FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36046

FusionGeneSummary for SRPK2_ZC3HC1

check button Fusion gene summary
Fusion gene informationFusion gene name: SRPK2_ZC3HC1
Fusion gene ID: 36046
HgeneTgene
Gene symbol

SRPK2

ZC3HC1

Gene ID

6733

51530

Gene nameSRSF protein kinase 2zinc finger C3HC-type containing 1
SynonymsSFRSK2HSPC216|NIPA
Cytomap

7q22.3

7q32.2

Type of geneprotein-codingprotein-coding
DescriptionSRSF protein kinase 2SFRS protein kinase 2SR protein kinase 2SR-protein-specific kinase 2serine kinase SRPK2serine/arginine-rich protein-specific kinase 2serine/arginine-rich splicing factor kinase 2serine/threonine-protein kinase SRPK2nuclear-interacting partner of ALKhematopoietic stem/progenitor cell protein 216nuclear interacting partner of anaplastic lymphoma kinase (ALK)
Modification date2018052320180529
UniProtAcc

P78362

Q86WB0

Ensembl transtripts involved in fusion geneENST00000393651, ENST00000357311, 
ENST00000489828, ENST00000493638, 
ENST00000358303, ENST00000360708, 
ENST00000311873, ENST00000481503, 
Fusion gene scores* DoF score11 X 6 X 10=6603 X 3 X 4=36
# samples 194
** MAII scorelog2(19/660*10)=-1.79646660591487
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SRPK2 [Title/Abstract] AND ZC3HC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSRPK2

GO:0000245

spliceosomal complex assembly

9472028

HgeneSRPK2

GO:0006468

protein phosphorylation

9472028

HgeneSRPK2

GO:0008284

positive regulation of cell proliferation

18559500

HgeneSRPK2

GO:0008380

RNA splicing

9472028

HgeneSRPK2

GO:0035556

intracellular signal transduction

9472028

HgeneSRPK2

GO:0045070

positive regulation of viral genome replication

20498328

HgeneSRPK2

GO:0045071

negative regulation of viral genome replication

12417631


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-5P-A9JZ-01ASRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000393651ENST00000358303SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000393651ENST00000360708SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000393651ENST00000311873SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000393651ENST00000481503SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000357311ENST00000358303SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000357311ENST00000360708SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000357311ENST00000311873SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
Frame-shiftENST00000357311ENST00000481503SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
In-frameENST00000489828ENST00000358303SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
In-frameENST00000489828ENST00000360708SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
In-frameENST00000489828ENST00000311873SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
In-frameENST00000489828ENST00000481503SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
intron-3CDSENST00000493638ENST00000358303SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
intron-3CDSENST00000493638ENST00000360708SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
intron-3CDSENST00000493638ENST00000311873SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-
intron-3CDSENST00000493638ENST00000481503SRPK2chr7

104800954

-ZC3HC1chr7

129688984

-

Top

FusionProtFeatures for SRPK2_ZC3HC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SRPK2

P78362

ZC3HC1

Q86WB0

Serine/arginine-rich protein-specific kinase whichspecifically phosphorylates its substrates at serine residueslocated in regions rich in arginine/serine dipeptides, known as RSdomains and is involved in the phosphorylation of SR splicingfactors and the regulation of splicing. Promotes neuronalapoptosis by up-regulating cyclin-D1 (CCND1) expression. This isdone by the phosphorylation of SRSF2, leading to the suppressionof p53/TP53 phosphorylation thereby relieving the repressiveeffect of p53/TP53 on cyclin-D1 (CCND1) expression. PhosphorylatesACIN1, and redistributes it from the nuclear speckles to thenucleoplasm, resulting in cyclin A1 but not cyclin A2 up-regulation. Plays an essential role in spliceosomal B complexformation via the phosphorylation of DDX23/PRP28. Can mediatehepatitis B virus (HBV) core protein phosphorylation. Plays anegative role in the regulation of HBV replication through amechanism not involving the phosphorylation of the core proteinbut by reducing the packaging efficiency of the pregenomic RNA(pgRNA) without affecting the formation of the viral coreparticles. {ECO:0000269|PubMed:12134018,ECO:0000269|PubMed:16122776, ECO:0000269|PubMed:18425142,ECO:0000269|PubMed:18559500, ECO:0000269|PubMed:19592491,ECO:0000269|PubMed:21056976, ECO:0000269|PubMed:21157427,ECO:0000269|PubMed:9472028}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SRPK2_ZC3HC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000358303_chr7_129688984_-_650aa
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWG
HFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQEGHVCHIPVSXWITPSGTTFIGIYKQRSLLXQSGNIFFFEMGRXALXAVSTRLCKIWLGHSGMXYAQVLXLSSF
SLCQFTTSFXLXQIXATMCXAEESLVYCPXEVLFLARQPIPRPIWDVAPGXACYSCXXIPRSFSKPLSLGPPASFPKAGGLENYVLDRRQ
DQSSPTLAXRXTXSPNXXEKNYNQIRLRHPSPRHCLYSLCVWLGVXFLFGIHAALPDNMFAMYEEGGALGLPADXIVHDXPGCILWPDQL
PNPRPXGATRALTSGAXISSEDDDPEPGCHFLPRLRAGXKEPWSHCLSNSELGLFQSCXPSXARGCXPHHQNSPSDPKHGNRRHPWPGGT
IXPSAESQASSPLLLQQFGHIFPKLLXSHLSAXRLVPLGEYHTWQRKQGEWWNXTRCQRPSRARLESSADHPLGAQTVXPASXNGLHESL

