FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36273

FusionGeneSummary for ST7_CAV1

check button Fusion gene summary
Fusion gene informationFusion gene name: ST7_CAV1
Fusion gene ID: 36273
HgeneTgene
Gene symbol

ST7

CAV1

Gene ID

29967

857

Gene nameLDL receptor related protein 12caveolin 1
SynonymsST7BSCL3|CGL3|LCCNS|MSTP085|PPH3|VIP21
Cytomap

8q22.3

7q31.2

Type of geneprotein-codingprotein-coding
Descriptionlow-density lipoprotein receptor-related protein 12suppressor of tumorigenicity 7 proteincaveolin-1caveolin 1, caveolae protein, 22kDacell growth-inhibiting protein 32
Modification date2018051920180527
UniProtAcc

Q9NRC1

Q03135

Ensembl transtripts involved in fusion geneENST00000393446, ENST00000265437, 
ENST00000393451, ENST00000393449, 
ENST00000323984, ENST00000432298, 
ENST00000422922, ENST00000487459, 
ENST00000393443, ENST00000393447, 
ENST00000393444, ENST00000465133, 
ENST00000341049, ENST00000393470, 
ENST00000405348, ENST00000393468, 
ENST00000393467, 
Fusion gene scores* DoF score14 X 7 X 10=9806 X 4 X 6=144
# samples 208
** MAII scorelog2(20/980*10)=-2.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/144*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ST7 [Title/Abstract] AND CAV1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneST7

GO:0001764

neuron migration

26639854

HgeneST7

GO:0031175

neuron projection development

26639854

TgeneCAV1

GO:0009617

response to bacterium

24625804

TgeneCAV1

GO:0030512

negative regulation of transforming growth factor beta receptor signaling pathway

25893292

TgeneCAV1

GO:0031295

T cell costimulation

17287217

TgeneCAV1

GO:0031623

receptor internalization

25893292

TgeneCAV1

GO:0032091

negative regulation of protein binding

16890161

TgeneCAV1

GO:0032570

response to progesterone

12388746

TgeneCAV1

GO:0033137

negative regulation of peptidyl-serine phosphorylation

18081315

TgeneCAV1

GO:0033138

positive regulation of peptidyl-serine phosphorylation

18081315

TgeneCAV1

GO:0043627

response to estrogen

12388746

TgeneCAV1

GO:0051480

regulation of cytosolic calcium ion concentration

19052258

TgeneCAV1

GO:0072584

caveolin-mediated endocytosis

19931615

TgeneCAV1

GO:1900027

regulation of ruffle assembly

24625804

TgeneCAV1

GO:2000535

regulation of entry of bacterium into host cell

24625804


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-0184-01AST7chr7

116593745

+CAV1chr7

116199000

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393446ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393446ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393446ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
Frame-shitENST00000393446ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393446ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000265437ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000265437ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000265437ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
Frame-shitENST00000265437ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000265437ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393451ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393451ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393451ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
Frame-shitENST00000393451ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393451ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393449ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393449ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393449ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
Frame-shitENST00000393449ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000393449ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000323984ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000323984ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000323984ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
Frame-shitENST00000323984ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
In-frameENST00000323984ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000432298ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000432298ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000432298ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000432298ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000432298ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000422922ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000422922ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000422922ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000422922ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000422922ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000487459ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000487459ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000487459ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000487459ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000487459ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393443ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393443ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393443ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393443ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393443ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393447ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393447ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393447ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393447ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393447ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393444ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393444ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393444ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393444ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000393444ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000465133ENST00000341049ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000465133ENST00000393470ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000465133ENST00000405348ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000465133ENST00000393468ST7chr7

116593745

+CAV1chr7

116199000

+
intron-3CDSENST00000465133ENST00000393467ST7chr7

116593745

+CAV1chr7

116199000

+

Top

FusionProtFeatures for ST7_CAV1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ST7

