FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36325

FusionGeneSummary for STAMBP_AQP4

check button Fusion gene summary
Fusion gene informationFusion gene name: STAMBP_AQP4
Fusion gene ID: 36325
HgeneTgene
Gene symbol

STAMBP

AQP4

Gene ID

10617

361

Gene nameSTAM binding proteinaquaporin 4
SynonymsAMSH|MICCAPMIWC|WCH4
Cytomap

2p13.1

18q11.2

Type of geneprotein-codingprotein-coding
DescriptionSTAM-binding proteinassociated molecule with the SH3 domain of STAMendosome-associated ubiquitin isopeptidasetesticular secretory protein Li 54aquaporin-4aquaporin type4mercurial-insensitive water channel
Modification date2018052320180523
UniProtAcc

O95630

P55087

Ensembl transtripts involved in fusion geneENST00000339566, ENST00000409707, 
ENST00000394073, ENST00000394070, 
ENST00000536064, ENST00000486458, 
ENST00000383168, ENST00000581374, 
ENST00000440832, ENST00000583022, 
Fusion gene scores* DoF score3 X 2 X 3=184 X 3 X 3=36
# samples 34
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: STAMBP [Title/Abstract] AND AQP4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneAQP4

GO:0071346

cellular response to interferon-gamma

17645239


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDKIRCTCGA-CZ-4854-01ASTAMBPchr2

74058186

+AQP4chr18

24442560

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000339566ENST00000383168STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000339566ENST00000581374STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000339566ENST00000440832STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-intronENST00000339566ENST00000583022STAMBPchr2

74058186

+AQP4chr18

24442560

-
In-frameENST00000409707ENST00000383168STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000409707ENST00000581374STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000409707ENST00000440832STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-intronENST00000409707ENST00000583022STAMBPchr2

74058186

+AQP4chr18

24442560

-
In-frameENST00000394073ENST00000383168STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000394073ENST00000581374STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000394073ENST00000440832STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-intronENST00000394073ENST00000583022STAMBPchr2

74058186

+AQP4chr18

24442560

-
In-frameENST00000394070ENST00000383168STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000394070ENST00000581374STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000394070ENST00000440832STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-intronENST00000394070ENST00000583022STAMBPchr2

74058186

+AQP4chr18

24442560

-
In-frameENST00000536064ENST00000383168STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000536064ENST00000581374STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-5UTRENST00000536064ENST00000440832STAMBPchr2

74058186

+AQP4chr18

24442560

-
5CDS-intronENST00000536064ENST00000583022STAMBPchr2

74058186

+AQP4chr18

24442560

-
intron-3CDSENST00000486458ENST00000383168STAMBPchr2

74058186

+AQP4chr18

24442560

-
intron-5UTRENST00000486458ENST00000581374STAMBPchr2

74058186

+AQP4chr18

24442560

-
intron-5UTRENST00000486458ENST00000440832STAMBPchr2

74058186

+AQP4chr18

24442560

-
intron-intronENST00000486458ENST00000583022STAMBPchr2

74058186

+AQP4chr18

24442560

-

Top

FusionProtFeatures for STAMBP_AQP4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STAMBP

O95630

AQP4

P55087

Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linkedpolyubiquitin chains (By similarity). Plays a role in signaltransduction for cell growth and MYC induction mediated by IL-2and GM-CSF. Potentiates BMP (bone morphogenetic protein) signalingby antagonizing the inhibitory action of SMAD6 and SMAD7. Has akey role in regulation of cell surface receptor-mediatedendocytosis and ubiquitin-dependent sorting of receptors tolysosomes. Endosomal localization of STAMBP is required forefficient EGFR degradation but not for its internalization (Bysimilarity). Involved in the negative regulation of PI3K-AKT-mTORand RAS-MAP signaling pathways. {ECO:0000250,ECO:0000269|PubMed:10383417, ECO:0000269|PubMed:11483516,ECO:0000269|PubMed:15314065, ECO:0000269|PubMed:17261583,ECO:0000269|PubMed:23542699}. Forms a water-specific channel. Osmoreceptor whichregulates body water balance and mediates water flow within thecentral nervous system.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05213_21510324MotifNote=NPA 2
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-0597_9910324MotifNote=NPA 1
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05213_215-12302MotifNote=NPA 2
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-0597_99-12302MotifNote=NPA 1
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04213_215-96302MotifNote=NPA 2
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-0497_99-96302MotifNote=NPA 1
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05137_15510324Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05177_18410324Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05206_23110324Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05253_32310324Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-0558_6410324Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-0586_11510324Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05137_155-12302Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05177_184-12302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-051_36-12302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05206_231-12302Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05253_323-12302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-0558_64-12302Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-0586_115-12302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04137_155-96302Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04177_184-96302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-041_36-96302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04206_231-96302Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04253_323-96302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-0458_64-96302Topological domainExtracellular
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-0486_115-96302Topological domainCytoplasmic
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05116_13610324TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05156_17610324TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05185_20510324TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-05232_25210324TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-0537_5710324TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-0565_8510324TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05116_136-12302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05156_176-12302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05185_205-12302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-05232_252-12302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-0537_57-12302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000440832-0565_85-12302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04116_136-96302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04156_176-96302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04185_205-96302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-04232_252-96302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-0437_57-96302TransmembraneHelical
TgeneAQP4chr2:74058186chr18:24442560ENST00000581374-0465_85-96302TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000339566+210104_17767425Compositional biasNote=Glu-rich
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394070+210104_17767425Compositional biasNote=Glu-rich
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394073+311104_17767425Compositional biasNote=Glu-rich
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000409707+211104_17767507Compositional biasNote=Glu-rich
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000339566+210257_38867425DomainMPN
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394070+210257_38867425DomainMPN
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394073+311257_38867425DomainMPN
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000409707+211257_38867507DomainMPN
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000339566+210335_34867425MotifJAMM motif
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394070+210335_34867425MotifJAMM motif
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394073+311335_34867425MotifJAMM motif
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000409707+211335_34867507MotifJAMM motif
TgeneAQP4chr2:74058186chr18:24442560ENST00000383168-051_3610324Topological domainCytoplasmic


Top

FusionGeneSequence for STAMBP_AQP4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STAMBP_ENST00000339566_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_381aa
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITKCGPLCTRENIMVAFKGVWTQA
FWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQC
LGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN
PARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVID

>In-frame_STAMBP_ENST00000409707_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_381aa
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITKCGPLCTRENIMVAFKGVWTQA
FWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQC
LGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN
PARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVID

>In-frame_STAMBP_ENST00000394073_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_381aa
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITKCGPLCTRENIMVAFKGVWTQA
FWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQC
LGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN
PARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVID

>In-frame_STAMBP_ENST00000394070_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_381aa
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITKCGPLCTRENIMVAFKGVWTQA
FWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQC
LGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN
PARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVID

>In-frame_STAMBP_ENST00000536064_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_381aa
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITKCGPLCTRENIMVAFKGVWTQA
FWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQC
LGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMN
PARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVID


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STAMBP_ENST00000339566_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_1143nt
ATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGAC
ATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTC
ATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCT
TTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAA
AAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGT
GGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGC
CTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAAT
CTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACT
GATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAAT
CCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTC
GCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACA
AAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGAC

>In-frame_STAMBP_ENST00000409707_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_1143nt
ATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGAC
ATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTC
ATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCT
TTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAA
AAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGT
GGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGC
CTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAAT
CTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACT
GATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAAT
CCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTC
GCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACA
AAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGAC

>In-frame_STAMBP_ENST00000394073_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_1143nt
ATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGAC
ATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTC
ATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCT
TTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAA
AAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGT
GGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGC
CTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAAT
CTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACT
GATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAAT
CCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTC
GCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACA
AAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGAC

>In-frame_STAMBP_ENST00000394070_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_1143nt
ATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGAC
ATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTC
ATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCT
TTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAA
AAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGT
GGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGC
CTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAAT
CTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACT
GATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAAT
CCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTC
GCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACA
AAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGAC

>In-frame_STAMBP_ENST00000536064_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_1143nt
ATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGAC
ATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTC
ATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCT
TTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAA
AAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGT
GGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGC
CTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAAT
CTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACT
GATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAAT
CCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTC
GCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACA
AAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_STAMBP_ENST00000339566_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_5366nt
ACGTTTCCGGAACCTCCGGGTGTCATCCGCGGGGAAAGAACTTGGTCCTGATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACC
GGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGACATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTA
TCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTCATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGT
GTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCTTTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTA
TTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAAAAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCT
TTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGTGGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCA
CCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGCCTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCA
CACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAATCTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCA
CATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACTGATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTG
TTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAATCCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATT
GGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTCGCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTG
AATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACAAAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGG
TAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGACGTTGACCGGGGAGAGGAGAAGAAGGGGAAAGACCAATCTG
GAGAGGTATTGTCTTCAGTATGACTAGAAGATCGCACTGAAAGCAGACAAGACTCCTTAGAACTGTCCTCAGATTTCCTTCCACCCATTA
AGGAAACAGATTTGTTATAAATTAGAAATGTGCAGGTTTGTTGTTTCATGTCATATTACTCAGTCTAAACAATAAATATTTCATAATTTA
CAAAGGAGGAACGGAAGAAACCTATTGTGAATTCCAAATCTAAAAAAAGAAATATTTTTAAAATGTTCTTAAGCAAATATATACCTATTT
TATCTAGTTACCTTTCATTAACAACCAATTTTAACCGTGTGTCAAGATTTGGTTAAGTCTTGCCTGACAGAACTCAAAGACACGTCTATC
AGCTTATTCCTTCTCTACTGGAATATTGGTATAGTCAATTCTTATTTGAATATTTATTCTATTAAACTGAGTTTAACAATGGCAAAATAC
AGTATGTCACAGTCATGCACATTCAAGAGAGAAAATATAACAAGTTCTTTTATGAGCAATCCCTTATGCATAGACTACCTTGGCAAAAGA
GCATTAGCAAGTGTCACTGCTCATCAGTTACTTCCTTCCATTTATATCACAAATACCCAAGTTTCAATTCTAACTTCATTTCATGGTATT
TCTTCCTCCTCAATGCCCAAGGTAATGTGGGACTAAAGCCCAGAAATTTGAAAAGAATATTCAGAAATCCTTCCCAAATCATAAGGGCAC
CTATTGAGATTCAAGACAAGCAGACTCGTAAAATCTTGTAGAGGCAGAGGCAAAGTTATCATCATACAAAAATCACAAACAAAAAGGAGA
TCTGTATTCGGGTATCAAACGGTTGATCTGTTTTCAGTGCACACCCTCAAATGCACCACACCAGTTTTACGATCTAAGCTTTTAACCCCT
TTACCACTTTGCTTATTTTTAAAAAATTTATTGGCAAAACTGGGGATTTTGTTTGTAACTTTGGTTATCTATATTTAAACATTAGCTGAG
ACATATTTTTGATAACAAGAACTTAGCTAGTTGAGTCCTGGCTTTTTGTTGATTATTAAGCTGTGTTCACTCTAGAAGGTGTAAAGGCCC
TGTCCCAATCTCTGCTCTCTCACTTCTCGTGACATTTGTTGATAATCTTTACTGCAAGTGTAATGATATTTGAGTGAATTAAAATGCATG
ACAGACAAGGTACAACATGGTTGCAGAATAAAAGGGTGAGGACATCAGATCACTCTGTATTCAAAGCTTACTAGACGAACAATCTTTCAT
TTCTGGATATATTGTAGCTAACCCAACACATTTTTAAACTATTTTTGTTACTGACTCACTTACTTGTCAAAATAATTGGTTTTTCTGTCC
TGCTTTGCCTTTTGTCACTAGAATGTTCTCCAGAAACCCCAGTTTCTGTCATCTTAACTGTCTAGTCTAGCCGTTAACTTAGACAAAGAA
GTGCAAATGTCAATTTCACTAAACAAAAGCTATTAGAAGTAAAGCAGAAACCTATCACTGCAAGGAGTGACTTGTAAATAACTGATGATC
AAGGGCTGTCTTCTCTCAAGCATGGTTCCAACTCTGTGTCACTTTTTAGCGTTAATGGCAGTTGTGTGTCTGTGGCAGTGAGATAATGGA
CCACTATTAAACCTGATTCTCTTCGGTGCTAGGAAAGAGTGATGTGTGAGATTCCCAGAGAGTCGTCACACCAGTGTTATGCCTGGGAGT
GCCACTGGCATACCGCAGGTGCCTAAATCCCAGGCCCCTTTCTCAGGGGGCGTGGCCACACCACACACTGCGCCAGTGACACATAGTTAC
TTCCTGGCTGGGACGGCACCTATAGAAACTAGGGTACAAATCTCCCAAAGATGGTTTGCACCGTCATTTCAAATGTTTGCACAATATACC
ACTTAGAGGCTTAAAATCAGGGTGGTTCAGTTCAAAAGGTAATATCAACCGTCAGCAAACATGTCAGTTTAAAAATAAGTTCGGTTAACA
AGGAAGTGTTAAGCAGATTTTTTGAATACACTTACAATATACTGGCTTATAATCATTTTTATTCTGCCATATGGTTTATTTCATATACAC
TCACTTTTACACTCACTTCCAATTATAGCATTCAATAAGTTACGGTTAAAGAAAAGTGAATGGTGTTTTTGTAATTTGTTTTCTAGTAGC
TAGCAGAGAGCCTGGCACATAGTATGTATTCAAAACAAGTGTGTTAATTAATAAAAATATATAAATCTCATTTGAGATTTAAGAATATAA
ATAATTTTCTTTTAATCTTTATTTTGCTCAATATTTAATAGGAAGTATGATTTCAAGGACTACTAAAGGAAGGCAATATACATGTGAAAA
CCATAAAATACATTTTTTGCATTCTACTATTTTTAGGGGCATGAAATGAATGAAAGCTTTAGCACTTTTTTGCCCCTACATATGAGACAA
CATATTTTGTATTTCACTCAAGGCTCTGCCAGTAAAAAGTAATGAAATTGTACCTTTCTAATGACATCTATGCAGCAGGGGTCTATCGCC
TTGTGGATGGCACCAAATTATCCAAGTGTATTAGGAGACTGGGGCTTTTTTCTTTAATCCCTTCTTATTAATGAAGTGCATAGTGCTGCT
CCCAGGAGACCACTGCTGACAGATACACAGAGAAGAGATCAGAGAGGAAAAACTGGGAAGACATAAATGAATTATACCCAGCCATGAAAC
AATGCCAACTGTCTCTTCCCTAAGGAAGAGTACAAGTACCCTAAAATTGAAAGGTGGTCCCTACACTGAAAACGCACATAGTTTGTCAAA
AGTGTACAAAAGGGAAAGAGTCTTATTTTAAGCTTTCAGGCTTTCTTAAAAACTTGGGGACCAGAATTTCAATGTATGTTTCCATTGTTG
AAGATAACATTTTCTTCAAAGAGCCTTAACCTTTTGTACTGGAAGGAAATATTTTCTGGACTTAAGTAGTTGCCTAAATTTAAGATTCCT
ACACTTTATTTCTGCCATTGATGCTTTTCCTAAACCCTTATACTATCTTTTTATTATCTGAGCCTTTTCCTAATGCAGCTCATAGGTGCT
AGCTAGAGCTGCTGCTCAGTATTGAAGACTTTACAAGGAGATTAGAAATCTTTGGAAAACATATGTGATGAAATTGAGCTATATGATTTA
TCAGAGATCTGATTCCAAAGAGCACAGAATACTGTTCTCAGACCATGAAACCAGACAACACATGTATTGGTTTAAACTCGATAATGACAG
GAAAATTCCAAACTAGAGCAGTAAATTCAAATGGTAAGATGAATCCTAGAAGGCCTCTGATTGCAGCATGTTGACACCAACCTCACGTTA
CGAACAATTCACAGAGAATTTGCCTTTGTGGCAACTGAAGATGGAAGTCTGGGGGGCACAGACAACCTTATCAAACAATATAAAAGCCAA
TATAAATTCTCATAAGCACTATAGAATTTGCAAATTCAGAACATTTTATACCTAAAAGTAATTCTGTCTTTCCTAAAGTGTTTTTAACAT
GAAAATTAGTAGGAAGATGTGGTTACTATTTGGAAAGTGTAATGTAACAAAACTCTCTTTTGTTACCACAAATTTTGTGAGTTTAGTACT
CTACAGATTGCCCCATAAGAGCAGTAGCTTTTGAAACTCATAATTCTCTGAAATAAATGAAAGACATTTAATTCAAGGATCAAAAATTGT
GGCCATCTTTGCAAATGACTACCTATAGCCTGTGAAAATACATTTCAAAAAATGTTATGTGCAATGAACACTAAATTTAAGAGCAGTTAC
AGTGTGACTCACTCATGTTTAAAAAAAATCGAAGAGCTAAAAAATACGTCTAATTTATGTAACCCATTGGAATGTATTTCTAGGTTCTCT
TCAGGATTAATTAAATAAACATGCAATTTATGAAAACATATAAACAATTATTTATCACTTTTATGACCCAAATCACAATAAAATTGTCAT
TTAGGATAAACTGGGGAGAATAGACTGAACATATGGTTATATTCACAGTTATTTATTAACTTAAATGTTATTCCAACATTAGAGCTAATG
TTAAAAAGATTTAAACTGTAACGTCTAATATTTGGAATAATATATTAAAGTATTAGCACTGTGGTTGATTTTCTTGAATTATGTTGCATC

