11

75599873

+

Top

FusionProtFeatures for STARD3_UVRAG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STARD3

Q14849

UVRAG

Q9P2Y5

Sterol-binding protein that mediates cholesteroltransport from the endoplasmic reticulum to endosomes(PubMed:11053434, PubMed:15930133, PubMed:22514632,PubMed:28377464). Creates contact site between the endoplasmicreticulum and late endosomes: localizes to late endosome membranesand contacts the endoplasmic reticulum via interaction with VAPAand VAPB (PubMed:24105263, PubMed:28377464). Acts as a lipidtransfer protein that redirects sterol to the endosome at theexpense of the cell membrane and favors membrane formation insideendosomes (PubMed:28377464). May also mediate cholesteroltransport between other membranes, such as mitochondria membraneor cell membrane (PubMed:12070139, PubMed:19965586). However, suchresults need additional experimental evidences; probably mainlymediates cholesterol transport from the endoplasmic reticulum toendosomes (PubMed:28377464). Does not activate transcriptionalcholesterol sensing (PubMed:28377464). Able to bind other lipids,such as lutein, a xanthophyll carotenoids that form the macularpigment of the retina (PubMed:21322544).{ECO:0000269|PubMed:11053434, ECO:0000269|PubMed:12070139,ECO:0000269|PubMed:15930133, ECO:0000269|PubMed:19965586,ECO:0000269|PubMed:21322544, ECO:0000269|PubMed:22514632,ECO:0000269|PubMed:24105263, ECO:0000269|PubMed:28377464}. Versatile protein that is involved in regulation ofdifferent cellular pathways implicated in membrane trafficking.Involved in regulation of the COPI-dependent retrograde transportfrom Golgi and the endoplasmic reticulum by associating with theNRZ complex; the function is dependent on its binding tophosphatidylinositol 3-phosphate (PtdIns(3)P) (PubMed:24056303).During autophagy acts as regulatory subunit of the alternativePI3K complex II (PI3KC3-C2) that mediates formation ofphosphatidylinositol 3-phosphate and is believed to be involved inmaturation of autophagosomes and endocytosis. Activates lipidkinase activity of PIK3C3. Involved in the regulation ofdegradative endocytic trafficking and cytokinesis, and inregulation of ATG9A transport from the Golgi to the autophagosome;the functions seems to implicate its association with PI3KC3-C2(PubMed:16799551, PubMed:20643123, PubMed:24056303). Involved inmaturation of autophagosomes and degradative endocytic traffickingindependently of BECN1 but depending on its association with aclass C Vps complex (possibly the HOPS complex); the associationis also proposed to promote autophagosome recruitment andactivation of Rab7 and endosome-endosome fusion events(PubMed:18552835). Enhances class C Vps complex (possibly HOPScomplex) association with a SNARE complex and promotes fusogenicSNARE complex formation during late endocytic membrane fusion(PubMed:24550300). In case of negative-strand RNA virus infectionis required for efficient virus entry, promotes endocytictransport of virions and is implicated in a VAMP8-specificfusogenic SNARE complex assembly (PubMed:24550300).{ECO:0000269|PubMed:18552835, ECO:0000269|PubMed:20643123,ECO:0000269|PubMed:24056303, ECO:0000305}. Involved in maintaining chromosomal stability. PromotesDNA double-strand break (DSB) repair by association with DNA-dependent protein kinase complex DNA-PK and activating it in non-homologous end joining (NHEJ) (PubMed:22542840). Required forcentrosome stability and proper chromosome segregation(PubMed:22542840). {ECO:0000269|PubMed:22542840}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+2151_5173446Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+2141_5173428Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+2151_5173446Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+21552_7273446TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+21452_7273428TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+21552_7273446TransmembraneHelical
TgeneUVRAGchr17:37810003chr11:75599873ENST00000356136+315224_305144700Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215230_44373446DomainSTART
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+21546_21773446DomainMENTAL
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214230_44373428DomainSTART
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+21446_21773428DomainMENTAL
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215230_44373446DomainSTART
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+21546_21773446DomainMENTAL
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215207_21273446MotifFFAT
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214207_21273428MotifFFAT
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215207_21273446MotifFFAT
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215116_12073446Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215142_14873446Topological domainExtracellular
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215170_44573446Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+21573_9473446Topological domainExtracellular
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214116_12073428Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214142_14873428Topological domainExtracellular
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214170_44573428Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+21473_9473428Topological domainExtracellular
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215116_12073446Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215142_14873446Topological domainExtracellular
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215170_44573446Topological domainCytoplasmic
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+21573_9473446Topological domainExtracellular
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215121_14173446TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+215149_16973446TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000336308+21595_11573446TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214121_14173428TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+214149_16973428TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000394250+21495_11573428TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215121_14173446TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+215149_16973446TransmembraneHelical
HgeneSTARD3chr17:37810003chr11:75599873ENST00000544210+21595_11573446TransmembraneHelical
TgeneUVRAGchr17:37810003chr11:75599873ENST00000356136+31544_128144700DomainNote=C2


