FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36265

FusionGeneSummary for ST6GALNAC6_PAWR

check button Fusion gene summary
Fusion gene informationFusion gene name: ST6GALNAC6_PAWR
Fusion gene ID: 36265
HgeneTgene
Gene symbol

ST6GALNAC6

PAWR

Gene ID

30815

5074

Gene nameST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6pro-apoptotic WT1 regulator
SynonymsSIAT7-F|SIAT7F|ST6GALNACVIPAR4|Par-4
Cytomap

9q34.11

12q21.2

Type of geneprotein-codingprotein-coding
Descriptionalpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VIST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6ST6 -PRKC apoptosis WT1 regulator proteinPRKC, apoptosis, WT1, regulatorWT1-interacting proteinprostate apoptosis response protein 4prostate apoptosis response protein PAR-4prostate apoptosis response-4transcriptional repressor PAR4
Modification date2018052320180523
UniProtAcc

Q969X2

Q96IZ0

Ensembl transtripts involved in fusion geneENST00000373146, ENST00000373141, 
ENST00000291839, ENST00000373142, 
ENST00000373144, ENST00000485320, 
ENST00000542456, 
ENST00000328827, 
ENST00000547571, 
Fusion gene scores* DoF score2 X 2 X 1=48 X 6 X 5=240
# samples 18
** MAII scorelog2(1/4*10)=1.32192809488736log2(8/240*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ST6GALNAC6 [Title/Abstract] AND PAWR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneST6GALNAC6

GO:0006677

glycosylceramide metabolic process

17123352

HgeneST6GALNAC6

GO:0006687

glycosphingolipid metabolic process

17123352

HgeneST6GALNAC6

GO:0009100

glycoprotein metabolic process

17123352


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A3M1-01AST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373146ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5CDS-intronENST00000373146ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
Frame-shiftENST00000373141ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5CDS-intronENST00000373141ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
Frame-shiftENST00000291839ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5CDS-intronENST00000291839ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
In-frameENST00000373142ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5CDS-intronENST00000373142ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
Frame-shiftENST00000373144ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5CDS-intronENST00000373144ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5UTR-3CDSENST00000485320ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5UTR-intronENST00000485320ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
Frame-shiftENST00000542456ENST00000328827ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-
5CDS-intronENST00000542456ENST00000547571ST6GALNAC6chr9

130656791

-PAWRchr12

79990438

-

Top

FusionProtFeatures for ST6GALNAC6_PAWR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ST6GALNAC6

Q969X2

PAWR

Q96IZ0

Alpha-2,6-sialyltransferase involved in the synthesis ofalpha-series gangliosides. Has activity toward GD1a, GT1b andGM1b. Has no activity toward glycoproteins. Responsible for thebiosynthesis of DSGG (disialylgalactosylgloboside) from MSGG(monosialylgalactosylgloboside) in normal and malignant kidney.Participates in the synthesis of disialyl Lewis a (Le(a)).{ECO:0000269|PubMed:12668675, ECO:0000269|PubMed:17123352}. Pro-apoptopic protein capable of selectively inducingapoptosis in cancer cells, sensitizing the cells to diverseapoptotic stimuli and causing regression of tumors in animalmodels. Induces apoptosis in certain cancer cells by activation ofthe Fas prodeath pathway and coparallel inhibition of NF-kappa-Btranscriptional activity. Inhibits the transcriptional activationand augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction withWT1. Seems also to be a transcriptional repressor by itself. Maybe directly involved in regulating the amyloid precursor protein(APP) cleavage activity of BACE1. {ECO:0000269|PubMed:11585763}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000291839-3630_3399334Compositional biasNote=Poly-Arg
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373141-3630_3365300Compositional biasNote=Poly-Arg
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373142-4730_3399375Compositional biasNote=Poly-Arg
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373144-3630_3365300Compositional biasNote=Poly-Arg
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373146-4730_3399334Compositional biasNote=Poly-Arg
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000291839-361_4399334Topological domainCytoplasmic
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373141-361_4365300Topological domainCytoplasmic
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373142-471_4399375Topological domainCytoplasmic
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373144-361_4365300Topological domainCytoplasmic
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373146-471_4399334Topological domainCytoplasmic
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000291839-3644_6499334TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373141-3644_6465300TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373142-4744_6499375TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373144-3644_6465300TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373146-4744_6499334TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgenePAWRchr9:130656791chr12:79990438ENST00000328827-37300_340227341RegionNote=Leucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000291839-36112_11599334Compositional biasNote=Poly-Ser
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373141-36112_11565300Compositional biasNote=Poly-Ser
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373142-47112_11599375Compositional biasNote=Poly-Ser
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373144-36112_11565300Compositional biasNote=Poly-Ser
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373146-47112_11599334Compositional biasNote=Poly-Ser
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000291839-3665_33399334Topological domainLumenal
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373141-3665_33365300Topological domainLumenal
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373142-4765_33399375Topological domainLumenal
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373144-3665_33365300Topological domainLumenal
HgeneST6GALNAC6chr9:130656791chr12:79990438ENST00000373146-4765_33399334Topological domainLumenal
TgenePAWRchr9:130656791chr12:79990438ENST00000328827-37186_206227341Coiled coilOntology_term=ECO:0000255
TgenePAWRchr9:130656791chr12:79990438ENST00000328827-3749_120227341Compositional biasNote=Ala-rich
TgenePAWRchr9:130656791chr12:79990438ENST00000328827-37145_161227341MotifNuclear localization signal
TgenePAWRchr9:130656791chr12:79990438ENST00000328827-3768_72227341MotifB30.2/SPRY domain-binding motif
TgenePAWRchr9:130656791chr12:79990438ENST00000328827-37145_203227341RegionNote=Selective for apoptosis induction in cancer cells (SAC)