>In-frame_STAMBP_ENST00000409707_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_5363nt
TTTCCGGAACCTCCGGGTGTCATCCGCGGGGAAAGAACTTGGTCCTGATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGG
TGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGACATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCC
GAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTCATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTA
CCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCTTTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTT
TTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAAAAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTG
GACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGTGGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCA
GGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGCCTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACAC
CTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAATCTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACAT
TTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACTGATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTG
CAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAATCCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGG
AAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTCGCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAAT
TCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACAAAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAG
AGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGACGTTGACCGGGGAGAGGAGAAGAAGGGGAAAGACCAATCTGGAG
AGGTATTGTCTTCAGTATGACTAGAAGATCGCACTGAAAGCAGACAAGACTCCTTAGAACTGTCCTCAGATTTCCTTCCACCCATTAAGG
AAACAGATTTGTTATAAATTAGAAATGTGCAGGTTTGTTGTTTCATGTCATATTACTCAGTCTAAACAATAAATATTTCATAATTTACAA
AGGAGGAACGGAAGAAACCTATTGTGAATTCCAAATCTAAAAAAAGAAATATTTTTAAAATGTTCTTAAGCAAATATATACCTATTTTAT
CTAGTTACCTTTCATTAACAACCAATTTTAACCGTGTGTCAAGATTTGGTTAAGTCTTGCCTGACAGAACTCAAAGACACGTCTATCAGC
TTATTCCTTCTCTACTGGAATATTGGTATAGTCAATTCTTATTTGAATATTTATTCTATTAAACTGAGTTTAACAATGGCAAAATACAGT
ATGTCACAGTCATGCACATTCAAGAGAGAAAATATAACAAGTTCTTTTATGAGCAATCCCTTATGCATAGACTACCTTGGCAAAAGAGCA
TTAGCAAGTGTCACTGCTCATCAGTTACTTCCTTCCATTTATATCACAAATACCCAAGTTTCAATTCTAACTTCATTTCATGGTATTTCT
TCCTCCTCAATGCCCAAGGTAATGTGGGACTAAAGCCCAGAAATTTGAAAAGAATATTCAGAAATCCTTCCCAAATCATAAGGGCACCTA
TTGAGATTCAAGACAAGCAGACTCGTAAAATCTTGTAGAGGCAGAGGCAAAGTTATCATCATACAAAAATCACAAACAAAAAGGAGATCT
GTATTCGGGTATCAAACGGTTGATCTGTTTTCAGTGCACACCCTCAAATGCACCACACCAGTTTTACGATCTAAGCTTTTAACCCCTTTA
CCACTTTGCTTATTTTTAAAAAATTTATTGGCAAAACTGGGGATTTTGTTTGTAACTTTGGTTATCTATATTTAAACATTAGCTGAGACA
TATTTTTGATAACAAGAACTTAGCTAGTTGAGTCCTGGCTTTTTGTTGATTATTAAGCTGTGTTCACTCTAGAAGGTGTAAAGGCCCTGT
CCCAATCTCTGCTCTCTCACTTCTCGTGACATTTGTTGATAATCTTTACTGCAAGTGTAATGATATTTGAGTGAATTAAAATGCATGACA
GACAAGGTACAACATGGTTGCAGAATAAAAGGGTGAGGACATCAGATCACTCTGTATTCAAAGCTTACTAGACGAACAATCTTTCATTTC
TGGATATATTGTAGCTAACCCAACACATTTTTAAACTATTTTTGTTACTGACTCACTTACTTGTCAAAATAATTGGTTTTTCTGTCCTGC
TTTGCCTTTTGTCACTAGAATGTTCTCCAGAAACCCCAGTTTCTGTCATCTTAACTGTCTAGTCTAGCCGTTAACTTAGACAAAGAAGTG
CAAATGTCAATTTCACTAAACAAAAGCTATTAGAAGTAAAGCAGAAACCTATCACTGCAAGGAGTGACTTGTAAATAACTGATGATCAAG
GGCTGTCTTCTCTCAAGCATGGTTCCAACTCTGTGTCACTTTTTAGCGTTAATGGCAGTTGTGTGTCTGTGGCAGTGAGATAATGGACCA
CTATTAAACCTGATTCTCTTCGGTGCTAGGAAAGAGTGATGTGTGAGATTCCCAGAGAGTCGTCACACCAGTGTTATGCCTGGGAGTGCC
ACTGGCATACCGCAGGTGCCTAAATCCCAGGCCCCTTTCTCAGGGGGCGTGGCCACACCACACACTGCGCCAGTGACACATAGTTACTTC
CTGGCTGGGACGGCACCTATAGAAACTAGGGTACAAATCTCCCAAAGATGGTTTGCACCGTCATTTCAAATGTTTGCACAATATACCACT
TAGAGGCTTAAAATCAGGGTGGTTCAGTTCAAAAGGTAATATCAACCGTCAGCAAACATGTCAGTTTAAAAATAAGTTCGGTTAACAAGG
AAGTGTTAAGCAGATTTTTTGAATACACTTACAATATACTGGCTTATAATCATTTTTATTCTGCCATATGGTTTATTTCATATACACTCA
CTTTTACACTCACTTCCAATTATAGCATTCAATAAGTTACGGTTAAAGAAAAGTGAATGGTGTTTTTGTAATTTGTTTTCTAGTAGCTAG
CAGAGAGCCTGGCACATAGTATGTATTCAAAACAAGTGTGTTAATTAATAAAAATATATAAATCTCATTTGAGATTTAAGAATATAAATA
ATTTTCTTTTAATCTTTATTTTGCTCAATATTTAATAGGAAGTATGATTTCAAGGACTACTAAAGGAAGGCAATATACATGTGAAAACCA
TAAAATACATTTTTTGCATTCTACTATTTTTAGGGGCATGAAATGAATGAAAGCTTTAGCACTTTTTTGCCCCTACATATGAGACAACAT
ATTTTGTATTTCACTCAAGGCTCTGCCAGTAAAAAGTAATGAAATTGTACCTTTCTAATGACATCTATGCAGCAGGGGTCTATCGCCTTG
TGGATGGCACCAAATTATCCAAGTGTATTAGGAGACTGGGGCTTTTTTCTTTAATCCCTTCTTATTAATGAAGTGCATAGTGCTGCTCCC
AGGAGACCACTGCTGACAGATACACAGAGAAGAGATCAGAGAGGAAAAACTGGGAAGACATAAATGAATTATACCCAGCCATGAAACAAT
GCCAACTGTCTCTTCCCTAAGGAAGAGTACAAGTACCCTAAAATTGAAAGGTGGTCCCTACACTGAAAACGCACATAGTTTGTCAAAAGT
GTACAAAAGGGAAAGAGTCTTATTTTAAGCTTTCAGGCTTTCTTAAAAACTTGGGGACCAGAATTTCAATGTATGTTTCCATTGTTGAAG
ATAACATTTTCTTCAAAGAGCCTTAACCTTTTGTACTGGAAGGAAATATTTTCTGGACTTAAGTAGTTGCCTAAATTTAAGATTCCTACA
CTTTATTTCTGCCATTGATGCTTTTCCTAAACCCTTATACTATCTTTTTATTATCTGAGCCTTTTCCTAATGCAGCTCATAGGTGCTAGC
TAGAGCTGCTGCTCAGTATTGAAGACTTTACAAGGAGATTAGAAATCTTTGGAAAACATATGTGATGAAATTGAGCTATATGATTTATCA
GAGATCTGATTCCAAAGAGCACAGAATACTGTTCTCAGACCATGAAACCAGACAACACATGTATTGGTTTAAACTCGATAATGACAGGAA
AATTCCAAACTAGAGCAGTAAATTCAAATGGTAAGATGAATCCTAGAAGGCCTCTGATTGCAGCATGTTGACACCAACCTCACGTTACGA
ACAATTCACAGAGAATTTGCCTTTGTGGCAACTGAAGATGGAAGTCTGGGGGGCACAGACAACCTTATCAAACAATATAAAAGCCAATAT
AAATTCTCATAAGCACTATAGAATTTGCAAATTCAGAACATTTTATACCTAAAAGTAATTCTGTCTTTCCTAAAGTGTTTTTAACATGAA
AATTAGTAGGAAGATGTGGTTACTATTTGGAAAGTGTAATGTAACAAAACTCTCTTTTGTTACCACAAATTTTGTGAGTTTAGTACTCTA
CAGATTGCCCCATAAGAGCAGTAGCTTTTGAAACTCATAATTCTCTGAAATAAATGAAAGACATTTAATTCAAGGATCAAAAATTGTGGC
CATCTTTGCAAATGACTACCTATAGCCTGTGAAAATACATTTCAAAAAATGTTATGTGCAATGAACACTAAATTTAAGAGCAGTTACAGT
GTGACTCACTCATGTTTAAAAAAAATCGAAGAGCTAAAAAATACGTCTAATTTATGTAACCCATTGGAATGTATTTCTAGGTTCTCTTCA
GGATTAATTAAATAAACATGCAATTTATGAAAACATATAAACAATTATTTATCACTTTTATGACCCAAATCACAATAAAATTGTCATTTA
GGATAAACTGGGGAGAATAGACTGAACATATGGTTATATTCACAGTTATTTATTAACTTAAATGTTATTCCAACATTAGAGCTAATGTTA
AAAAGATTTAAACTGTAACGTCTAATATTTGGAATAATATATTAAAGTATTAGCACTGTGGTTGATTTTCTTGAATTATGTTGCATCTTG