Top

FusionGeneSequence for STARD3_UVRAG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STARD3_ENST00000336308_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000336308_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000544210_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000544210_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000394250_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000394250_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000580611_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV

>In-frame_STARD3_ENST00000580611_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_629aa
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNIHARNQNEIIFGLNDGY
YGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNEL
ERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFV
CGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNK
NIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPP
SYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STARD3_ENST00000336308_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000336308_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000544210_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000544210_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000394250_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000394250_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000580611_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA

>In-frame_STARD3_ENST00000580611_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_1887nt
ATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAG
AGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGAC
CTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATAC
TATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTAC
GATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAA
GAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTG
GAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCT
GAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAAT
GCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTA
TGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTC
TCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGAC
AAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAA
AATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGA
CTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGC
TTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCC
AGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTG
GATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCT
AGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTC
CAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACA
GGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_STARD3_ENST00000336308_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_3887nt
GGCGGGGCCGCAGGCGAACGCAAGTCCCGCTTCGCTCTCGGGGGCGGACTCAGCGGCGGAAGTGGCGCTGCCGGAAGATCTTCTTCCGCT
CTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCAGCCCTGCTGCTGAG
GCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTG
CCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTG
ATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAA
ACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTC
TTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGA
CTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAAT
GCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAAC
AAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGG
AGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTT
ACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAA
GCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATA
AGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGA
AGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGC
AAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTA
AGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCT
CTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAG
AGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAG
TTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCA
CTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTG
TGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACA
GTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCA
GCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAA
AGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGA
GGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATC
ACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAA
GATGATAATATATAAATAATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACTTTGGGAAAACG
GAATATTCAGAAATAGGTTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTGGTCTCCTTACA
TCTAGGCCTAACTGTCCCTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCGTGGATGGGCCA
TGCGTCCTGAAAACAGGACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCATGGCCTTCCCC
TCCTCTGCCATACCCTTAATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGACCTCGAGGTTA
CTGCAGTCAGATGCCATCTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCATGCTTTCTGGCA
ATGCACTCACCAGACAAAAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTACATGACAGAATG
TATGTAGAGAGTTGGGGTGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATAGAATACTATTG
GTATGTGTGCAATTTCATGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGTTGCTTTATACG
TTACGTACCCAAGGACATTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCCATATATCCATGTATTATATAGAAGAATAAAAAT
TGAGTTTACTTCACCCGACCTGATTTTTTTTTACCAGCTTGGAAATTCCTCTTGAACCTACGTCTCCATATGTCACATCATGACAGGACT
AGCCTGAACAAAAGCCATGTCTATCTAAGCGGAGGCTGTTGACTTCATTCAGTTTGCATATTGTATATAGCAACACAAACACTTGACAGG
TATATACTCCAGTCGCCACATTTGTCCTGCATAACAGCTTCACTCACAGGCCTCACCGTCACTTTATTTTGTGTCCAAGCATTCCTGGGC
TCAAGTTTAATGTATAGCTACATTGTTGTTTTCCATGTAGAGAACTCACAGGATGACTACATCACAAATAAACCCAACTCTCAGGCAGTC
GAAAGCTTTAACTGGATCTGCAGAAGCCCATCTTCCTCCACATGAAGAAGTGGGGCTCCTTCACCTAGAGCAGGAGCTTCTCTGCAGTGT
ACTGTCTGTCGCTCATTTTGGAGTCAGTGTGGGTGGAGACAGCATCGTGGATATGCACGTGCTGCGGGGCCCTCCAGGGAAGTAACATTT