Top

FusionGeneSequence for ST6GALNAC6_PAWR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ST6GALNAC6_ENST00000373146_chr9_130656791_-_PAWR_ENST00000328827_chr12_79990438_-_212aa
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITD
GYVPILGNKHNQCLXRRCLKXIFSNRXKWVPXIXQGCKCFRYSGFKXHTGKENXRSXKGSSKRKTRKPKTCETDARXRGNDWKTQRRNXF

>In-frame_ST6GALNAC6_ENST00000373142_chr9_130656791_-_PAWR_ENST00000328827_chr12_79990438_-_212aa
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITD
GYVPILGNKHNQCLXRRCLKXIFSNRXKWVPXIXQGCKCFRYSGFKXHTGKENXRSXKGSSKRKTRKPKTCETDARXRGNDWKTQRRNXF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ST6GALNAC6_ENST00000373146_chr9_130656791_-_PAWR_ENST00000328827_chr12_79990438_-_637nt
ATGGCTTGCTCGAGGCCCCCCAGCCAGTGTGAACCCACATCCCTGCCCCCAGGGCCACCTGCAGGACGCCGACACCTACCCCTCAGCAGA
CGCCGGAGAGAAATGAGTAGCAACAAAGAGCAGCGGTCAGCAGTGTTCGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGC
TCCAACAGTGCCAATGAGGTCTTCCATTACGGCTCCCTGCGGGGCCGTAGCCGCCGACCTGTCAACCTCAAGAAGTGGAGCATCACTGAC
GGCTATGTCCCCATTCTCGGCAACAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTT
CCCTAGATATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGT
AGTAAGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTT
ATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGAC