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000360708_chr7_129688984_-_579aa
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWG
HFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQEGHVCHIPVSXWITPSGTTFIGIYKQRSLLXQSGNIFFFEMGRXALXAVSTRLCKIWLGHSGMXYAQVLXLSSF
SLCQFTTSFXLXQIXATMCXAEESLVYCPXEVLFLARQPIPRPIWDVAPGXACYSCXXIPRSFSKPLSLGPPASFPKAGGLENYVLDRRQ
DQSSPTLAXRXTXSPNXXEKNYNQIRLRHPSPRHCLYSLCVWLGVXFLFGIHAALPDNMFAMYEEGGALGLPADXIVHDXPGCILWPDQL
PNPRPXGATRALTSGAXISSEDDDPEPGCHFLPRLRAGHIFPKLLXSHLSAXRLVPLGEYHTWQRKQGEWWNXTRCQRPSRARLESSADH

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000311873_chr7_129688984_-_650aa
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWG
HFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQEGHVCHIPVSXWITPSGTTFIGIYKQRSLLXQSGNIFFFEMGRXALXAVSTRLCKIWLGHSGMXYAQVLXLSSF
SLCQFTTSFXLXQIXATMCXAEESLVYCPXEVLFLARQPIPRPIWDVAPGXACYSCXXIPRSFSKPLSLGPPASFPKAGGLENYVLDRRQ
DQSSPTLAXRXTXSPNXXEKNYNQIRLRHPSPRHCLYSLCVWLGVXFLFGIHAALPDNMFAMYEEGGALGLPADXIVHDXPGCILWPDQL
PNPRPXGATRALTSGAXISSEDDDPEPGCHFLPRLRAGXKEPWSHCLSNSELGLFQSCXPSXARGCXPHHQNSPSDPKHGNRRHPWPGGT
IXPSAESQASSPLLLQQFGHIFPKLLXSHLSAXRLVPLGEYHTWQRKQGEWWNXTRCQRPSRARLESSADHPLGAQTVXPASXNGLHESL

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000481503_chr7_129688984_-_607aa
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWG
HFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQEGHVCHIPVSXWITPSGTTFIGIYKQRSLLXQSGNIFFFEMGRXALXAVSTRLCKIWLGHSGMXYAQVLXLSSF
SLCQFTTSFXLXQIXATMCXAEESLVYCPXEVLFLARQPIPRPIWDVAPGXACYSCXXIPRSFSKPLSLGPPASFPKAGGLENYVLDRRQ
DQSSPTLAXRXTXSPNXXEKNYNQIRLRHPSPRHCLYSLCVWLGVXLPNPRPXGATRALTSGAXISSEDDDPEPGCHFLPRLRAGXKEPW
SHCLSNSELGLFQSCXPSXARGCXPHHQNSPSDPKHGNRRHPWPGGTIXPSAESQASSPLLLQQFGHIFPKLLXSHLSAXRLVPLGEYHT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000358303_chr7_129688984_-_1951nt
ATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACCA
CCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCCT
GCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGGG
CACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGAG
ACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGAC
GACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATCC
AACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCACC
CCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTAA
GCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTTT
TCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATGA
GAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCCT
AGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACAA
GATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCCA
AGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGTTCCTCTTTGGAATCCATGCAGCTCTCCCTGATAACATGTTC
GCAATGTATGAGGAAGGTGGGGCTCTGGGGCTTCCAGCAGATTGAATCGTCCATGACTGACCTGGATGCATCCTTTGGCCTGACCAGCTC
CCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACCTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCAC
TTTCTCCCCAGGCTCAGAGCAGGCTGAAAAGAGCCCTGGTCCCATTGTCTCTCGAACTCGGAGCTGGGACTCTTCCAGTCCTGTTGACCG
TCCTGAGCCAGAGGCTGCTAGCCCCACCACCAGAACTCGCCCAGTGACCCGAAGCATGGGAACAGGAGACACCCCTGGCCTGGAGGTACC
ATCTAGCCCTCTGCGGAAAGCCAAGCGAGCTCGCCTCTGCTCCTCCAGCAGTTCGGACACATCTTCCCGAAGCTTCTTTGATCCCACCTC
TCAGCATAGAGACTGGTGCCCTTGGGTGAATATCACACTTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCCC
AGCAGAGCCAGGCTGGAAAGCAGTGCTGACCATCCTCTTGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCTC

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000360708_chr7_129688984_-_1738nt
ATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACCA
CCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCCT
GCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGGG
CACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGAG
ACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGAC
GACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATCC
AACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCACC
CCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTAA
GCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTTT
TCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATGA
GAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCCT
AGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACAA
GATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCCA
AGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGTTCCTCTTTGGAATCCATGCAGCTCTCCCTGATAACATGTTC
GCAATGTATGAGGAAGGTGGGGCTCTGGGGCTTCCAGCAGATTGAATCGTCCATGACTGACCTGGATGCATCCTTTGGCCTGACCAGCTC
CCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACCTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCAC
TTTCTCCCCAGGCTCAGAGCAGGACACATCTTCCCGAAGCTTCTTTGATCCCACCTCTCAGCATAGAGACTGGTGCCCTTGGGTGAATAT
CACACTTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCCCAGCAGAGCCAGGCTGGAAAGCAGTGCTGACCAT
CCTCTTGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCTCTGAGAAATCAAGGAAAGTATTCCGAATATTTCG

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000311873_chr7_129688984_-_1951nt
ATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACCA
CCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCCT
GCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGGG
CACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGAG
ACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGAC
GACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATCC
AACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCACC
CCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTAA
GCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTTT
TCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATGA
GAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCCT
AGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACAA
GATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCCA
AGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGTTCCTCTTTGGAATCCATGCAGCTCTCCCTGATAACATGTTC
GCAATGTATGAGGAAGGTGGGGCTCTGGGGCTTCCAGCAGATTGAATCGTCCATGACTGACCTGGATGCATCCTTTGGCCTGACCAGCTC
CCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACCTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCAC
TTTCTCCCCAGGCTCAGAGCAGGCTGAAAAGAGCCCTGGTCCCATTGTCTCTCGAACTCGGAGCTGGGACTCTTCCAGTCCTGTTGACCG
TCCTGAGCCAGAGGCTGCTAGCCCCACCACCAGAACTCGCCCAGTGACCCGAAGCATGGGAACAGGAGACACCCCTGGCCTGGAGGTACC
ATCTAGCCCTCTGCGGAAAGCCAAGCGAGCTCGCCTCTGCTCCTCCAGCAGTTCGGACACATCTTCCCGAAGCTTCTTTGATCCCACCTC
TCAGCATAGAGACTGGTGCCCTTGGGTGAATATCACACTTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCCC
AGCAGAGCCAGGCTGGAAAGCAGTGCTGACCATCCTCTTGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCTC

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000481503_chr7_129688984_-_1822nt
ATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACCA
CCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCCT
GCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGGG
CACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGAG
ACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGAC
GACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATCC
AACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCACC
CCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTAA
GCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTTT
TCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATGA
GAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCCT
AGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACAA
GATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCCA
AGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGCTCCCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACC
TCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCACTTTCTCCCCAGGCTCAGAGCAGGCTGAAAAGAGCCCTGG
TCCCATTGTCTCTCGAACTCGGAGCTGGGACTCTTCCAGTCCTGTTGACCGTCCTGAGCCAGAGGCTGCTAGCCCCACCACCAGAACTCG
CCCAGTGACCCGAAGCATGGGAACAGGAGACACCCCTGGCCTGGAGGTACCATCTAGCCCTCTGCGGAAAGCCAAGCGAGCTCGCCTCTG
CTCCTCCAGCAGTTCGGACACATCTTCCCGAAGCTTCTTTGATCCCACCTCTCAGCATAGAGACTGGTGCCCTTGGGTGAATATCACACT
TGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCCCAGCAGAGCCAGGCTGGAAAGCAGTGCTGACCATCCTCTT
GGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCTCTGAGAAATCAAGGAAAGTATTCCGAATATTTCGGCAGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000358303_chr7_129688984_-_2510nt
GTTGGAGTGGGCCCTGTGCCTCTGCTGTCTCCTACTGCTAACGAGTGAACAACCAAGGCGATGGGCTGTAGGATGTTGATACATCTGAGG
GGCCAGATGGCCACCATATCAGGGAAAGCCAATGTGTTTTGAAAAATATGCAAATGTTCAATAAGAAATCAAGCAGAAGATTGAGCTGCT
GATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACC
ACCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCC
TGCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGG
GCACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGA
GACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGA
CGACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATC
CAACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCAC
CCCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTA
AGCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTT
TTCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATG
AGAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCC
TAGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACA
AGATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCC
AAGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGTTCCTCTTTGGAATCCATGCAGCTCTCCCTGATAACATGTT
CGCAATGTATGAGGAAGGTGGGGCTCTGGGGCTTCCAGCAGATTGAATCGTCCATGACTGACCTGGATGCATCCTTTGGCCTGACCAGCT
CCCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACCTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCA
CTTTCTCCCCAGGCTCAGAGCAGGCTGAAAAGAGCCCTGGTCCCATTGTCTCTCGAACTCGGAGCTGGGACTCTTCCAGTCCTGTTGACC
GTCCTGAGCCAGAGGCTGCTAGCCCCACCACCAGAACTCGCCCAGTGACCCGAAGCATGGGAACAGGAGACACCCCTGGCCTGGAGGTAC
CATCTAGCCCTCTGCGGAAAGCCAAGCGAGCTCGCCTCTGCTCCTCCAGCAGTTCGGACACATCTTCCCGAAGCTTCTTTGATCCCACCT
CTCAGCATAGAGACTGGTGCCCTTGGGTGAATATCACACTTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCC
CAGCAGAGCCAGGCTGGAAAGCAGTGCTGACCATCCTCTTGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCT
CTGAGAAATCAAGGAAAGTATTCCGAATATTTCGGCAGTGGGAATCTCTGTGCTCATGCTGAAGATACTCCAGCGCCTTCCTGGAGATAG
CTGGAATGAGAGTGACTTTTTGAAAAATTAAGGCTGAGTTCCTTTCGGTCAGCTGACACTAAGTTTTTCCTGTTCTGGGTTAATCATAAG
GAGCCCCCTGCCATAGCAAAGGCAGTGAGTGTCAACTATCTGCATCTGGCTGAGAGAGACCCGTTTCCTTTCAGGGATGTGGACAGGGTA
AGGGCAGCAAGCATGGTTCTGTTAAAGGAGTGTGGGATTAACAGACTAGAAGGAAGACTAAGGACCTGACCACCCATTTCAGCATCTTCA

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000360708_chr7_129688984_-_2291nt
GTTGGAGTGGGCCCTGTGCCTCTGCTGTCTCCTACTGCTAACGAGTGAACAACCAAGGCGATGGGCTGTAGGATGTTGATACATCTGAGG
GGCCAGATGGCCACCATATCAGGGAAAGCCAATGTGTTTTGAAAAATATGCAAATGTTCAATAAGAAATCAAGCAGAAGATTGAGCTGCT
GATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACC
ACCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCC
TGCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGG
GCACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGA
GACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGA
CGACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATC
CAACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCAC
CCCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTA
AGCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTT
TTCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATG
AGAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCC
TAGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACA
AGATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCC
AAGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGTTCCTCTTTGGAATCCATGCAGCTCTCCCTGATAACATGTT
CGCAATGTATGAGGAAGGTGGGGCTCTGGGGCTTCCAGCAGATTGAATCGTCCATGACTGACCTGGATGCATCCTTTGGCCTGACCAGCT
CCCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACCTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCA
CTTTCTCCCCAGGCTCAGAGCAGGACACATCTTCCCGAAGCTTCTTTGATCCCACCTCTCAGCATAGAGACTGGTGCCCTTGGGTGAATA
TCACACTTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCCCAGCAGAGCCAGGCTGGAAAGCAGTGCTGACCA
TCCTCTTGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCTCTGAGAAATCAAGGAAAGTATTCCGAATATTTC
GGCAGTGGGAATCTCTGTGCTCATGCTGAAGATACTCCAGCGCCTTCCTGGAGATAGCTGGAATGAGAGTGACTTTTTGAAAAATTAAGG
CTGAGTTCCTTTCGGTCAGCTGACACTAAGTTTTTCCTGTTCTGGGTTAATCATAAGGAGCCCCCTGCCATAGCAAAGGCAGTGAGTGTC
AACTATCTGCATCTGGCTGAGAGAGACCCGTTTCCTTTCAGGGATGTGGACAGGGTAAGGGCAGCAAGCATGGTTCTGTTAAAGGAGTGT
GGGATTAACAGACTAGAAGGAAGACTAAGGACCTGACCACCCATTTCAGCATCTTCAATGTGGAGCAGTGTTCTGAGGACTCTTCTATCC