>In-frame_STARD3_ENST00000336308_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_2486nt
GGCGGGGCCGCAGGCGAACGCAAGTCCCGCTTCGCTCTCGGGGGCGGACTCAGCGGCGGAAGTGGCGCTGCCGGAAGATCTTCTTCCGCT
CTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCAGCCCTGCTGCTGAG
GCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCCTG
CCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTCTG
ATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCGAA
ACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTATTC
TTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACAGA
CTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGAAT
GCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCAAC
AAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAAGG
AGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACATTT
ACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGGAA
GCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCATA
AGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGAGA
AGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCGGC
AAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCCTA
AGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAGCT
CTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGGAG
AGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCTAG
TTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGGCA
CTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTACTG
TGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGACA
GTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATCCA
GCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTGAA
AGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAGGA
GGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAATC
ACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGGAA

>In-frame_STARD3_ENST00000544210_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_3811nt
GATCTTCTTCCGCTCTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCA
GCCCTGCTGCTGAGGCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGA
GCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCG
AAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAA
TATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGC
TCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTG
TGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAA
AAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATT
ACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAA
TGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGA
GCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGC
AAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATA
TCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCC
AAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGAC
TCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGC
AATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCG
AAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGT
CCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAA
AGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGC
CACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGA
GCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTG
CATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAA
TGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCC
TAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACT
TTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATT
TTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTT
ATCCTCAGAGGGAAGATGATAATATATAAATAATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAA
ACTTTGGGAAAACGGAATATTCAGAAATAGGTTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATA
GTGGTCTCCTTACATCTAGGCCTAACTGTCCCTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCT
CCGTGGATGGGCCATGCGTCCTGAAAACAGGACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAG
CCATGGCCTTCCCCTCCTCTGCCATACCCTTAATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAA
GGACCTCGAGGTTACTGCAGTCAGATGCCATCTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGG
CATGCTTTCTGGCAATGCACTCACCAGACAAAAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATT
TACATGACAGAATGTATGTAGAGAGTTGGGGTGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGAC
ATAGAATACTATTGGTATGTGTGCAATTTCATGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGC
TGTTGCTTTATACGTTACGTACCCAAGGACATTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCCATATATCCATGTATTATAT
AGAAGAATAAAAATTGAGTTTACTTCACCCGACCTGATTTTTTTTTACCAGCTTGGAAATTCCTCTTGAACCTACGTCTCCATATGTCAC
ATCATGACAGGACTAGCCTGAACAAAAGCCATGTCTATCTAAGCGGAGGCTGTTGACTTCATTCAGTTTGCATATTGTATATAGCAACAC
AAACACTTGACAGGTATATACTCCAGTCGCCACATTTGTCCTGCATAACAGCTTCACTCACAGGCCTCACCGTCACTTTATTTTGTGTCC
AAGCATTCCTGGGCTCAAGTTTAATGTATAGCTACATTGTTGTTTTCCATGTAGAGAACTCACAGGATGACTACATCACAAATAAACCCA
ACTCTCAGGCAGTCGAAAGCTTTAACTGGATCTGCAGAAGCCCATCTTCCTCCACATGAAGAAGTGGGGCTCCTTCACCTAGAGCAGGAG
CTTCTCTGCAGTGTACTGTCTGTCGCTCATTTTGGAGTCAGTGTGGGTGGAGACAGCATCGTGGATATGCACGTGCTGCGGGGCCCTCCA

>In-frame_STARD3_ENST00000544210_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_2410nt
GATCTTCTTCCGCTCTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCA
GCCCTGCTGCTGAGGCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGA
GCGCAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCG
AAGGGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAA
TATTCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGC
TCAGAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTG
TGCAATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAA
AAAAAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATT
ACTGCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAA
TGAGCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGA
GCTTTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGC
AAAAGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATA
TCCTATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCC
AAAAGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGAC
TCCAGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGC
AATCCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCG
AAAACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGT
CCCCTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAA
AGGAGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGC
CACAGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGA
GCTCTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTG
CATCCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAA
TGAAAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCC
TAAAATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACT
TTGGGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATT
TTAAAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTT

>In-frame_STARD3_ENST00000394250_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_3808nt
CTTCTTCCGCTCTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCAGCC
CTGCTGCTGAGGCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCG
CAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAG
GGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATAT
TCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCA
GAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGC
AATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAA
AAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACT
GCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGA
GCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCT
TTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAA
AGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCC
TATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAA
AGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCC
AGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAAT
CCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAA
ACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCC
CTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGG
AGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCAC
AGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCT
CTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCAT
CCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGA
AAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAA
AATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTG
GGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTA
AAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATC
CTCAGAGGGAAGATGATAATATATAAATAATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACT
TTGGGAAAACGGAATATTCAGAAATAGGTTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTG
GTCTCCTTACATCTAGGCCTAACTGTCCCTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCG
TGGATGGGCCATGCGTCCTGAAAACAGGACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCA
TGGCCTTCCCCTCCTCTGCCATACCCTTAATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGA
CCTCGAGGTTACTGCAGTCAGATGCCATCTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCAT
GCTTTCTGGCAATGCACTCACCAGACAAAAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTAC
ATGACAGAATGTATGTAGAGAGTTGGGGTGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATA
GAATACTATTGGTATGTGTGCAATTTCATGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGT
TGCTTTATACGTTACGTACCCAAGGACATTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCCATATATCCATGTATTATATAGA
AGAATAAAAATTGAGTTTACTTCACCCGACCTGATTTTTTTTTACCAGCTTGGAAATTCCTCTTGAACCTACGTCTCCATATGTCACATC
ATGACAGGACTAGCCTGAACAAAAGCCATGTCTATCTAAGCGGAGGCTGTTGACTTCATTCAGTTTGCATATTGTATATAGCAACACAAA
CACTTGACAGGTATATACTCCAGTCGCCACATTTGTCCTGCATAACAGCTTCACTCACAGGCCTCACCGTCACTTTATTTTGTGTCCAAG
CATTCCTGGGCTCAAGTTTAATGTATAGCTACATTGTTGTTTTCCATGTAGAGAACTCACAGGATGACTACATCACAAATAAACCCAACT
CTCAGGCAGTCGAAAGCTTTAACTGGATCTGCAGAAGCCCATCTTCCTCCACATGAAGAAGTGGGGCTCCTTCACCTAGAGCAGGAGCTT
CTCTGCAGTGTACTGTCTGTCGCTCATTTTGGAGTCAGTGTGGGTGGAGACAGCATCGTGGATATGCACGTGCTGCGGGGCCCTCCAGGG

>In-frame_STARD3_ENST00000394250_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_2407nt
CTTCTTCCGCTCTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCAGCC
CTGCTGCTGAGGCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCG
CAGCCTGCCTGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAG
GGCCATCTCTGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATAT
TCATGCCCGAAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCA
GAAGACTATTCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGC
AATTAAACAGACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAA
AAAAAGTGAATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACT
GCATAAGCAACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGA
GCTGAGGAAGGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCT
TTCCTACATTTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAA
AGATGATGGAAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCC
TATAATTCATAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAA
AGGAGGGGAGAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCC
AGACTTGCGGCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAAT
CCCTGTTCCTAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAA
ACGGGCCAGCTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCC
CTCCATGGGAGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGG
AGAGGATCTAGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCAC
AGTCAATGGCACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCT
CTGCTGTACTGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCAT
CCCAGTGGACAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGA
AAACGTATCCAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAA
AATGAAGTGAAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTG
GGAATGAAGGAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTA
AAGCAAAAATCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATC

>In-frame_STARD3_ENST00000580611_chr17_37810003_+_UVRAG_ENST00000356136_chr11_75599873_+_3799nt
CTCTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCAGCCCTGCTGCTG
AGGCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCC
TGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTC
TGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCG
AAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTAT
TCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACA
GACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGA
ATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCA
ACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAA
GGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACAT
TTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGG
AAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCA
TAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGA
GAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCG
GCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCC
TAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAG
CTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGG
AGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCT
AGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGG
CACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTAC
TGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGA
CAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATC
CAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTG
AAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAG
GAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAA
TCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGG
AAGATGATAATATATAAATAATATAATGAACACACCCTTAGTTTCTCATAAGCATTTGCCCTCACCATGGTTTATAAAACTTTGGGAAAA
CGGAATATTCAGAAATAGGTTTCCGCCATGTACTGAAAGGTCTGTGGCCATCTGTGAGGTAGATGAAGAAGCAGCATAGTGGTCTCCTTA
CATCTAGGCCTAACTGTCCCTCTTCCTGCCCCCGGGTACCACAGTCCACCTTTAGACCCTACTGTCGCCCCATCTTCTCCGTGGATGGGC
CATGCGTCCTGAAAACAGGACATCAGATTCACTGGTTCTGTAACCCAGTAGCTGTGACGTTCCATCTCTTCTAACCAGCCATGGCCTTCC
CCTCCTCTGCCATACCCTTAATGCGGCCCTCAGATTAGATGAAAAACTTGCTCCTGGTGGATCCCAAGGGACCCTCAAGGACCTCGAGGT
TACTGCAGTCAGATGCCATCTCATCCCCTGTGGGGGCCAAAGTTTTTATGTGGGCAGATGCTGTGGTCAGGAACTAGGCATGCTTTCTGG
CAATGCACTCACCAGACAAAAATCCCTTGATGTAAATCCCATGTTAATTTATTAAATTTCAGTCAGAAGGTCAGCATTTACATGACAGAA
TGTATGTAGAGAGTTGGGGTGTCTGGTAGGCAAACTGCAAGGCAGTTGAGATAGTTGGATTAAGAGGCTAGACGAGACATAGAATACTAT
TGGTATGTGTGCAATTTCATGAATATTAAATTATGTTTCGAAGTCCAGTTGTCATTCCCGCATTCAGATTTCATTTGCTGTTGCTTTATA
CGTTACGTACCCAAGGACATTGCCTCAGGGTTGCAAACTCTTTAAAGGAAAATTTATCCATATATCCATGTATTATATAGAAGAATAAAA
ATTGAGTTTACTTCACCCGACCTGATTTTTTTTTACCAGCTTGGAAATTCCTCTTGAACCTACGTCTCCATATGTCACATCATGACAGGA
CTAGCCTGAACAAAAGCCATGTCTATCTAAGCGGAGGCTGTTGACTTCATTCAGTTTGCATATTGTATATAGCAACACAAACACTTGACA
GGTATATACTCCAGTCGCCACATTTGTCCTGCATAACAGCTTCACTCACAGGCCTCACCGTCACTTTATTTTGTGTCCAAGCATTCCTGG
GCTCAAGTTTAATGTATAGCTACATTGTTGTTTTCCATGTAGAGAACTCACAGGATGACTACATCACAAATAAACCCAACTCTCAGGCAG
TCGAAAGCTTTAACTGGATCTGCAGAAGCCCATCTTCCTCCACATGAAGAAGTGGGGCTCCTTCACCTAGAGCAGGAGCTTCTCTGCAGT
GTACTGTCTGTCGCTCATTTTGGAGTCAGTGTGGGTGGAGACAGCATCGTGGATATGCACGTGCTGCGGGGCCCTCCAGGGAAGTAACAT