>In-frame_ST6GALNAC6_ENST00000373142_chr9_130656791_-_PAWR_ENST00000328827_chr12_79990438_-_637nt
ATGGCTTGCTCGAGGCCCCCCAGCCAGTGTGAACCCACATCCCTGCCCCCAGGGCCACCTGCAGGACGCCGACACCTACCCCTCAGCAGA
CGCCGGAGAGAAATGAGTAGCAACAAAGAGCAGCGGTCAGCAGTGTTCGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGC
TCCAACAGTGCCAATGAGGTCTTCCATTACGGCTCCCTGCGGGGCCGTAGCCGCCGACCTGTCAACCTCAAGAAGTGGAGCATCACTGAC
GGCTATGTCCCCATTCTCGGCAACAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTT
CCCTAGATATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGT
AGTAAGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTT
ATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ST6GALNAC6_ENST00000373146_chr9_130656791_-_PAWR_ENST00000328827_chr12_79990438_-_8550nt
GGGCCGGGCCGTGACGGCGGCGCTAGGACCCGGCGGGCCGCGGGTGCGGCGAGGCCTGGGCGGCCTGAGGAGCGCGGACCCCGGCGCTCG
GCTCCCGGCGCCATGTGAGGGGGCTCGGGGGCCGCGGGGGGCCGGGCGCTCCCCGCCGGAGATGAGGAAACTGAGGCTCAGAGAGGTCAC
ATGGCTTGCTCGAGGCCCCCCAGCCAGTGTGAACCCACATCCCTGCCCCCAGGGCCACCTGCAGGACGCCGACACCTACCCCTCAGCAGA
CGCCGGAGAGAAATGAGTAGCAACAAAGAGCAGCGGTCAGCAGTGTTCGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGC
TCCAACAGTGCCAATGAGGTCTTCCATTACGGCTCCCTGCGGGGCCGTAGCCGCCGACCTGTCAACCTCAAGAAGTGGAGCATCACTGAC
GGCTATGTCCCCATTCTCGGCAACAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTT
CCCTAGATATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGT
AGTAAGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTT
ATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGAC
CAGGTAGAGGATTCAAGACTCAATGTGGAAAAAATATTTTAAACTACTGATTGAATGTTAATGGTCAATGCTAGCACAATATTCCTATGC
TGCAATACATTAAAATAACTAAGCAAGTATATTTATTTCTAGCAAACAGATGTTTGTTTTCAAAATACTTCTTTTTCATTATTGGTTTTA
AAAAAGCATTATCCTTTTATCTCACAAATAAGTAATATCTTTCAGTTATTAAATGATAGATAATGCCTTTTTGGTTTTGTGTGGTATTCA
ACTAATACATGGTTTAAAGTCACAGCCGTTTGAATATATTTTATCTTGGTAGTACATTTTCTCCCTTAGGAATATACATAGTCTTTGTTT
ACATGAGTTCAAATACTTTTGGGATGTTACCTTCACATGTCCTATTACTGATGTGTGCAACCTTTTATGTGTTGATGACTCACTCATAAA
GGTTTTTGTCTACTGTCATTTGTTCTTTCCACTTATTCTAAGCATTTAGAGTAATAGAGTCATACTTTTTTATAACAGCAACCTTTTAAA
AGGAAAGCTCTTATAAAGTCACTGTCATGTTTTAGTTGACTAAATATAAATTTAAGAGAATACTTGAATTGTGCTATAGTAAATAAAAAT
TTACTATTTTGTGTTTGAATATTGAAAAATTGAATCACTTTAACTCCTGAAAAACATACAATTGTAATTTCAATGTAAAATTTCTTATGT
AGGTACTACCTTTTTTTATCGTTCCAAGGTTTGCTAGTGAACACAGGATATTTTAAAAGTTTTTTATTCTTCGGGCCTGGAAAGTGTACA
AAGTCAGTGTAGGAGAAAAAAATCCATATTTTTATATTAGCATGCACACTAAAAACCAAAATATTATTCATACTTAAAACATTCATACAA
AACAATATGTAAGCAGAAATAGTACTAAAATACTTTGCCTAATTTCTAAGTTGAAGAATAACACTGGGACACAGTTTTTTCATATGAGAG
AATATTCCGCTATTTCAAATTTAAGGGATTTTCTTCCTAACATTGAAATTTTAAAAACAGAGTTACTTCTAAATAATTATACAGATTTTT
TCTTCTATTAAATATTATTATTTAGAATTGTTTTTGTATTACATATTCATGTTAAGAACCCCGTCTTCCCTTAAAATACATTAAAATTAT
GACATTTTTGCTTTGTGATTGAATTTCAAATAGCAGTATGGTATCCTTTTATCTAGTTAATATATGAAAGTGGCTTGAATATAGTCAAAT
CCATTTTAGGTACTCTACTGACTTTTTCCTTCACTTGCCAAGCCCTTTTATTGTTCACTGTTAGAAAAATAGAGAAGGTGAGACAGCTGG
GGGAAAATGTGGAGTAAATGATAATCAAATGTTGAATTCTAAAAGTCTCTACATTTACCTAGGTTGGCTTTCTCCCCCAGTTCAGAAGTT
TCCAGCTTGGCCAATCATCAGAATCACTTGAGGAACTTAGAAAGAACTCCCTGGCTGTAGCTCCTATGTAGGTTTAGGTTGAGACTCTGG
ATTCCACAATTTTTAAAGGTTACCATCTGAGGTTTCTGATCATAGTCTACTTTTGAAGCAGCTGCTGCTGTTTCTTTATTCCATTGAACA