>In-frame_STAMBP_ENST00000394073_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_5505nt
GGGAAGGGTCCCGGGAACGTGGTGGGGCAGGGCCTCCGAGCGTGGTTGGACTTTGAAGGGGATCGGCCGCCATGCTGCATCCCCTTTTTG
GAATTGCTCAACCAGGTGGTAACCGGCGCCGCTTCCTGGCCTTGGGAGGTGGTTCCTTTCTTAACCCACAAGAACCTCTCCCAAGAGAAC
TTGGTCCTGATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTG
AATGAAGACATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAA
CATGCCTTCATCCTCTATAACAAGTATATCACTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGG
ACTCAAGCTTTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGT
GGAACAGAAAAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCAT
ATCAGCGGTGGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCA
GCCCAGTGCCTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTT
CATGGAAATCTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCC
AAACGGACTGATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCC
AGCATGAATCCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGA
GCTGTCCTCGCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCC
CAGCAAACAAAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCAT
GTGATTGACGTTGACCGGGGAGAGGAGAAGAAGGGGAAAGACCAATCTGGAGAGGTATTGTCTTCAGTATGACTAGAAGATCGCACTGAA
AGCAGACAAGACTCCTTAGAACTGTCCTCAGATTTCCTTCCACCCATTAAGGAAACAGATTTGTTATAAATTAGAAATGTGCAGGTTTGT
TGTTTCATGTCATATTACTCAGTCTAAACAATAAATATTTCATAATTTACAAAGGAGGAACGGAAGAAACCTATTGTGAATTCCAAATCT
AAAAAAAGAAATATTTTTAAAATGTTCTTAAGCAAATATATACCTATTTTATCTAGTTACCTTTCATTAACAACCAATTTTAACCGTGTG
TCAAGATTTGGTTAAGTCTTGCCTGACAGAACTCAAAGACACGTCTATCAGCTTATTCCTTCTCTACTGGAATATTGGTATAGTCAATTC
TTATTTGAATATTTATTCTATTAAACTGAGTTTAACAATGGCAAAATACAGTATGTCACAGTCATGCACATTCAAGAGAGAAAATATAAC
AAGTTCTTTTATGAGCAATCCCTTATGCATAGACTACCTTGGCAAAAGAGCATTAGCAAGTGTCACTGCTCATCAGTTACTTCCTTCCAT
TTATATCACAAATACCCAAGTTTCAATTCTAACTTCATTTCATGGTATTTCTTCCTCCTCAATGCCCAAGGTAATGTGGGACTAAAGCCC
AGAAATTTGAAAAGAATATTCAGAAATCCTTCCCAAATCATAAGGGCACCTATTGAGATTCAAGACAAGCAGACTCGTAAAATCTTGTAG
AGGCAGAGGCAAAGTTATCATCATACAAAAATCACAAACAAAAAGGAGATCTGTATTCGGGTATCAAACGGTTGATCTGTTTTCAGTGCA
CACCCTCAAATGCACCACACCAGTTTTACGATCTAAGCTTTTAACCCCTTTACCACTTTGCTTATTTTTAAAAAATTTATTGGCAAAACT
GGGGATTTTGTTTGTAACTTTGGTTATCTATATTTAAACATTAGCTGAGACATATTTTTGATAACAAGAACTTAGCTAGTTGAGTCCTGG
CTTTTTGTTGATTATTAAGCTGTGTTCACTCTAGAAGGTGTAAAGGCCCTGTCCCAATCTCTGCTCTCTCACTTCTCGTGACATTTGTTG
ATAATCTTTACTGCAAGTGTAATGATATTTGAGTGAATTAAAATGCATGACAGACAAGGTACAACATGGTTGCAGAATAAAAGGGTGAGG
ACATCAGATCACTCTGTATTCAAAGCTTACTAGACGAACAATCTTTCATTTCTGGATATATTGTAGCTAACCCAACACATTTTTAAACTA
TTTTTGTTACTGACTCACTTACTTGTCAAAATAATTGGTTTTTCTGTCCTGCTTTGCCTTTTGTCACTAGAATGTTCTCCAGAAACCCCA
GTTTCTGTCATCTTAACTGTCTAGTCTAGCCGTTAACTTAGACAAAGAAGTGCAAATGTCAATTTCACTAAACAAAAGCTATTAGAAGTA
AAGCAGAAACCTATCACTGCAAGGAGTGACTTGTAAATAACTGATGATCAAGGGCTGTCTTCTCTCAAGCATGGTTCCAACTCTGTGTCA
CTTTTTAGCGTTAATGGCAGTTGTGTGTCTGTGGCAGTGAGATAATGGACCACTATTAAACCTGATTCTCTTCGGTGCTAGGAAAGAGTG
ATGTGTGAGATTCCCAGAGAGTCGTCACACCAGTGTTATGCCTGGGAGTGCCACTGGCATACCGCAGGTGCCTAAATCCCAGGCCCCTTT
CTCAGGGGGCGTGGCCACACCACACACTGCGCCAGTGACACATAGTTACTTCCTGGCTGGGACGGCACCTATAGAAACTAGGGTACAAAT
CTCCCAAAGATGGTTTGCACCGTCATTTCAAATGTTTGCACAATATACCACTTAGAGGCTTAAAATCAGGGTGGTTCAGTTCAAAAGGTA
ATATCAACCGTCAGCAAACATGTCAGTTTAAAAATAAGTTCGGTTAACAAGGAAGTGTTAAGCAGATTTTTTGAATACACTTACAATATA
CTGGCTTATAATCATTTTTATTCTGCCATATGGTTTATTTCATATACACTCACTTTTACACTCACTTCCAATTATAGCATTCAATAAGTT
ACGGTTAAAGAAAAGTGAATGGTGTTTTTGTAATTTGTTTTCTAGTAGCTAGCAGAGAGCCTGGCACATAGTATGTATTCAAAACAAGTG
TGTTAATTAATAAAAATATATAAATCTCATTTGAGATTTAAGAATATAAATAATTTTCTTTTAATCTTTATTTTGCTCAATATTTAATAG
GAAGTATGATTTCAAGGACTACTAAAGGAAGGCAATATACATGTGAAAACCATAAAATACATTTTTTGCATTCTACTATTTTTAGGGGCA
TGAAATGAATGAAAGCTTTAGCACTTTTTTGCCCCTACATATGAGACAACATATTTTGTATTTCACTCAAGGCTCTGCCAGTAAAAAGTA
ATGAAATTGTACCTTTCTAATGACATCTATGCAGCAGGGGTCTATCGCCTTGTGGATGGCACCAAATTATCCAAGTGTATTAGGAGACTG
GGGCTTTTTTCTTTAATCCCTTCTTATTAATGAAGTGCATAGTGCTGCTCCCAGGAGACCACTGCTGACAGATACACAGAGAAGAGATCA
GAGAGGAAAAACTGGGAAGACATAAATGAATTATACCCAGCCATGAAACAATGCCAACTGTCTCTTCCCTAAGGAAGAGTACAAGTACCC
TAAAATTGAAAGGTGGTCCCTACACTGAAAACGCACATAGTTTGTCAAAAGTGTACAAAAGGGAAAGAGTCTTATTTTAAGCTTTCAGGC
TTTCTTAAAAACTTGGGGACCAGAATTTCAATGTATGTTTCCATTGTTGAAGATAACATTTTCTTCAAAGAGCCTTAACCTTTTGTACTG
GAAGGAAATATTTTCTGGACTTAAGTAGTTGCCTAAATTTAAGATTCCTACACTTTATTTCTGCCATTGATGCTTTTCCTAAACCCTTAT
ACTATCTTTTTATTATCTGAGCCTTTTCCTAATGCAGCTCATAGGTGCTAGCTAGAGCTGCTGCTCAGTATTGAAGACTTTACAAGGAGA
TTAGAAATCTTTGGAAAACATATGTGATGAAATTGAGCTATATGATTTATCAGAGATCTGATTCCAAAGAGCACAGAATACTGTTCTCAG
ACCATGAAACCAGACAACACATGTATTGGTTTAAACTCGATAATGACAGGAAAATTCCAAACTAGAGCAGTAAATTCAAATGGTAAGATG
AATCCTAGAAGGCCTCTGATTGCAGCATGTTGACACCAACCTCACGTTACGAACAATTCACAGAGAATTTGCCTTTGTGGCAACTGAAGA
TGGAAGTCTGGGGGGCACAGACAACCTTATCAAACAATATAAAAGCCAATATAAATTCTCATAAGCACTATAGAATTTGCAAATTCAGAA
CATTTTATACCTAAAAGTAATTCTGTCTTTCCTAAAGTGTTTTTAACATGAAAATTAGTAGGAAGATGTGGTTACTATTTGGAAAGTGTA
ATGTAACAAAACTCTCTTTTGTTACCACAAATTTTGTGAGTTTAGTACTCTACAGATTGCCCCATAAGAGCAGTAGCTTTTGAAACTCAT
AATTCTCTGAAATAAATGAAAGACATTTAATTCAAGGATCAAAAATTGTGGCCATCTTTGCAAATGACTACCTATAGCCTGTGAAAATAC
ATTTCAAAAAATGTTATGTGCAATGAACACTAAATTTAAGAGCAGTTACAGTGTGACTCACTCATGTTTAAAAAAAATCGAAGAGCTAAA
AAATACGTCTAATTTATGTAACCCATTGGAATGTATTTCTAGGTTCTCTTCAGGATTAATTAAATAAACATGCAATTTATGAAAACATAT
AAACAATTATTTATCACTTTTATGACCCAAATCACAATAAAATTGTCATTTAGGATAAACTGGGGAGAATAGACTGAACATATGGTTATA
TTCACAGTTATTTATTAACTTAAATGTTATTCCAACATTAGAGCTAATGTTAAAAAGATTTAAACTGTAACGTCTAATATTTGGAATAAT
ATATTAAAGTATTAGCACTGTGGTTGATTTTCTTGAATTATGTTGCATCTTGTACTACTAAGCTTGTGAAAATAAACATTTGGATGTTTT

