FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36262

FusionGeneSummary for ST6GALNAC3_AK5

check button Fusion gene summary
Fusion gene informationFusion gene name: ST6GALNAC3_AK5
Fusion gene ID: 36262
HgeneTgene
Gene symbol

ST6GALNAC3

AK5

Gene ID

256435

26289

Gene nameST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3adenylate kinase 5
SynonymsPRO7177|SIAT7C|ST6GALNACIII|STYAK6
Cytomap

1p31.1

1p31.1

Type of geneprotein-codingprotein-coding
Descriptionalpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3GalNAc alpha-2,6-sialyltransferase IIIST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltranST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)adenylate kinase isoenzyme 5AK 5ATP-AMP transphosphorylase 5adenylate kinase 6
Modification date2018052320180519
UniProtAcc

Q8NDV1

Q9Y6K8

Ensembl transtripts involved in fusion geneENST00000328299, ENST00000464140, 
ENST00000354567, ENST00000344720, 
ENST00000317704, ENST00000478255, 
Fusion gene scores* DoF score2 X 2 X 2=85 X 3 X 4=60
# samples 25
** MAII scorelog2(2/8*10)=1.32192809488736log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ST6GALNAC3 [Title/Abstract] AND AK5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneST6GALNAC3

GO:0006677

glycosylceramide metabolic process

17123352

HgeneST6GALNAC3

GO:0006687

glycosphingolipid metabolic process

17123352

HgeneST6GALNAC3

GO:0009100

glycoprotein metabolic process

17123352

TgeneAK5

GO:0006165

nucleoside diphosphate phosphorylation

23416111

TgeneAK5

GO:0009142

nucleoside triphosphate biosynthetic process

23416111


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-LA-A7SW-01AST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000328299ENST00000354567ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
In-frameENST00000328299ENST00000344720ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
5CDS-intronENST00000328299ENST00000317704ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
5CDS-intronENST00000328299ENST00000478255ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
intron-3CDSENST00000464140ENST00000354567ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
intron-3CDSENST00000464140ENST00000344720ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
intron-intronENST00000464140ENST00000317704ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+
intron-intronENST00000464140ENST00000478255ST6GALNAC3chr1

76540569

+AK5chr1

77949002

+

Top

FusionProtFeatures for ST6GALNAC3_AK5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ST6GALNAC3

Q8NDV1

AK5

Q9Y6K8

Involved in the biosynthesis of ganglioside GD1A fromGM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAcresidue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteinsand glycolipids. ST6GalNAcIII prefers glycolipids to glycoproteins(By similarity). {ECO:0000250}. Nucleoside monophosphate (NMP) kinase that catalyzes thereversible transfer of the terminal phosphate group betweennucleoside triphosphates and monophosphates. Active on AMP anddAMP with ATP as a donor. When GTP is used as phosphate donor, theenzyme phosphorylates AMP, CMP, and to a small extent dCMP. Alsodisplays broad nucleoside diphosphate kinase activity.{ECO:0000269|PubMed:19647735, ECO:0000269|PubMed:23416111}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneST6GALNAC3chr1:76540569chr1:77949002ENST00000328299+151_86306Topological domainCytoplasmic
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714386_391327537Nucleotide bindingATP 2
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714433_435327537Nucleotide bindingAMP 2
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714462_465327537Nucleotide bindingAMP 2
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714386_391353563Nucleotide bindingATP 2
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714433_435353563Nucleotide bindingAMP 2
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714462_465353563Nucleotide bindingAMP 2
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714377_559327537RegionAdenylate kinase 2
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714406_435327537RegionNMPbind 2
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714499_509327537RegionLID 2
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714377_559353563RegionAdenylate kinase 2
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714406_435353563RegionNMPbind 2
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714499_509353563RegionLID 2

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneST6GALNAC3chr1:76540569chr1:77949002ENST00000328299+1529_3056306Topological domainLumenal
HgeneST6GALNAC3chr1:76540569chr1:77949002ENST00000328299+159_286306TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714142_147327537Nucleotide bindingATP 1
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714191_193327537Nucleotide bindingAMP 1
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714219_222327537Nucleotide bindingAMP 1
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714142_147353563Nucleotide bindingATP 1
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714191_193353563Nucleotide bindingAMP 1
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714219_222353563Nucleotide bindingAMP 1
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714133_316327537RegionAdenylate kinase 1
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714162_193327537RegionNMPbind 1
TgeneAK5chr1:76540569chr1:77949002ENST00000344720+714256_266327537RegionLID 1
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714133_316353563RegionAdenylate kinase 1
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714162_193353563RegionNMPbind 1
TgeneAK5chr1:76540569chr1:77949002ENST00000354567+714256_266353563RegionLID 1