CCCTGGAATTGACATAATTTTATCTATCAGCATTTCTCCCCTTTTAGTTTATTTAATAATTAACCCGGTCTCCAGGGCAGTTTTCATATG
ACCATGTGTATATTCACTGCTCACGAAAAAGTTTAATGTTAGATTACCAAATTTAATATAGTTACAGAATTACTGCATAAGGGCTTCCCT
TCTTGGAGACTCTTACCCAGCATGGGAACAGTGATCTGCCCACATGACAGGGTGGTATGCCAGGCATAGTTAACTGCTTTTGGTTGTGAG
GTACTCATCTTCCTTTAGTTACCCTTAGTTATGTGGCACACATGTCCTTATTGCCTAGTTCGTCATCCACACTTTGGATCTTGTGAAAAT
GCTGTTAGTATCCAACCTTAAAATATATTAGTATATGGGTTTTTATTAAAAGAATTACTTTGAATTTTCTATTTAATTCATATGTAAATA
AAGGAACATTTCATTTCACTTAAAAAAATTATATCAGTTATTAGGCTGGGTGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGC
CAAGGCGGGTGGATTACCAGAGTTCGGGAGTTTGAGACCAGCTTGACCAACATGGAGAAACCCCGTCTCTACTAAAAATACAAAATTAGC
CAGGTGTGGTGGCGCATGCCTGTAATCCTGGCTACTCAGGAGGCTGAGGCAGGAGAATCGCTTGAAAACCCAGGAGACAGAGGTTGCGGT
GAGCTGAGATTGCGCCATTGTACTCCAGCCTGGGCAAGAAGAGCGAAACTCTGTCTCCAAAAAAAAAAAAAAAAAAATTATTAATACTTT
TAAAGACTGAGCTGTTTAAGAATTTTTTGGGGAACATTTCTAGCAGTGATTTTTTTGGCCTTTAATGATAGCGTAAAGACAGGAGCCTTA
CAACTTAGGCAAAGCATTTCACATGCAGTCCTTCTTCCATCTCAAAATATGTACTTATTTTACATACAGAATTTTACACTAACCATTGAA
AAATAAAGTAGGATCTGCTACAGTTTCACCTGAAAATTTATAAAAAGTGTTGAGATTGGTAGAAGGTAGTTTTTAAGTACATGTGCACTA
CCCTAAAAGACTTGTCTATTGTCAATAAAGTGTTAGTATTTGTGAAATTATTATTCCTGTTCAGAAATACTATTTCTTAAATCTCCTGGG
AATTTGTGGCATAATAAAGCACATTCAAAGTTCTAATGTATTTATGAGCTCATTTTCAAAATAGTAAGTTTGTCATCTTTAAAATGAACA
TGACTTGCCTCCTTGATTTCTGAAATGAATTAATTGAAGATTGCTATAGTAATCTTTATTTCATCTTTCTAGAGTTGTTGACAATTTTAT
TATACAACAGTTACCATTAGAGAAGGAGGGAAGGGCTTTTGGGTGTGTATTTATAGGTACTAAGGGATTTACTAAATATAGTAGATTAGC
ACTGTCACACTTGTTCAAGTAGTTTCAAACATAGAAAATTAAGTATCAGGTATGTGGAGCAATGTAGTTTTTTTTTTTCTTCAGTTTAAA
AAATTTTTAATTGTGGTAGAAGCAATGTATTCTTAAGGTGAAAAACCTACCTCGGTTACATGTGGTTTGTGTTTTTTGGATTAATCTGGA
TTTTATAATTAGAAATAAAAATGTAAGATTTTGAATCCACTTAATTTCTTGAAAATAGTACAAGTCAGTGTAATAGAGAAGCATTCATAT
ATTCAACACTGTAAGACAAAACAGCAGAGACCTTGGATTTGATAATTGATCTGATATCCTGGACAGTATTCATATGTACAGTGATAGGTA
TCTTTCTTTGGAGTTTTTTTTTTGTGCATATGTGTATAGTTTTATGGGTTCTGAGTTGGTGACCAGTAAGTTGCATGTAGTGCTGGCACT
TACTTAATAACTATTCATGATATTGTTAATAACTTGTTATAGGATTGTATTCCCAATTACAGTCTCTAAGATTGTAATTGATATTATCTG
AGAGGTAGTGTGACAACTTTCTTTTGTTGTTACATTAAGCCGAAAACATAATACTAATAGACAACTAACAGTTTGCTTATCAGGCACATC
AACTAAGGCACCTCCCCCCATGCTAAGTTTCTCCTGGATATATGGAAGTTGATTGTTTCCCAGTTTAAAAACTTGAACTAATATCTCCTA
AGAAAATCTGAGTCCATATTGTTTTTATTTTACTTAGCTAGAATCTCATAGCATGTTAAAGTCATATCCTTATCCCCACTAAAAATAACT
ATGTCTATGTGAGAGGAATATAGTATGTGGGAGCTGTATTAAATACTATTACAGGTGTTACAGAATCTTTAAATAAATGGACATGGACCA
ACTTTCCATCTAGTAGTGTACGATCTATATAGTGCATGTCAGTAGCACAAAATGCAGTCTTAGCATTAGCCTGTCTAATCTGAATAGTTT
ACTCAAAAGTACTTCTTTGTGTTAAGTATTCAGCCACTGTTTTTAGATCTAGTTAATAGGTTCTATTTAATTTGCTACAACATTTACTGA
ATGGTGGAGTGAAAAAACTGATGCATACTGGGAAATATCTACCATTTTTTAAAGATAATGTTAATTAGGAAAAGAACACTTTTAAGGAAT
TTATAGCAGTGATGAAATGAATTCAGTTATATCAGATACACCAAACTGTTGATGGTATTTAAATGTGACTTCAAGTTAGTATTTCTGTAT
ATATTATTGATTACTGGTTTGTTTTTAGATATGTAAGTCTGTTCTAATCTACAGTTCACATATCGACAGTTACTCTGGTAATAATAGAAT
GTTAGTGATGATCACTTGGTGGATGTTGATTAAGTGCCTGTGTTTTGTTTCCTCCTCTGGATACCAAATAGGTGTATGCTACTTTTTTGG
TGAACTTATTTCTTGGAAGATTTGGCTATGCTATTCAGGGTTTTTATTCTTATGTTTTTCTTCTAAATTTAAGTAGCATCCTGCTGCTAC
CATATTAAAGCTAAAATTTAACTTTTGCTGAAGAATCAGCTAATTCAGGTAATCCAAATATTTGTGGAAAAACATCTGGATAATTTATTG