>In-frame_STAMBP_ENST00000394070_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_5819nt
GGTGGGGCAGGGCCTCCGAGCGTGGTTGGACTTTGAAGGGGATCGGCCGCCGTGAGTGTGGGGCCTGCAGCCTACTCTCCCCGAGTCCCC
TGCCCGGCCTGCCTCGCTCGAGGCACCCGACGGCTTCTGTCTCCGCGGGCTGGCGCCTGACCAGCCAGGCCCAGCGGTTCCCCGCCTACT
GCATTTGAAAGATCCCGAAAACCCTGGATGATTGTGCCTGGGGTTGGCAAGTTCGTCTTGAGTGCCTTCAAGAAGGGTTCCTCAAGCAGT
TGTCGATAGAGCCCTCCCTACTGTATACGCCCCCTCCGCTCATTCCTGCTACTTCCTTTCTCCTCCTCGTATTTCCCCCTCGGTCCTTTA
CGCCGCCTTTCCCCCTCATTTGCAGATGCTGCATCCCCTTTTTGGAATTGCTCAACCAGGTGGTAACCGGCGCCGCTTCCTGGCCTTGGG
AGGTGGTTCCTTTCTTAACCCACAAGAACCTCTCCCAAGAGAACTTGGTCCTGATGTCTGACCATGGAGATGTGAGCCTCCCGCCCGAAG
ACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGACATTCCACCCCGTCGGTACTTCCGCTCTGGAGTTGAGA
TTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTCATCCTCTATAACAAGTATATCACTAAGTGTGGACCTT
TGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCTTTCTGGAAAGCAGTCACAGCGGAATTTCTGGCCATGC
TTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAAAAGCCTTTACCGGTCGACATGGTTCTCATCTCCCTTT
GCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGTGGCCACATCAACCCTGCAGTGACTGTGGCCATGGTGT
GCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGCCTGGGGGCCATCATTGGAGCAGGAATCCTCTATCTGG
TCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAATCTTACCGCTGGTCATGGTCTCCTGGTTGAGTTGATAA
TCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACTGATGTCACTGGCTCAATAGCTTTAGCAATTGGATTTT
CTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAATCCCGCCCGATCCTTTGGACCTGCAGTTATCATGGGAA
ATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTCGCTGGTGGCCTTTATGAGTATGTCTTCTGTCCAGATG
TTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACAAAAGGAAGCTACATGGAGGTGGAGGACAACAGGAGTC
AGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGACGTTGACCGGGGAGAGGAGAAGAAGGGGAAAGACCAAT
CTGGAGAGGTATTGTCTTCAGTATGACTAGAAGATCGCACTGAAAGCAGACAAGACTCCTTAGAACTGTCCTCAGATTTCCTTCCACCCA
TTAAGGAAACAGATTTGTTATAAATTAGAAATGTGCAGGTTTGTTGTTTCATGTCATATTACTCAGTCTAAACAATAAATATTTCATAAT
TTACAAAGGAGGAACGGAAGAAACCTATTGTGAATTCCAAATCTAAAAAAAGAAATATTTTTAAAATGTTCTTAAGCAAATATATACCTA
TTTTATCTAGTTACCTTTCATTAACAACCAATTTTAACCGTGTGTCAAGATTTGGTTAAGTCTTGCCTGACAGAACTCAAAGACACGTCT
ATCAGCTTATTCCTTCTCTACTGGAATATTGGTATAGTCAATTCTTATTTGAATATTTATTCTATTAAACTGAGTTTAACAATGGCAAAA
TACAGTATGTCACAGTCATGCACATTCAAGAGAGAAAATATAACAAGTTCTTTTATGAGCAATCCCTTATGCATAGACTACCTTGGCAAA
AGAGCATTAGCAAGTGTCACTGCTCATCAGTTACTTCCTTCCATTTATATCACAAATACCCAAGTTTCAATTCTAACTTCATTTCATGGT
ATTTCTTCCTCCTCAATGCCCAAGGTAATGTGGGACTAAAGCCCAGAAATTTGAAAAGAATATTCAGAAATCCTTCCCAAATCATAAGGG
CACCTATTGAGATTCAAGACAAGCAGACTCGTAAAATCTTGTAGAGGCAGAGGCAAAGTTATCATCATACAAAAATCACAAACAAAAAGG
AGATCTGTATTCGGGTATCAAACGGTTGATCTGTTTTCAGTGCACACCCTCAAATGCACCACACCAGTTTTACGATCTAAGCTTTTAACC
CCTTTACCACTTTGCTTATTTTTAAAAAATTTATTGGCAAAACTGGGGATTTTGTTTGTAACTTTGGTTATCTATATTTAAACATTAGCT
GAGACATATTTTTGATAACAAGAACTTAGCTAGTTGAGTCCTGGCTTTTTGTTGATTATTAAGCTGTGTTCACTCTAGAAGGTGTAAAGG
CCCTGTCCCAATCTCTGCTCTCTCACTTCTCGTGACATTTGTTGATAATCTTTACTGCAAGTGTAATGATATTTGAGTGAATTAAAATGC
ATGACAGACAAGGTACAACATGGTTGCAGAATAAAAGGGTGAGGACATCAGATCACTCTGTATTCAAAGCTTACTAGACGAACAATCTTT
CATTTCTGGATATATTGTAGCTAACCCAACACATTTTTAAACTATTTTTGTTACTGACTCACTTACTTGTCAAAATAATTGGTTTTTCTG
TCCTGCTTTGCCTTTTGTCACTAGAATGTTCTCCAGAAACCCCAGTTTCTGTCATCTTAACTGTCTAGTCTAGCCGTTAACTTAGACAAA
GAAGTGCAAATGTCAATTTCACTAAACAAAAGCTATTAGAAGTAAAGCAGAAACCTATCACTGCAAGGAGTGACTTGTAAATAACTGATG
ATCAAGGGCTGTCTTCTCTCAAGCATGGTTCCAACTCTGTGTCACTTTTTAGCGTTAATGGCAGTTGTGTGTCTGTGGCAGTGAGATAAT
GGACCACTATTAAACCTGATTCTCTTCGGTGCTAGGAAAGAGTGATGTGTGAGATTCCCAGAGAGTCGTCACACCAGTGTTATGCCTGGG
AGTGCCACTGGCATACCGCAGGTGCCTAAATCCCAGGCCCCTTTCTCAGGGGGCGTGGCCACACCACACACTGCGCCAGTGACACATAGT
TACTTCCTGGCTGGGACGGCACCTATAGAAACTAGGGTACAAATCTCCCAAAGATGGTTTGCACCGTCATTTCAAATGTTTGCACAATAT
ACCACTTAGAGGCTTAAAATCAGGGTGGTTCAGTTCAAAAGGTAATATCAACCGTCAGCAAACATGTCAGTTTAAAAATAAGTTCGGTTA
ACAAGGAAGTGTTAAGCAGATTTTTTGAATACACTTACAATATACTGGCTTATAATCATTTTTATTCTGCCATATGGTTTATTTCATATA
CACTCACTTTTACACTCACTTCCAATTATAGCATTCAATAAGTTACGGTTAAAGAAAAGTGAATGGTGTTTTTGTAATTTGTTTTCTAGT
AGCTAGCAGAGAGCCTGGCACATAGTATGTATTCAAAACAAGTGTGTTAATTAATAAAAATATATAAATCTCATTTGAGATTTAAGAATA
TAAATAATTTTCTTTTAATCTTTATTTTGCTCAATATTTAATAGGAAGTATGATTTCAAGGACTACTAAAGGAAGGCAATATACATGTGA
AAACCATAAAATACATTTTTTGCATTCTACTATTTTTAGGGGCATGAAATGAATGAAAGCTTTAGCACTTTTTTGCCCCTACATATGAGA
CAACATATTTTGTATTTCACTCAAGGCTCTGCCAGTAAAAAGTAATGAAATTGTACCTTTCTAATGACATCTATGCAGCAGGGGTCTATC
GCCTTGTGGATGGCACCAAATTATCCAAGTGTATTAGGAGACTGGGGCTTTTTTCTTTAATCCCTTCTTATTAATGAAGTGCATAGTGCT
GCTCCCAGGAGACCACTGCTGACAGATACACAGAGAAGAGATCAGAGAGGAAAAACTGGGAAGACATAAATGAATTATACCCAGCCATGA
AACAATGCCAACTGTCTCTTCCCTAAGGAAGAGTACAAGTACCCTAAAATTGAAAGGTGGTCCCTACACTGAAAACGCACATAGTTTGTC
AAAAGTGTACAAAAGGGAAAGAGTCTTATTTTAAGCTTTCAGGCTTTCTTAAAAACTTGGGGACCAGAATTTCAATGTATGTTTCCATTG
TTGAAGATAACATTTTCTTCAAAGAGCCTTAACCTTTTGTACTGGAAGGAAATATTTTCTGGACTTAAGTAGTTGCCTAAATTTAAGATT
CCTACACTTTATTTCTGCCATTGATGCTTTTCCTAAACCCTTATACTATCTTTTTATTATCTGAGCCTTTTCCTAATGCAGCTCATAGGT
GCTAGCTAGAGCTGCTGCTCAGTATTGAAGACTTTACAAGGAGATTAGAAATCTTTGGAAAACATATGTGATGAAATTGAGCTATATGAT
TTATCAGAGATCTGATTCCAAAGAGCACAGAATACTGTTCTCAGACCATGAAACCAGACAACACATGTATTGGTTTAAACTCGATAATGA
CAGGAAAATTCCAAACTAGAGCAGTAAATTCAAATGGTAAGATGAATCCTAGAAGGCCTCTGATTGCAGCATGTTGACACCAACCTCACG
TTACGAACAATTCACAGAGAATTTGCCTTTGTGGCAACTGAAGATGGAAGTCTGGGGGGCACAGACAACCTTATCAAACAATATAAAAGC
CAATATAAATTCTCATAAGCACTATAGAATTTGCAAATTCAGAACATTTTATACCTAAAAGTAATTCTGTCTTTCCTAAAGTGTTTTTAA
CATGAAAATTAGTAGGAAGATGTGGTTACTATTTGGAAAGTGTAATGTAACAAAACTCTCTTTTGTTACCACAAATTTTGTGAGTTTAGT
ACTCTACAGATTGCCCCATAAGAGCAGTAGCTTTTGAAACTCATAATTCTCTGAAATAAATGAAAGACATTTAATTCAAGGATCAAAAAT
TGTGGCCATCTTTGCAAATGACTACCTATAGCCTGTGAAAATACATTTCAAAAAATGTTATGTGCAATGAACACTAAATTTAAGAGCAGT
TACAGTGTGACTCACTCATGTTTAAAAAAAATCGAAGAGCTAAAAAATACGTCTAATTTATGTAACCCATTGGAATGTATTTCTAGGTTC
TCTTCAGGATTAATTAAATAAACATGCAATTTATGAAAACATATAAACAATTATTTATCACTTTTATGACCCAAATCACAATAAAATTGT
CATTTAGGATAAACTGGGGAGAATAGACTGAACATATGGTTATATTCACAGTTATTTATTAACTTAAATGTTATTCCAACATTAGAGCTA
ATGTTAAAAAGATTTAAACTGTAACGTCTAATATTTGGAATAATATATTAAAGTATTAGCACTGTGGTTGATTTTCTTGAATTATGTTGC