Q9NRC1

CAV1

Q03135

May act as a scaffolding protein within caveolarmembranes. Interacts directly with G-protein alpha subunits andcan functionally regulate their activity (By similarity). Involvedin the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cellproliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and mayregulate CTNNB1-mediated signaling through the Wnt pathway.Negatively regulates TGFB1-mediated activation of SMAD2/3 bymediating the internalization of TGFBR1 from membrane raftsleading to its subsequent degradation (PubMed:25893292). Mediatesthe recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae(PubMed:19262564). {ECO:0000250|UniProtKB:P49817,ECO:0000269|PubMed:11751885, ECO:0000269|PubMed:17287217,ECO:0000269|PubMed:19262564, ECO:0000269|PubMed:25893292}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneST7chr7:116593745chr7:116199000ENST00000265437+11615_3550586TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000393451+11515_3550555TransmembraneHelical
TgeneCAV1chr7:116593745chr7:116199000ENST00000341049+13105_12565179IntramembraneHelical
TgeneCAV1chr7:116593745chr7:116199000ENST00000393467+02105_12534148IntramembraneHelical
TgeneCAV1chr7:116593745chr7:116199000ENST00000393468+13105_12534148IntramembraneHelical
TgeneCAV1chr7:116593745chr7:116199000ENST00000405348+13105_12534148IntramembraneHelical
TgeneCAV1chr7:116593745chr7:116199000ENST00000341049+13126_17865179Topological domainCytoplasmic
TgeneCAV1chr7:116593745chr7:116199000ENST00000393467+02126_17834148Topological domainCytoplasmic
TgeneCAV1chr7:116593745chr7:116199000ENST00000393468+13126_17834148Topological domainCytoplasmic
TgeneCAV1chr7:116593745chr7:116199000ENST00000405348+13126_17834148Topological domainCytoplasmic

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneST7chr7:116593745chr7:116199000ENST00000265437+116512_53250586TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000265437+11662_8250586TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000393443+11615_35-205500TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000393443+116512_532-205500TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000393443+11662_82-205500TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000393451+115512_53250555TransmembraneHelical
HgeneST7chr7:116593745chr7:116199000ENST00000393451+11562_8250555TransmembraneHelical
TgeneCAV1chr7:116593745chr7:116199000ENST00000341049+132_9465179RegionRequired for homooligomerization
TgeneCAV1chr7:116593745chr7:116199000ENST00000393467+022_9434148RegionRequired for homooligomerization
TgeneCAV1chr7:116593745chr7:116199000ENST00000393468+132_9434148RegionRequired for homooligomerization
TgeneCAV1chr7:116593745chr7:116199000ENST00000405348+132_9434148RegionRequired for homooligomerization
TgeneCAV1chr7:116593745chr7:116199000ENST00000341049+132_10465179Topological domainCytoplasmic
TgeneCAV1chr7:116593745chr7:116199000ENST00000393467+022_10434148Topological domainCytoplasmic
TgeneCAV1chr7:116593745chr7:116199000ENST00000393468+132_10434148Topological domainCytoplasmic
TgeneCAV1chr7:116593745chr7:116199000ENST00000405348+132_10434148Topological domainCytoplasmic


Top

FusionGeneSequence for ST7_CAV1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_164aa
MAEAATGFLEQLKSCIVWSWTTLWTVWFFIVLFLVYILRVPLKINDNLSTD_L_RCDCRTRRDTQF_RHLEGQLHHLHCDEILVLPLAVC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_493nt
ATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATC
GTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACC
AGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGC
CCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAA
GAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_2685nt
TCTTTCTAAATATTAGCATAATAAATATAAATGGACCCAGAACGCGAGGGGGCAGGGGCCACGTGATCGCTCCACGAAAGCCACTTGTAG
GGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGG
CGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACC
AAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCT
TGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGC
ACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGT
GACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTT
CCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACAC
CGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGG
ATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTG
AATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTC
TGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACATA
TTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCA
AAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTT
CCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTT
CTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAA
CAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAA
GACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCA
TCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGG
GCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAA
TCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCC
AAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTC
TGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGA
GGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTC
GTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCA
GTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTAC
CTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTG
CATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTAT
TCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACT

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_828nt
TCTTTCTAAATATTAGCATAATAAATATAAATGGACCCAGAACGCGAGGGGGCAGGGGCCACGTGATCGCTCCACGAAAGCCACTTGTAG
GGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGG
CGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACC
AAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCT
TGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGC
ACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGT
GACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTT
CCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACAC
CGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGG

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_2688nt
TCTTTCTAAATATTAGCATAATAAATATAAATGGACCCAGAACGCGAGGGGGCAGGGGCCACGTGATCGCTCCACGAAAGCCACTTGTAG
GGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGG
CGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACC
AAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCT
TGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGC
ACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGT
GACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTT
CCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACAC
CGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGG
ATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTG
AATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTC
TGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACATA
TTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCA
AAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTT
CCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTT
CTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAA
CAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAA
GACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCA
TCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGG
GCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAA
TCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCC
AAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTC
TGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGA
GGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTC
GTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCA
GTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTAC
CTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTG
CATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTAT
TCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACT

>In-frame_ST7_ENST00000393446_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_2685nt
TCTTTCTAAATATTAGCATAATAAATATAAATGGACCCAGAACGCGAGGGGGCAGGGGCCACGTGATCGCTCCACGAAAGCCACTTGTAG
GGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGG
CGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACC
AAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCT
TGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGC
ACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGT
GACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTT
CCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACAC
CGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGG
ATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTG
AATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTC
TGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACATA
TTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCA
AAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTT
CCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTT
CTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAA
CAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAA
GACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCA
TCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGG
GCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAA
TCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCC
AAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTC
TGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGA
GGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTC
GTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCA
GTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTAC
CTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTG
CATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTAT
TCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACT

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_2596nt
GGGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCG
GCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACAC
CAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTC
TTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAG
CACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTG
TGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTT
TCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACA
CCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAG
GATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATT
GAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGT
CTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACAT
ATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCC
AAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTT
TCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCT
TCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATA
ACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGA
AGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTC
ATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTG
GGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATA
ATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTC
CAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGT
CTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGG
AGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGT
CGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTC
AGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTA
CCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACT
GCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTA
TTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTAC

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_739nt
GGGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCG
GCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACAC
CAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTC
TTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAG
CACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTG
TGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTT
TCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACA
CCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAG

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_2599nt
GGGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCG
GCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACAC
CAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTC
TTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAG
CACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTG
TGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTT
TCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACA
CCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAG
GATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATT
GAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGT
CTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACAT
ATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCC
AAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTT
TCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCT
TCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATA
ACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGA
AGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTC
ATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTG
GGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATA
ATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTC
CAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGT
CTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGG
AGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGT
CGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTC
AGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTA
CCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACT
GCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTA
TTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTAC

>In-frame_ST7_ENST00000265437_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_2596nt
GGGACCTTTAGAGAGTTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCG
GCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACAC
CAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTC
TTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAG
CACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTG
TGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTT
TCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACA
CCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAG
GATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATT
GAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGT
CTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACAT
ATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCC
AAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTT
TCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCT
TCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATA
ACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGA
AGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTC
ATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTG
GGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATA
ATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTC
CAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGT
CTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGG
AGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGT
CGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTC
AGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTA
CCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACT
GCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTA
TTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTAC

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_2581nt
TTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTC
CGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAG
CAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTG
GACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTG
AAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGT
TTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGG
CAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCAC
TCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCT
GATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTG
AAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAAC
CCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAA
TTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATT
TTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGG
AGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGA
TCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGC
CTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAA
TATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTT
TATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGG
AAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGA
ATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTA
AAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGAC
ACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAA
GATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGC
CTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTT
TTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTT
TGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAAT
GTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCT
GTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAA

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_724nt
TTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTC
CGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAG
CAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTG
GACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTG
AAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGT
TTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGG
CAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCAC
TCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCT

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_2584nt
TTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTC
CGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAG
CAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTG
GACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTG
AAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGT
TTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGG
CAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCAC
TCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCT
GATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTG
AAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAAC
CCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAA
TTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATT
TTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGG
AGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGA
TCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGC
CTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAA
TATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTT
TATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGG
AAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGA
ATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTA
AAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGAC
ACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAA
GATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGC
CTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTT
TTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTT
TGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAAT
GTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCT
GTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAA

>In-frame_ST7_ENST00000393451_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_2581nt
TTAGCAATAAGGCTGGAGAAGGAAAAGCCGGCGCGCCCGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTC
CGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGAGCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAG
CAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACGGGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTG
GACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTACATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTG
AAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGT
TTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGG
CAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCAC
TCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCT
GATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTG
AAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAAC
CCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAA
TTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATT
TTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGG
AGTTAGTGGATTACTGCCATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGA
TCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGC
CTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAA
TATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTT
TATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGG
AAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGA
ATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTA
AAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGAC
ACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAA
GATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGC
CTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTT
TTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTT
TGCATTTAAAACAGACACTGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAAT
GTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCT
GTTCTACATAGATGCTTAGTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAA

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_2544nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG
CATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTC
AAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTAT
TATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATG
TGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAA
AAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGA
GTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGT
AGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCT
ATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTC
TAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTC
TGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAA
ATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGG
TCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCT
CAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTG
CAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAA
TCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTC
TGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCAT
ATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCT
CTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTA
CTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACT
TAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAAT
TACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCT

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_687nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_2547nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG
CATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTC
AAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTAT
TATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATG
TGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAA
AAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGA
GTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGT
AGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCT
ATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTC
TAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTC
TGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAA
ATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGG
TCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCT
CAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTG
CAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAA
TCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTC
TGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCAT
ATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCT
CTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTA
CTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACT
TAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAAT
TACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCT

>In-frame_ST7_ENST00000393449_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_2544nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG
CATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTC
AAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTAT
TATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATG
TGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAA
AAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGA
GTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGT
AGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCT
ATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTC
TAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTC
TGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAA
ATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGG
TCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCT
CAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTG
CAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAA
TCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTC
TGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCAT
ATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCT
CTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTA
CTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACT
TAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAAT
TACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCT

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000341049_chr7_116199000_+_2544nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG
CATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTC
AAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTAT
TATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATG
TGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAA
AAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGA
GTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGT
AGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCT
ATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTC
TAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTC
TGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAA
ATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGG
TCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCT
CAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTG
CAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAA
TCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTC
TGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCAT
ATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCT
CTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTA
CTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACT
TAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAAT
TACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCT

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000393470_chr7_116199000_+_687nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000405348_chr7_116199000_+_2547nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG
CATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTC
AAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTAT
TATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATG
TGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAA
AAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGA
GTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGT
AGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCT
ATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTC
TAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTC
TGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAA
ATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGG
TCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCT
CAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTG
CAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAA
TCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTC
TGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCAT
ATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCT
CTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTA
CTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACT
TAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAAT
TACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCT

>In-frame_ST7_ENST00000323984_chr7_116593745_+_CAV1_ENST00000393467_chr7_116199000_+_2544nt
CGCGGCCCGCGCGATTTCCCGCCGAGCCCGCGTCCCCGGCGGCGGGCGGGCTCCGGGGGCGCCCGGGCCGCGGCGGCGGCGGCGGCGCGA
GCTGCGCCTCCGGGCCGGTGAATCATCCCGGCAGACACCAAGAGCCGCGGCAGCAGAGAGGAGCGCTGAAACATGGCTGAAGCGGCCACG
GGCTTTCTGGAGCAGCTCAAGTCCTGCATAGTTTGGTCTTGGACGTATCTGTGGACCGTGTGGTTCTTCATCGTGCTATTCCTGGTCTAC
ATCCTGCGGGTGCCTTTGAAAATCAACGACAACTTGAGCACAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTT
TGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGAT
GGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGAT
TCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCG
CATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGATAGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTC
AAGTTCCAAGTTGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTTTCTCAGTTTTCATAAGTAT
TATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTGAATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATG
TGGATCAACCATCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAGAACTGAGGAGGAAAAAAAA
AAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAAATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGA
GTGTACAAGTATGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCCATTCACTTCATAATCCAGT
AGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCTGCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCT
ATGATATTTTCTGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATTTTCCTTTTCAAATAGGGTC
TAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGACCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTC
TGAGCTACAGAGTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGGTTGACACTAGCCCAATGAA
ATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGCTGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGG
TCAGCATGTCTATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCACCGGGGTGGTTTAGTGGCT
CAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAAGGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTG
CAAACCTGACCCCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTGCCAGGAGCTTTGGACCTAA
TCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGGCAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTC
TGAACTCAAACTGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCTTTTTATTCCTCCTGCTCAT
ATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGTTATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCT
CTTCCAGTCTTCCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACACTGGCATGGATATAGTTTTA
CTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCATACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACT
TAGGAAATGGCTTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTAGTCCCTCATGCAAATCAAT
TACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGATATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCT


Top

FusionGenePPI for ST7_CAV1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ST7NFKBIA, RIC3, KLRAP1, HLA-DQA1, MCOLN3, CD244, FAM189A2, PTGER3, CHRNA9, LRRTM2, EVC2, PTPRU, B4GAT1, CDH5, PCDHAC2, PCDHB11, PCDHB16, GPR21, CHRND, RNF19B, C3AR1, POLR2E, ZNRF4, HTR3A, FAM189B, LRRN1CAV1AR, SCP2, PLD2, AQP3, EDNRB, NOS3, CAV2, NOS2, BTK, BMX, GRK5, GRK1, ADRBK1, TRAF2, TRADD, TNFRSF1B, TRPC1, NTRK1, NGFR, NEU3, TSC2, DAG1, APP, INSR, PRKACA, PTPN1, PTPN6, PTPN11, PTEN, PTPRF, S1PR1, FLOT1, FLOT2, ESR1, PTGS2, PDGFRB, PDGFRA, RCVRN, CSK, EGFR, SRC, TGFBR1, SMAD2, GJA1, GJB2, GJB1, TNFRSF1A, TNF, NKD2, RAC1, RHOA, RHOC, MAPK3, MAPK1, PLAA, PDIA3, CD44, CXCR4, ITCH, TOLLIP, IRAK1, FYN, KCNA3, KCNA5, PPP1CA, PPP2R1A, PPP2R1B, PPP2CA, PPP2R4, SNCA, PTRF, ACIN1, VDAC1, SQSTM1, VCP, UBXN6, KCNN3, MCL1, ITPR3, PTCH1, TENC1, DLC1, ID1, MLC1, NF1, MALL, KCNMA1, BMPR2, BMPR1A, AXIN1, LRP6, FAS, BID, HSP90AA1, ACTB, F2R, PROCR, GLIPR2, KDR, ATP4A, DERL1, VIMP, UFD1L, PTGS1, PTGIS, RPA3, RPA2, RPA1, ATG5, ATG12, ABCC1, TFRC, MOV10, NXF1, PPARG, LATS1, VAV2, KRT8, PLCG1, CTNNB1, HDAC6, AGTR1, LPAR6, P2RY12, FNDC4, FAF2, FAP, TMEM17, TMEM216, CLTC, DBN1, RAB2A, RAB5C, RAB7A, DYNLL1, VAPA, FGFR1OP2, GOLT1B, LIMA1, TMEM63B, YIPF5, MMGT1, MBOAT1, ANKRD13A, ADCY6, ADCY5, TLR4, YIPF3, SMPD3, SLC22A9, CAV3, TACR1, HK1, LPAR4, SLC5A8, CHRM3, SLC37A3, HTR2C, TMEM184A, SLC6A15, NR3C2, UBC, MAP1LC3A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneCAV1chr7:116593745chr7:116199000ENST00000341049+1382_9465179CAVIN3
TgeneCAV1chr7:116593745chr7:116199000ENST00000393467+0282_9434148CAVIN3
TgeneCAV1chr7:116593745chr7:116199000ENST00000393468+1382_9434148CAVIN3
TgeneCAV1chr7:116593745chr7:116199000ENST00000405348+1382_9434148CAVIN3


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ST7_CAV1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ST7_CAV1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCAV1C1458155Mammary Neoplasms4CTD_human
TgeneCAV1C0004238Atrial Fibrillation2CTD_human
TgeneCAV1C0033578Prostatic Neoplasms2CTD_human
TgeneCAV1C0011853Diabetes Mellitus, Experimental1CTD_human
TgeneCAV1C0017612Glaucoma, Open-Angle1CTD_human
TgeneCAV1C0018800Cardiomegaly1CTD_human
TgeneCAV1C0020538Hypertensive disease1CTD_human
TgeneCAV1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneCAV1C0027627Neoplasm Metastasis1CTD_human
TgeneCAV1C0036341Schizophrenia1PSYGENET
TgeneCAV1C0038325Stevens-Johnson Syndrome1CTD_human
TgeneCAV1C0038356Stomach Neoplasms1CTD_human
TgeneCAV1C0043094Weight Gain1CTD_human
TgeneCAV1C0271694Familial partial lipodystrophy1CTD_human
TgeneCAV1C0919267ovarian neoplasm1CTD_human