AACACATTAGTATTGTGTTAGACAGCTTTGATCATTCCCATTTCATAGGTTTTTATTGTGGAATAGTCAACTTAATATAGATTCACTTTC
AATTTGCATGTATAAAGTAATACTCAATAAAATTTTTTTCATTTATTTTTCAACAGTGGTTATTTTTTTTCTTCCTGTACTATCAGTAAA
ATCCTGACTATGAGTTTTACTTTTGAAGCTAAAGGATAATGCTGGTAATCTAATTATGTACCTCTTACAGAAACCATATGCAGCACTTTA
AAAATCTTTATTTGGTATATTATTTTAGGTGGACAATGATTTAAGACTCAAAGCCATCATATTAAGGTCTAAATACATTAGTGGTGGGGT
TTCTCGAATAAATGAGGAAGTGCACAAAAGTTCAGCCTGACTGAAAATTTTAATTGTGTTTTAAAACTACATGAATAATTTCTTGATTCA
AAATCAGAACTCTTATAAACTAAATCTGATGGTGTCCAAAGAATTTCAGGTCCTTCAAAGTTTGTAAAAGATAAGTAGGGGCCTAGGAAT
ATAAAAATTTAGACTTTTTTAGTAAATGGTTTACATAACCTTTTGTCTTAATTTGTCATTCTTCATACACAGGCACAAGCTAATCAGTCT
TCTCTACTTCTAGAACTCTAAATCTTCTCAGTAATGTCATACAAGTCTAACAAGAGGAAAAGCATCCTTAAGTCAGTCTATTTAGATAAA
CTCTTCAAGTCCCTATATAAGGACGTATTCCACTAGCAAGCCAGTAAATTTTTCCAAGGTCACATAATCTTACATGAAATGGAACCTTTC
ATCTTAGACTTCATCAAACTCAATTTTTTCCCTTCTAGATTCACTTTGTGTTTATGCATGCATGCACGCGTGCACACAATTCTATCAGCA
GCTGTAAACTACCCACATATTTTCTTAATCTCATTTTTTCAGTTTTTCTTCATCTTTAAAAGAGGTTACATTTCATTCCTGGTCAACTCT
TAAAAAGAATTATGTAATGTTGGGCCTTCATATTAAAGAGAGAGACTGGTTATAAGATCCTTTACAGTCCATTCATTTTATTCTGATGTC
TAACCAGATAGACACTAGCAAGCAAAACTTCCCTCTTAATCCTGGACCAAATGCATAATTTTACTGTCACTTTCAAAAATCTGTTATGAC
TGAATCAAAATCCTTTTAAAGAAAGGAAAAAGCTCCTTTTGTGTCAAATAGTTGAACAACATGAAAACAGTATGAGCCGGTTAAAGATAG
ATTGAATTTTTACTTTACACATATGAAAAACAGTAAGTTTTGACTGCTGTGTATGTTATTCATGTTAATATGTGCTCAGTTATTCACTAT
TGTTAATCCACATATAATCAGTTGCTATCCCTGGTTAGACACACTATGGAACTTGAAATGCACAATATTTACATTGTTAGAGGCTTCTAT
CCAAATATCTGCATTCCTTTAAAATGTGAACTATTTGCTGTGATTAACCAAAGGTAGATTATGTCATCAGTGGACATTTTAGCTTTATGG
AAACAAATTATTAAGAAATGAATAGAAAGGTGTCTTTTTCTTTGTGTAGTGCAAAAGCCTAAAGCTATCAGTCAAAGGCCTAAGAAATCC
ACATTTGAAAAACGTAAATCATGATTGGTAAGAATACATTCATCTGATAGTATTGAGAAAAGTTGAAAAACTGTTAGCCTTCCATAACAC
ATTAAACATTTTATGTATGGATGGCTGAAAGTATTGAGAAAAGCTGAAAAACTGTTAGCCTTCCATAACACATTAAACGTTTTGTGTATG
GATGGCTTAGGACAATAAACAACATCATTAAAGTAAAATTATGTCAGTCTGTTCATATTAACTTATTTAAATCAATGAAAATTTTGATGA
GATGACTAAATGGATGCTTTGGAAATGCAGGATTATAGGAGGCCTAAAAGTGCATCTTGTTTCTTGTAACCCTTTTAAAACCAATATGCC
TGGCTAGGTGCAGTGGCTCATGCCTGTAATACCAACGGGGTAACACAGGGTTATGCCGTCTATACAAAAAAATAAATGAGCTGGGCAAGA
TGGCATGCACCTGTAGTCCCAGCTGCTTGGTAGGCTGAGGGGGAAGGATTGCTTGAGCCTGGGAGGTCGAGACTGCAGTGAGCCAAGATC
ACACCACTGCACTCCAGCCTGGGTGACAGAGCAAGACTCTACCTCAAAAATAAAAATAATCAATATAGTTTCAATGAAGCAAAGCATCTC
AGGTAACAATTTGAGCATAACTTTAACCATAACTTATGATAGCATAATAACATTCATTAGTAATTCAGTAGCCGTATGTGCCAGGCTGTG
TTAGGTGCTTTATATATTGTTTAATTTTTAAAAACTTGTGGAGTGTACAGATTGGTAAGGTGACATTGTATCACAAAGCTAGTCTTTGAG
TCCAAAGTTTTGTGGTTTTATGTTATGATATACTTTTATCATGGAATTGTCTTATTAAATGTTTTGCCAGTGGTTCTTAAAGTGTGTTTC
TGACACCAGTAGCATTGACTTCACTTAGAAACCTGTTAGAAATACAAATTATTTGGCCCCACCCAACACTTGAGTCACAAACTTTGCAGA
TGGGGCTCAATCTGTTTTAACAAGCGCTTCATGTAATTTTGATGCAGGCCTAAGTTTTTGAGCCACTGCAGTATGCATTTCTATTTTTAA
GCAAAGATCTTGGTCTTTCTTTTTGGACATTGTAGAAATAACATGAACTTGTTTTTTGTTTGTTTTTGTTTTGTTTTGTTTTAAGCTCCT
GATCTTTGTTGGTTATGTTGCAAAAGATTGTATCAGGAGAAGCCTCAGCATGGACATTGGCATCCTGACATAACCCCCATTAATTTAGTA
TTCTTTCTGAAACTCAAATGGATTCTCAAGTCCAAGAGACTATGGAATAAAATCATTGTTTGTCTGTGTTAAGTTTTATCTCTGTTATTG
CCTGAAGACTTTTGGTAACAATAATGCGCTTTCATCAAACTTTTAAGACTTGATTGGAAAAAATAAATGTATGTTTCATCAGTTATACAA