>In-frame_STAMBP_ENST00000536064_chr2_74058186_+_AQP4_ENST00000383168_chr18_24442560_-_5474nt
GCCTCCGAGCGTGGTTGGACTTTGAAGGGGATCGGCCGCCATGCTGCATCCCCTTTTTGGAATTGCTCAACCAGGTGGTAACCGGCGCCG
CTTCCTGGCCTTGGGAGGTGGTTCCTTTCTTAACCCACAAGAACCTCTCCCAAGAGAACTTGGTCCTGATGTCTGACCATGGAGATGTGA
GCCTCCCGCCCGAAGACCGGGTGAGGGCTCTCTCCCAGCTGGGTAGTGCGGTAGAGGTGAATGAAGACATTCCACCCCGTCGGTACTTCC
GCTCTGGAGTTGAGATTATCCGAATGGCATCCATTTACTCTGAGGAAGGCAACATTGAACATGCCTTCATCCTCTATAACAAGTATATCA
CTAAGTGTGGACCTTTGTGTACCAGAGAGAACATCATGGTGGCTTTCAAAGGGGTCTGGACTCAAGCTTTCTGGAAAGCAGTCACAGCGG
AATTTCTGGCCATGCTTATTTTTGTTCTCCTCAGCCTGGGATCCACCATCAACTGGGGTGGAACAGAAAAGCCTTTACCGGTCGACATGG
TTCTCATCTCCCTTTGCTTTGGACTCAGCATTGCAACCATGGTGCAGTGCTTTGGCCATATCAGCGGTGGCCACATCAACCCTGCAGTGA
CTGTGGCCATGGTGTGCACCAGGAAGATCAGCATCGCCAAGTCTGTCTTCTACATCGCAGCCCAGTGCCTGGGGGCCATCATTGGAGCAG
GAATCCTCTATCTGGTCACACCTCCCAGTGTGGTGGGAGGCCTGGGAGTCACCATGGTTCATGGAAATCTTACCGCTGGTCATGGTCTCC
TGGTTGAGTTGATAATCACATTTCAATTGGTGTTTACTATCTTTGCCAGCTGTGATTCCAAACGGACTGATGTCACTGGCTCAATAGCTT
TAGCAATTGGATTTTCTGTTGCAATTGGACATTTATTTGCAATCAATTATACTGGTGCCAGCATGAATCCCGCCCGATCCTTTGGACCTG
CAGTTATCATGGGAAATTGGGAAAACCATTGGATATATTGGGTTGGGCCCATCATAGGAGCTGTCCTCGCTGGTGGCCTTTATGAGTATG
TCTTCTGTCCAGATGTTGAATTCAAACGTCGTTTTAAAGAAGCCTTCAGCAAAGCTGCCCAGCAAACAAAAGGAAGCTACATGGAGGTGG
AGGACAACAGGAGTCAGGTAGAGACGGATGACCTGATTCTAAAACCTGGAGTGGTGCATGTGATTGACGTTGACCGGGGAGAGGAGAAGA
AGGGGAAAGACCAATCTGGAGAGGTATTGTCTTCAGTATGACTAGAAGATCGCACTGAAAGCAGACAAGACTCCTTAGAACTGTCCTCAG
ATTTCCTTCCACCCATTAAGGAAACAGATTTGTTATAAATTAGAAATGTGCAGGTTTGTTGTTTCATGTCATATTACTCAGTCTAAACAA
TAAATATTTCATAATTTACAAAGGAGGAACGGAAGAAACCTATTGTGAATTCCAAATCTAAAAAAAGAAATATTTTTAAAATGTTCTTAA
GCAAATATATACCTATTTTATCTAGTTACCTTTCATTAACAACCAATTTTAACCGTGTGTCAAGATTTGGTTAAGTCTTGCCTGACAGAA
CTCAAAGACACGTCTATCAGCTTATTCCTTCTCTACTGGAATATTGGTATAGTCAATTCTTATTTGAATATTTATTCTATTAAACTGAGT
TTAACAATGGCAAAATACAGTATGTCACAGTCATGCACATTCAAGAGAGAAAATATAACAAGTTCTTTTATGAGCAATCCCTTATGCATA
GACTACCTTGGCAAAAGAGCATTAGCAAGTGTCACTGCTCATCAGTTACTTCCTTCCATTTATATCACAAATACCCAAGTTTCAATTCTA
ACTTCATTTCATGGTATTTCTTCCTCCTCAATGCCCAAGGTAATGTGGGACTAAAGCCCAGAAATTTGAAAAGAATATTCAGAAATCCTT
CCCAAATCATAAGGGCACCTATTGAGATTCAAGACAAGCAGACTCGTAAAATCTTGTAGAGGCAGAGGCAAAGTTATCATCATACAAAAA
TCACAAACAAAAAGGAGATCTGTATTCGGGTATCAAACGGTTGATCTGTTTTCAGTGCACACCCTCAAATGCACCACACCAGTTTTACGA
TCTAAGCTTTTAACCCCTTTACCACTTTGCTTATTTTTAAAAAATTTATTGGCAAAACTGGGGATTTTGTTTGTAACTTTGGTTATCTAT
ATTTAAACATTAGCTGAGACATATTTTTGATAACAAGAACTTAGCTAGTTGAGTCCTGGCTTTTTGTTGATTATTAAGCTGTGTTCACTC
TAGAAGGTGTAAAGGCCCTGTCCCAATCTCTGCTCTCTCACTTCTCGTGACATTTGTTGATAATCTTTACTGCAAGTGTAATGATATTTG
AGTGAATTAAAATGCATGACAGACAAGGTACAACATGGTTGCAGAATAAAAGGGTGAGGACATCAGATCACTCTGTATTCAAAGCTTACT
AGACGAACAATCTTTCATTTCTGGATATATTGTAGCTAACCCAACACATTTTTAAACTATTTTTGTTACTGACTCACTTACTTGTCAAAA