>In-frame_STARD3_ENST00000580611_chr17_37810003_+_UVRAG_ENST00000528420_chr11_75599873_+_2398nt
CTCTGAGGCGCTACTGAGGCCGCGGAGCCGGACTGCGGTTGGGGCGGGAAGAGCCGGGGCCGTGGCTGACATGGAGCAGCCCTGCTGCTG
AGGCCGCGCCCTCCCCGCCCTGAGGTGGGGGCCCACCAGGATGAGCAAGCTGCCCAGGGAGCTGACCCGAGACTTGGAGCGCAGCCTGCC
TGCCGTGGCCTCCCTGGGCTCCTCACTGTCCCACAGCCAGAGCCTCTCCTCGCACCTCCTTCCGCCGCCTGAGAAGCGAAGGGCCATCTC
TGATGTCCGCCGCACCTTCTGTCTCTTCGTCACCTTCGACCTGCTCTTCATCTCCCTGCTCTGGATCATCGAACTGAATATTCATGCCCG
AAACCAAAATGAAATAATTTTTGGGCTGAATGATGGATACTATGGTGCTCCATTTGAACATAAGGGTTATTCAAATGCTCAGAAGACTAT
TCTTCTGCAGGTGGATCAGAACTGTGTTCGCAATTCTTACGATGTCTTCTCTTTGCTACGGCTTCATAGAGCCCAGTGTGCAATTAAACA
GACTCAGGTAACTGTTCAGAAAATTGGAAAGGAAATTGAAGAAAAACTAAGACTCACATCTACAAGCAATGAACTGAAAAAAAAAAGTGA
ATGCCTGCAGTTAAAAATTTTGGTGCTTCAGAATGAACTGGAACGGCAGAAGAAAGCTTTGGGACGGGAGGTGGCATTACTGCATAAGCA
ACAAATTGCATTACAAGACAAAGGAAGTGCATTTTCAGCTGAGCACCTCAAACTTCAACTCCAGAAGGAATCCCTAAATGAGCTGAGGAA
GGAGTGCACTGCAAAAAGAGAACTCTTCTTGAAGACTAATGCTCAGTTGACAATTCGTTGCAGGCAGTTACTCTCTGAGCTTTCCTACAT
TTACCCTATTGATTTGAATGAACATAAGGATTACTTTGTATGCGGTGTCAAGTTGCCTAATTCTGAGGACTTCCAAGCAAAAGATGATGG
AAGCATTGCTGTTGCCCTTGGTTATACTGCACATCTGGTCTCCATGATTTCCTTTTTCCTACAAGTGCCCCTCAGATATCCTATAATTCA
TAAGGGGTCTAGATCAACAATCAAAGACAATATCAATGACAAACTGACGGAAAAGGAGAGAGAGTTTCCACTGTATCCAAAAGGAGGGGA
GAAGTTGCAGTTTGATTATGGTGTCTATCTTCTGAACAAAAATATAGCACAGCTAAGATATCAACATGGACTAGGGACTCCAGACTTGCG
GCAAACCCTTCCCAACCTGAAAAACTTCATGGAGCATGGACTAATGGTCAGGTGTGACAGACATCACACCTCCAGTGCAATCCCTGTTCC
TAAGAGACAAAGCTCCATATTTGGGGGTGCAGATGTAGGCTTCTCTGGGGGGATCCCTTCACCAGACAAAGGACATCGAAAACGGGCCAG
CTCTGAGAATGAGAGACTTCAGTACAAAACCCCTCCTCCCAGTTACAACTCAGCATTAGCCCAGCCTGTGACCACCGTCCCCTCCATGGG
AGAGACCGAGAGAAAGATAACATCTCTATCCTCCTCCTTGGATACCTCCTTGGACTTCTCCAAAGAAAACAAGAAAAAAGGAGAGGATCT
AGTTGGCAGCTTAAACGGAGGCCACGCGAATGTGCACCCTAGCCAAGAACAAGGAGAAGCCCTCTCCGGGCACCGGGCCACAGTCAATGG
CACTCTCCTACCCAGCGAGCAGGCCGGGTCCGCCAGTGTCCAGCTTCCAGGCGAGTTCCACCCAGTCTCAGAAGCTGAGCTCTGCTGTAC
TGTGGAGCAAGCAGAAGAAATCATCGGGCTGGAAGCCACAGGTTTCGCCTCAGGTGATCAGCTAGAAGCATTTAACTGCATCCCAGTGGA
CAGTGCTGTGGCAGTAGAGTGTGACGAACAAGTTCTGGGAGAATTTGAAGAGTTCTCCCGAAGGATCTATGCACTGAATGAAAACGTATC
CAGCTTCCGCCGGCCGCGCAGGAGTTCCGATAAGTGAAGTGAGCAGGTCAACAGTAGGACTGGGGCAGAAGCTCTGCCTAAAATGAAGTG
AAAGCTGCACTTAACCCTTTGTGATAATGATGACACAAAATGAATATTAATGGAGGATATTCCTCGGAAAAACAGACTTTGGGAATGAAG
GAGGGACTCAGGATCATTGTTATCAGTGGGCCAAAGTTAGATTTTGCTTTCAAGATTTGCTTTTCGGGCCTGATGATTTTAAAGCAAAAA
TCACCCTCTAGTTGAAAGAGCTTACAGCTCGAGTCACCTTTTAGCTATTTGTCTGCTTTTTATTTACCCTTGTATGTTATCCTCAGAGGG


Top

FusionGenePPI for STARD3_UVRAG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STARD3GOPC, SPACA1, SDF4, ERGIC3, HEPACAM2, VAPB, CREB3, C19orf26, MME, P2RX2, SLC15A1, CHRM3, MANSC1, PMEL, CLEC2D, TSPYL6, TRIM25, LMNAUVRAGBECN1, PIK3C3, VPS33A, VPS18, PIK3R4, PTPRA, KIAA0226, TGFBRAP1, VPS16, VPS11, VPS33B, VPS39, YWHAE, RALB, USP18, XPO1, MYO1C, DDB1, DDB2, CUL4A, RBX1, KIAA0226L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STARD3_UVRAG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STARD3_UVRAG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSTARD3C0033578Prostatic Neoplasms2CTD_human
HgeneSTARD3C3496069cocaine use1PSYGENET