>In-frame_ST6GALNAC6_ENST00000373142_chr9_130656791_-_PAWR_ENST00000328827_chr12_79990438_-_8543nt
GCCGTGACGGCGGCGCTAGGACCCGGCGGGCCGCGGGTGCGGCGAGGCCTGGGCGGCCTGAGGAGCGCGGACCCCGGCGCTCGGCTCCCG
GCGCCATGTGAGGGGGCTCGGGGGCCGCGGGGGGCCGGGCGCTCCCCGCCGGAGATGAGGAAACTGAGGCTCAGAGAGGTCACATGGCTT
GCTCGAGGCCCCCCAGCCAGTGTGAACCCACATCCCTGCCCCCAGGGCCACCTGCAGGACGCCGACACCTACCCCTCAGCAGACGCCGGA
GAGAAATGAGTAGCAACAAAGAGCAGCGGTCAGCAGTGTTCGTGATCCTCTTTGCCCTCATCACCATCCTCATCCTCTACAGCTCCAACA
GTGCCAATGAGGTCTTCCATTACGGCTCCCTGCGGGGCCGTAGCCGCCGACCTGTCAACCTCAAGAAGTGGAGCATCACTGACGGCTATG
TCCCCATTCTCGGCAACAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTTCCCTAGA
TATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGTAGTAAGA
GAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTTATTAAAT
AGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGACCAGGTAG
AGGATTCAAGACTCAATGTGGAAAAAATATTTTAAACTACTGATTGAATGTTAATGGTCAATGCTAGCACAATATTCCTATGCTGCAATA
CATTAAAATAACTAAGCAAGTATATTTATTTCTAGCAAACAGATGTTTGTTTTCAAAATACTTCTTTTTCATTATTGGTTTTAAAAAAGC
ATTATCCTTTTATCTCACAAATAAGTAATATCTTTCAGTTATTAAATGATAGATAATGCCTTTTTGGTTTTGTGTGGTATTCAACTAATA
CATGGTTTAAAGTCACAGCCGTTTGAATATATTTTATCTTGGTAGTACATTTTCTCCCTTAGGAATATACATAGTCTTTGTTTACATGAG
TTCAAATACTTTTGGGATGTTACCTTCACATGTCCTATTACTGATGTGTGCAACCTTTTATGTGTTGATGACTCACTCATAAAGGTTTTT
GTCTACTGTCATTTGTTCTTTCCACTTATTCTAAGCATTTAGAGTAATAGAGTCATACTTTTTTATAACAGCAACCTTTTAAAAGGAAAG
CTCTTATAAAGTCACTGTCATGTTTTAGTTGACTAAATATAAATTTAAGAGAATACTTGAATTGTGCTATAGTAAATAAAAATTTACTAT
TTTGTGTTTGAATATTGAAAAATTGAATCACTTTAACTCCTGAAAAACATACAATTGTAATTTCAATGTAAAATTTCTTATGTAGGTACT
ACCTTTTTTTATCGTTCCAAGGTTTGCTAGTGAACACAGGATATTTTAAAAGTTTTTTATTCTTCGGGCCTGGAAAGTGTACAAAGTCAG
TGTAGGAGAAAAAAATCCATATTTTTATATTAGCATGCACACTAAAAACCAAAATATTATTCATACTTAAAACATTCATACAAAACAATA
TGTAAGCAGAAATAGTACTAAAATACTTTGCCTAATTTCTAAGTTGAAGAATAACACTGGGACACAGTTTTTTCATATGAGAGAATATTC
CGCTATTTCAAATTTAAGGGATTTTCTTCCTAACATTGAAATTTTAAAAACAGAGTTACTTCTAAATAATTATACAGATTTTTTCTTCTA
TTAAATATTATTATTTAGAATTGTTTTTGTATTACATATTCATGTTAAGAACCCCGTCTTCCCTTAAAATACATTAAAATTATGACATTT
TTGCTTTGTGATTGAATTTCAAATAGCAGTATGGTATCCTTTTATCTAGTTAATATATGAAAGTGGCTTGAATATAGTCAAATCCATTTT
AGGTACTCTACTGACTTTTTCCTTCACTTGCCAAGCCCTTTTATTGTTCACTGTTAGAAAAATAGAGAAGGTGAGACAGCTGGGGGAAAA
TGTGGAGTAAATGATAATCAAATGTTGAATTCTAAAAGTCTCTACATTTACCTAGGTTGGCTTTCTCCCCCAGTTCAGAAGTTTCCAGCT
TGGCCAATCATCAGAATCACTTGAGGAACTTAGAAAGAACTCCCTGGCTGTAGCTCCTATGTAGGTTTAGGTTGAGACTCTGGATTCCAC
AATTTTTAAAGGTTACCATCTGAGGTTTCTGATCATAGTCTACTTTTGAAGCAGCTGCTGCTGTTTCTTTATTCCATTGAACACCCTGGA
ATTGACATAATTTTATCTATCAGCATTTCTCCCCTTTTAGTTTATTTAATAATTAACCCGGTCTCCAGGGCAGTTTTCATATGACCATGT
GTATATTCACTGCTCACGAAAAAGTTTAATGTTAGATTACCAAATTTAATATAGTTACAGAATTACTGCATAAGGGCTTCCCTTCTTGGA
GACTCTTACCCAGCATGGGAACAGTGATCTGCCCACATGACAGGGTGGTATGCCAGGCATAGTTAACTGCTTTTGGTTGTGAGGTACTCA
TCTTCCTTTAGTTACCCTTAGTTATGTGGCACACATGTCCTTATTGCCTAGTTCGTCATCCACACTTTGGATCTTGTGAAAATGCTGTTA
GTATCCAACCTTAAAATATATTAGTATATGGGTTTTTATTAAAAGAATTACTTTGAATTTTCTATTTAATTCATATGTAAATAAAGGAAC
ATTTCATTTCACTTAAAAAAATTATATCAGTTATTAGGCTGGGTGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCG
GGTGGATTACCAGAGTTCGGGAGTTTGAGACCAGCTTGACCAACATGGAGAAACCCCGTCTCTACTAAAAATACAAAATTAGCCAGGTGT
GGTGGCGCATGCCTGTAATCCTGGCTACTCAGGAGGCTGAGGCAGGAGAATCGCTTGAAAACCCAGGAGACAGAGGTTGCGGTGAGCTGA
GATTGCGCCATTGTACTCCAGCCTGGGCAAGAAGAGCGAAACTCTGTCTCCAAAAAAAAAAAAAAAAAAATTATTAATACTTTTAAAGAC
TGAGCTGTTTAAGAATTTTTTGGGGAACATTTCTAGCAGTGATTTTTTTGGCCTTTAATGATAGCGTAAAGACAGGAGCCTTACAACTTA
GGCAAAGCATTTCACATGCAGTCCTTCTTCCATCTCAAAATATGTACTTATTTTACATACAGAATTTTACACTAACCATTGAAAAATAAA
GTAGGATCTGCTACAGTTTCACCTGAAAATTTATAAAAAGTGTTGAGATTGGTAGAAGGTAGTTTTTAAGTACATGTGCACTACCCTAAA
AGACTTGTCTATTGTCAATAAAGTGTTAGTATTTGTGAAATTATTATTCCTGTTCAGAAATACTATTTCTTAAATCTCCTGGGAATTTGT
GGCATAATAAAGCACATTCAAAGTTCTAATGTATTTATGAGCTCATTTTCAAAATAGTAAGTTTGTCATCTTTAAAATGAACATGACTTG
CCTCCTTGATTTCTGAAATGAATTAATTGAAGATTGCTATAGTAATCTTTATTTCATCTTTCTAGAGTTGTTGACAATTTTATTATACAA
CAGTTACCATTAGAGAAGGAGGGAAGGGCTTTTGGGTGTGTATTTATAGGTACTAAGGGATTTACTAAATATAGTAGATTAGCACTGTCA
CACTTGTTCAAGTAGTTTCAAACATAGAAAATTAAGTATCAGGTATGTGGAGCAATGTAGTTTTTTTTTTTCTTCAGTTTAAAAAATTTT
TAATTGTGGTAGAAGCAATGTATTCTTAAGGTGAAAAACCTACCTCGGTTACATGTGGTTTGTGTTTTTTGGATTAATCTGGATTTTATA
ATTAGAAATAAAAATGTAAGATTTTGAATCCACTTAATTTCTTGAAAATAGTACAAGTCAGTGTAATAGAGAAGCATTCATATATTCAAC
ACTGTAAGACAAAACAGCAGAGACCTTGGATTTGATAATTGATCTGATATCCTGGACAGTATTCATATGTACAGTGATAGGTATCTTTCT