Top

FusionGeneSequence for ST6GALNAC3_AK5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ST6GALNAC3_ENST00000328299_chr1_76540569_+_AK5_ENST00000354567_chr1_77949002_+_216aa
MACILKGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPS
GIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIP

>In-frame_ST6GALNAC3_ENST00000328299_chr1_76540569_+_AK5_ENST00000344720_chr1_77949002_+_216aa
MACILKGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPS
GIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ST6GALNAC3_ENST00000328299_chr1_76540569_+_AK5_ENST00000354567_chr1_77949002_+_648nt
ATGGCCTGCATCCTGAAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAA
ATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACT
GGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCA
GGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTG
AAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTT
CTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCC
GTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCT

>In-frame_ST6GALNAC3_ENST00000328299_chr1_76540569_+_AK5_ENST00000344720_chr1_77949002_+_648nt
ATGGCCTGCATCCTGAAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAA
ATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACT
GGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCA
GGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTG
AAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTT
CTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCC
GTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ST6GALNAC3_ENST00000328299_chr1_76540569_+_AK5_ENST00000354567_chr1_77949002_+_2092nt
GCAGCTTACACCGCGGTCCCCTTATTTGGATCTGCGGGAATGTGGGCTGGAGAGGTCCTGCCGTGGTACCAGCCTCCAGCCTGCCCCCAG
GACTGCCCCTGACCCAGGCGCGCCCGCTGCTCGGTGGCAGGAGGGCCGGCGGAGCGCCATGGCCTGCATCCTGAAGGGTGATGACCAGTT
AAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGG
CAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGA
ATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCAT
GGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGG
AGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGA
CGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCT
ACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGAAGGCAAAAATGCAT
GTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCA
ACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGCATGGTGTATTTGGG
ACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCACACTCAGAGCTAGT
CAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGTTCTCCTCTCATTAA
GCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTT
TGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTTGTACATGATATAGA
GGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACCCAGGTTAGTCATCA
GTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAATTGTGTAACCTAGT
CTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGATATTTGCTATTTCA
TTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAAAAAAATACCCTAAC
AAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCT
TGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAG
AGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTT
TTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAAATGGATATGTACAA

>In-frame_ST6GALNAC3_ENST00000328299_chr1_76540569_+_AK5_ENST00000344720_chr1_77949002_+_2088nt
GCAGCTTACACCGCGGTCCCCTTATTTGGATCTGCGGGAATGTGGGCTGGAGAGGTCCTGCCGTGGTACCAGCCTCCAGCCTGCCCCCAG
GACTGCCCCTGACCCAGGCGCGCCCGCTGCTCGGTGGCAGGAGGGCCGGCGGAGCGCCATGGCCTGCATCCTGAAGGGTGATGACCAGTT
AAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGG
CAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGA
ATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCAT
GGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGG
AGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGA
CGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCT
ACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGAAGGCAAAAATGCAT
GTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCA
ACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGCATGGTGTATTTGGG
ACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCACACTCAGAGCTAGT
CAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGTTCTCCTCTCATTAA
GCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTT
TGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTTGTACATGATATAGA
GGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACCCAGGTTAGTCATCA
GTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAATTGTGTAACCTAGT
CTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGATATTTGCTATTTCA
TTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAAAAAAATACCCTAAC
AAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCT
TGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAG
AGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTT
TTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAAATGGATATGTACAA


Top

FusionGenePPI for ST6GALNAC3_AK5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ST6GALNAC3CAMK1, SAAL1, SELENBP1, PON2, DSG4, PKP3, PTCH1, SCN3B, GGT7, CLEC2D, KLRG2, TMED6, DUSP14, NCEH1AK5C7orf26, CPNE6, NUCKS1, STRN4, TRIM46, UGDH, RNF114, CEBPA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ST6GALNAC3_AK5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ST6GALNAC3_AK5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAK5C0236733Amphetamine-Related Disorders1CTD_human