TAATTGGTTTTTCTGTCCTGCTTTGCCTTTTGTCACTAGAATGTTCTCCAGAAACCCCAGTTTCTGTCATCTTAACTGTCTAGTCTAGCC
GTTAACTTAGACAAAGAAGTGCAAATGTCAATTTCACTAAACAAAAGCTATTAGAAGTAAAGCAGAAACCTATCACTGCAAGGAGTGACT
TGTAAATAACTGATGATCAAGGGCTGTCTTCTCTCAAGCATGGTTCCAACTCTGTGTCACTTTTTAGCGTTAATGGCAGTTGTGTGTCTG
TGGCAGTGAGATAATGGACCACTATTAAACCTGATTCTCTTCGGTGCTAGGAAAGAGTGATGTGTGAGATTCCCAGAGAGTCGTCACACC
AGTGTTATGCCTGGGAGTGCCACTGGCATACCGCAGGTGCCTAAATCCCAGGCCCCTTTCTCAGGGGGCGTGGCCACACCACACACTGCG
CCAGTGACACATAGTTACTTCCTGGCTGGGACGGCACCTATAGAAACTAGGGTACAAATCTCCCAAAGATGGTTTGCACCGTCATTTCAA
ATGTTTGCACAATATACCACTTAGAGGCTTAAAATCAGGGTGGTTCAGTTCAAAAGGTAATATCAACCGTCAGCAAACATGTCAGTTTAA
AAATAAGTTCGGTTAACAAGGAAGTGTTAAGCAGATTTTTTGAATACACTTACAATATACTGGCTTATAATCATTTTTATTCTGCCATAT
GGTTTATTTCATATACACTCACTTTTACACTCACTTCCAATTATAGCATTCAATAAGTTACGGTTAAAGAAAAGTGAATGGTGTTTTTGT
AATTTGTTTTCTAGTAGCTAGCAGAGAGCCTGGCACATAGTATGTATTCAAAACAAGTGTGTTAATTAATAAAAATATATAAATCTCATT
TGAGATTTAAGAATATAAATAATTTTCTTTTAATCTTTATTTTGCTCAATATTTAATAGGAAGTATGATTTCAAGGACTACTAAAGGAAG
GCAATATACATGTGAAAACCATAAAATACATTTTTTGCATTCTACTATTTTTAGGGGCATGAAATGAATGAAAGCTTTAGCACTTTTTTG
CCCCTACATATGAGACAACATATTTTGTATTTCACTCAAGGCTCTGCCAGTAAAAAGTAATGAAATTGTACCTTTCTAATGACATCTATG
CAGCAGGGGTCTATCGCCTTGTGGATGGCACCAAATTATCCAAGTGTATTAGGAGACTGGGGCTTTTTTCTTTAATCCCTTCTTATTAAT
GAAGTGCATAGTGCTGCTCCCAGGAGACCACTGCTGACAGATACACAGAGAAGAGATCAGAGAGGAAAAACTGGGAAGACATAAATGAAT
TATACCCAGCCATGAAACAATGCCAACTGTCTCTTCCCTAAGGAAGAGTACAAGTACCCTAAAATTGAAAGGTGGTCCCTACACTGAAAA
CGCACATAGTTTGTCAAAAGTGTACAAAAGGGAAAGAGTCTTATTTTAAGCTTTCAGGCTTTCTTAAAAACTTGGGGACCAGAATTTCAA
TGTATGTTTCCATTGTTGAAGATAACATTTTCTTCAAAGAGCCTTAACCTTTTGTACTGGAAGGAAATATTTTCTGGACTTAAGTAGTTG
CCTAAATTTAAGATTCCTACACTTTATTTCTGCCATTGATGCTTTTCCTAAACCCTTATACTATCTTTTTATTATCTGAGCCTTTTCCTA
ATGCAGCTCATAGGTGCTAGCTAGAGCTGCTGCTCAGTATTGAAGACTTTACAAGGAGATTAGAAATCTTTGGAAAACATATGTGATGAA
ATTGAGCTATATGATTTATCAGAGATCTGATTCCAAAGAGCACAGAATACTGTTCTCAGACCATGAAACCAGACAACACATGTATTGGTT
TAAACTCGATAATGACAGGAAAATTCCAAACTAGAGCAGTAAATTCAAATGGTAAGATGAATCCTAGAAGGCCTCTGATTGCAGCATGTT
GACACCAACCTCACGTTACGAACAATTCACAGAGAATTTGCCTTTGTGGCAACTGAAGATGGAAGTCTGGGGGGCACAGACAACCTTATC
AAACAATATAAAAGCCAATATAAATTCTCATAAGCACTATAGAATTTGCAAATTCAGAACATTTTATACCTAAAAGTAATTCTGTCTTTC
CTAAAGTGTTTTTAACATGAAAATTAGTAGGAAGATGTGGTTACTATTTGGAAAGTGTAATGTAACAAAACTCTCTTTTGTTACCACAAA
TTTTGTGAGTTTAGTACTCTACAGATTGCCCCATAAGAGCAGTAGCTTTTGAAACTCATAATTCTCTGAAATAAATGAAAGACATTTAAT
TCAAGGATCAAAAATTGTGGCCATCTTTGCAAATGACTACCTATAGCCTGTGAAAATACATTTCAAAAAATGTTATGTGCAATGAACACT
AAATTTAAGAGCAGTTACAGTGTGACTCACTCATGTTTAAAAAAAATCGAAGAGCTAAAAAATACGTCTAATTTATGTAACCCATTGGAA
TGTATTTCTAGGTTCTCTTCAGGATTAATTAAATAAACATGCAATTTATGAAAACATATAAACAATTATTTATCACTTTTATGACCCAAA
TCACAATAAAATTGTCATTTAGGATAAACTGGGGAGAATAGACTGAACATATGGTTATATTCACAGTTATTTATTAACTTAAATGTTATT
CCAACATTAGAGCTAATGTTAAAAAGATTTAAACTGTAACGTCTAATATTTGGAATAATATATTAAAGTATTAGCACTGTGGTTGATTTT