TTGGAGTTTTTTTTTTGTGCATATGTGTATAGTTTTATGGGTTCTGAGTTGGTGACCAGTAAGTTGCATGTAGTGCTGGCACTTACTTAA
TAACTATTCATGATATTGTTAATAACTTGTTATAGGATTGTATTCCCAATTACAGTCTCTAAGATTGTAATTGATATTATCTGAGAGGTA
GTGTGACAACTTTCTTTTGTTGTTACATTAAGCCGAAAACATAATACTAATAGACAACTAACAGTTTGCTTATCAGGCACATCAACTAAG
GCACCTCCCCCCATGCTAAGTTTCTCCTGGATATATGGAAGTTGATTGTTTCCCAGTTTAAAAACTTGAACTAATATCTCCTAAGAAAAT
CTGAGTCCATATTGTTTTTATTTTACTTAGCTAGAATCTCATAGCATGTTAAAGTCATATCCTTATCCCCACTAAAAATAACTATGTCTA
TGTGAGAGGAATATAGTATGTGGGAGCTGTATTAAATACTATTACAGGTGTTACAGAATCTTTAAATAAATGGACATGGACCAACTTTCC
ATCTAGTAGTGTACGATCTATATAGTGCATGTCAGTAGCACAAAATGCAGTCTTAGCATTAGCCTGTCTAATCTGAATAGTTTACTCAAA
AGTACTTCTTTGTGTTAAGTATTCAGCCACTGTTTTTAGATCTAGTTAATAGGTTCTATTTAATTTGCTACAACATTTACTGAATGGTGG
AGTGAAAAAACTGATGCATACTGGGAAATATCTACCATTTTTTAAAGATAATGTTAATTAGGAAAAGAACACTTTTAAGGAATTTATAGC
AGTGATGAAATGAATTCAGTTATATCAGATACACCAAACTGTTGATGGTATTTAAATGTGACTTCAAGTTAGTATTTCTGTATATATTAT
TGATTACTGGTTTGTTTTTAGATATGTAAGTCTGTTCTAATCTACAGTTCACATATCGACAGTTACTCTGGTAATAATAGAATGTTAGTG
ATGATCACTTGGTGGATGTTGATTAAGTGCCTGTGTTTTGTTTCCTCCTCTGGATACCAAATAGGTGTATGCTACTTTTTTGGTGAACTT
ATTTCTTGGAAGATTTGGCTATGCTATTCAGGGTTTTTATTCTTATGTTTTTCTTCTAAATTTAAGTAGCATCCTGCTGCTACCATATTA
AAGCTAAAATTTAACTTTTGCTGAAGAATCAGCTAATTCAGGTAATCCAAATATTTGTGGAAAAACATCTGGATAATTTATTGAACACAT
TAGTATTGTGTTAGACAGCTTTGATCATTCCCATTTCATAGGTTTTTATTGTGGAATAGTCAACTTAATATAGATTCACTTTCAATTTGC
ATGTATAAAGTAATACTCAATAAAATTTTTTTCATTTATTTTTCAACAGTGGTTATTTTTTTTCTTCCTGTACTATCAGTAAAATCCTGA
CTATGAGTTTTACTTTTGAAGCTAAAGGATAATGCTGGTAATCTAATTATGTACCTCTTACAGAAACCATATGCAGCACTTTAAAAATCT
TTATTTGGTATATTATTTTAGGTGGACAATGATTTAAGACTCAAAGCCATCATATTAAGGTCTAAATACATTAGTGGTGGGGTTTCTCGA
ATAAATGAGGAAGTGCACAAAAGTTCAGCCTGACTGAAAATTTTAATTGTGTTTTAAAACTACATGAATAATTTCTTGATTCAAAATCAG
AACTCTTATAAACTAAATCTGATGGTGTCCAAAGAATTTCAGGTCCTTCAAAGTTTGTAAAAGATAAGTAGGGGCCTAGGAATATAAAAA
TTTAGACTTTTTTAGTAAATGGTTTACATAACCTTTTGTCTTAATTTGTCATTCTTCATACACAGGCACAAGCTAATCAGTCTTCTCTAC
TTCTAGAACTCTAAATCTTCTCAGTAATGTCATACAAGTCTAACAAGAGGAAAAGCATCCTTAAGTCAGTCTATTTAGATAAACTCTTCA
AGTCCCTATATAAGGACGTATTCCACTAGCAAGCCAGTAAATTTTTCCAAGGTCACATAATCTTACATGAAATGGAACCTTTCATCTTAG
ACTTCATCAAACTCAATTTTTTCCCTTCTAGATTCACTTTGTGTTTATGCATGCATGCACGCGTGCACACAATTCTATCAGCAGCTGTAA
ACTACCCACATATTTTCTTAATCTCATTTTTTCAGTTTTTCTTCATCTTTAAAAGAGGTTACATTTCATTCCTGGTCAACTCTTAAAAAG
AATTATGTAATGTTGGGCCTTCATATTAAAGAGAGAGACTGGTTATAAGATCCTTTACAGTCCATTCATTTTATTCTGATGTCTAACCAG
ATAGACACTAGCAAGCAAAACTTCCCTCTTAATCCTGGACCAAATGCATAATTTTACTGTCACTTTCAAAAATCTGTTATGACTGAATCA
AAATCCTTTTAAAGAAAGGAAAAAGCTCCTTTTGTGTCAAATAGTTGAACAACATGAAAACAGTATGAGCCGGTTAAAGATAGATTGAAT
TTTTACTTTACACATATGAAAAACAGTAAGTTTTGACTGCTGTGTATGTTATTCATGTTAATATGTGCTCAGTTATTCACTATTGTTAAT
CCACATATAATCAGTTGCTATCCCTGGTTAGACACACTATGGAACTTGAAATGCACAATATTTACATTGTTAGAGGCTTCTATCCAAATA
TCTGCATTCCTTTAAAATGTGAACTATTTGCTGTGATTAACCAAAGGTAGATTATGTCATCAGTGGACATTTTAGCTTTATGGAAACAAA
TTATTAAGAAATGAATAGAAAGGTGTCTTTTTCTTTGTGTAGTGCAAAAGCCTAAAGCTATCAGTCAAAGGCCTAAGAAATCCACATTTG
AAAAACGTAAATCATGATTGGTAAGAATACATTCATCTGATAGTATTGAGAAAAGTTGAAAAACTGTTAGCCTTCCATAACACATTAAAC
ATTTTATGTATGGATGGCTGAAAGTATTGAGAAAAGCTGAAAAACTGTTAGCCTTCCATAACACATTAAACGTTTTGTGTATGGATGGCT
TAGGACAATAAACAACATCATTAAAGTAAAATTATGTCAGTCTGTTCATATTAACTTATTTAAATCAATGAAAATTTTGATGAGATGACT
AAATGGATGCTTTGGAAATGCAGGATTATAGGAGGCCTAAAAGTGCATCTTGTTTCTTGTAACCCTTTTAAAACCAATATGCCTGGCTAG
GTGCAGTGGCTCATGCCTGTAATACCAACGGGGTAACACAGGGTTATGCCGTCTATACAAAAAAATAAATGAGCTGGGCAAGATGGCATG
CACCTGTAGTCCCAGCTGCTTGGTAGGCTGAGGGGGAAGGATTGCTTGAGCCTGGGAGGTCGAGACTGCAGTGAGCCAAGATCACACCAC
TGCACTCCAGCCTGGGTGACAGAGCAAGACTCTACCTCAAAAATAAAAATAATCAATATAGTTTCAATGAAGCAAAGCATCTCAGGTAAC
AATTTGAGCATAACTTTAACCATAACTTATGATAGCATAATAACATTCATTAGTAATTCAGTAGCCGTATGTGCCAGGCTGTGTTAGGTG
CTTTATATATTGTTTAATTTTTAAAAACTTGTGGAGTGTACAGATTGGTAAGGTGACATTGTATCACAAAGCTAGTCTTTGAGTCCAAAG
TTTTGTGGTTTTATGTTATGATATACTTTTATCATGGAATTGTCTTATTAAATGTTTTGCCAGTGGTTCTTAAAGTGTGTTTCTGACACC
AGTAGCATTGACTTCACTTAGAAACCTGTTAGAAATACAAATTATTTGGCCCCACCCAACACTTGAGTCACAAACTTTGCAGATGGGGCT
CAATCTGTTTTAACAAGCGCTTCATGTAATTTTGATGCAGGCCTAAGTTTTTGAGCCACTGCAGTATGCATTTCTATTTTTAAGCAAAGA
TCTTGGTCTTTCTTTTTGGACATTGTAGAAATAACATGAACTTGTTTTTTGTTTGTTTTTGTTTTGTTTTGTTTTAAGCTCCTGATCTTT
GTTGGTTATGTTGCAAAAGATTGTATCAGGAGAAGCCTCAGCATGGACATTGGCATCCTGACATAACCCCCATTAATTTAGTATTCTTTC
TGAAACTCAAATGGATTCTCAAGTCCAAGAGACTATGGAATAAAATCATTGTTTGTCTGTGTTAAGTTTTATCTCTGTTATTGCCTGAAG


Top

FusionGenePPI for ST6GALNAC6_PAWR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ST6GALNAC6ATXN1, ATXN1L, APPPAWRTHAP1, SLC5A7, SLC5A1, AATF, DAPK3, PRKCZ, WT1, HSPA5, FBXO25, SPSB1, SPSB2, SPSB4, SQSTM1, DRD2, PAN2, APEH, CAND1, CARS, FAM129B, H3F3A, IDE, JMJD6, ATP6V1C1, SHMT1, PPM1G, SHMT2, SNX2, SNX6, STAT1, VPS29, FBXO45, CCDC8, EED, LUZP4, DDX39A, CEP290, CEP128, MYH9, HMG20A, IKBIP, SCOC, SLC25A41, G3BP1, HDAC6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ST6GALNAC6_PAWR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ST6GALNAC6_PAWR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePAWRC0036341Schizophrenia2PSYGENET
TgenePAWRC0041696Unipolar Depression2PSYGENET
TgenePAWRC1269683Major Depressive Disorder2PSYGENET
TgenePAWRC0001418Adenocarcinoma1CTD_human
TgenePAWRC0005586Bipolar Disorder1PSYGENET
TgenePAWRC0014170Endometrial Neoplasms1CTD_human
TgenePAWRC0033578Prostatic Neoplasms1CTD_human
TgenePAWRC0033975Psychotic Disorders1PSYGENET
TgenePAWRC0525045Mood Disorders1PSYGENET
TgenePAWRC0600427Cocaine Dependence1PSYGENET