Top

FusionGenePPI for STAMBP_AQP4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STAMBPGRAP2, STAM2, RNF11, SMURF2, STAM, SMAD6, SMAD7, AFP, CLTA, GRB2, PIK3C2A, CLINT1, OTUB1, CHMP3, CHMP2A, CHMP1A, CHMP1B, CLTC, CHMP4A, CHMP4B, CHMP4C, UBC, UBE2S, TRAF6, CASR, ALAS1, AMN, UACA, CTNNBL1, MAP2K5, PJA1, USP21, USP28, TRIP13, NTPCR, CYP2C9, CHMP5, ITGA5, SPG7, FDPS, VAMP8, MAP3K2, TNFRSF1A, GJA1, ODF3L1, CLTCL1, GAK, CDKL3, PTPN11, CCDC58, PSMD7, GTSE1, RNASEH2B, KIF7, TP53, STAMBPL1, BMP2K, RALBP1, RDH12, AP2A1, VTI1B, SLC25A41, IGHG2, IL1RL2AQP4AP2M1, PSMD4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000339566+2101_12767425CHMP3
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394070+2101_12767425CHMP3
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394073+3111_12767425CHMP3
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000409707+2111_12767507CHMP3
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000339566+210227_23167425STAM
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394070+210227_23167425STAM
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000394073+311227_23167425STAM
HgeneSTAMBPchr2:74058186chr18:24442560ENST00000409707+211227_23167507STAM


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STAMBP_AQP4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STAMBP_AQP4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSTAMBPC0006111Brain Diseases1CTD_human
HgeneSTAMBPC0008073Developmental Disabilities1CTD_human
HgeneSTAMBPC0014544Epilepsy1CTD_human;HPO
HgeneSTAMBPC0025958Microcephaly1CTD_human
HgeneSTAMBPC1842180CAPILLARY MALFORMATION-ARTERIOVENOUS MALFORMATION (disorder)1CTD_human
HgeneSTAMBPC3280296Microcephaly-capillary malformation syndrome1ORPHANET;UNIPROT
TgeneAQP4C0011570Mental Depression2PSYGENET
TgeneAQP4C0027873Neuromyelitis Optica2CTD_human
TgeneAQP4C0036341Schizophrenia2PSYGENET
TgeneAQP4C0338715Drug-induced depressive state2PSYGENET
TgeneAQP4C0004352Autistic Disorder1CTD_human
TgeneAQP4C0011581Depressive disorder1PSYGENET
TgeneAQP4C0038220Status Epilepticus1CTD_human