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000311873_chr7_129688984_-_2503nt
GTTGGAGTGGGCCCTGTGCCTCTGCTGTCTCCTACTGCTAACGAGTGAACAACCAAGGCGATGGGCTGTAGGATGTTGATACATCTGAGG
GGCCAGATGGCCACCATATCAGGGAAAGCCAATGTGTTTTGAAAAATATGCAAATGTTCAATAAGAAATCAAGCAGAAGATTGAGCTGCT
GATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACC
ACCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCC
TGCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGG
GCACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGA
GACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGA
CGACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATC
CAACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCAC
CCCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTA
AGCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTT
TTCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATG
AGAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCC
TAGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACA
AGATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCC
AAGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGTTCCTCTTTGGAATCCATGCAGCTCTCCCTGATAACATGTT
CGCAATGTATGAGGAAGGTGGGGCTCTGGGGCTTCCAGCAGATTGAATCGTCCATGACTGACCTGGATGCATCCTTTGGCCTGACCAGCT
CCCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTACCTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCA
CTTTCTCCCCAGGCTCAGAGCAGGCTGAAAAGAGCCCTGGTCCCATTGTCTCTCGAACTCGGAGCTGGGACTCTTCCAGTCCTGTTGACC
GTCCTGAGCCAGAGGCTGCTAGCCCCACCACCAGAACTCGCCCAGTGACCCGAAGCATGGGAACAGGAGACACCCCTGGCCTGGAGGTAC
CATCTAGCCCTCTGCGGAAAGCCAAGCGAGCTCGCCTCTGCTCCTCCAGCAGTTCGGACACATCTTCCCGAAGCTTCTTTGATCCCACCT
CTCAGCATAGAGACTGGTGCCCTTGGGTGAATATCACACTTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCC
CAGCAGAGCCAGGCTGGAAAGCAGTGCTGACCATCCTCTTGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCT
CTGAGAAATCAAGGAAAGTATTCCGAATATTTCGGCAGTGGGAATCTCTGTGCTCATGCTGAAGATACTCCAGCGCCTTCCTGGAGATAG
CTGGAATGAGAGTGACTTTTTGAAAAATTAAGGCTGAGTTCCTTTCGGTCAGCTGACACTAAGTTTTTCCTGTTCTGGGTTAATCATAAG
GAGCCCCCTGCCATAGCAAAGGCAGTGAGTGTCAACTATCTGCATCTGGCTGAGAGAGACCCGTTTCCTTTCAGGGATGTGGACAGGGTA
AGGGCAGCAAGCATGGTTCTGTTAAAGGAGTGTGGGATTAACAGACTAGAAGGAAGACTAAGGACCTGACCACCCATTTCAGCATCTTCA

>In-frame_SRPK2_ENST00000489828_chr7_104800954_-_ZC3HC1_ENST00000481503_chr7_129688984_-_2341nt
GTTGGAGTGGGCCCTGTGCCTCTGCTGTCTCCTACTGCTAACGAGTGAACAACCAAGGCGATGGGCTGTAGGATGTTGATACATCTGAGG
GGCCAGATGGCCACCATATCAGGGAAAGCCAATGTGTTTTGAAAAATATGCAAATGTTCAATAAGAAATCAAGCAGAAGATTGAGCTGCT
GATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCTCCTTTAGTTCCTCCTCCTCCACCGCCACC
ACCACCACCACCGCCACCTTTGCCAGACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCC
TGCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAAAGCTTGGATGGGG
GCACTTCTCTACTGTCTGGCTGTGCTGGGATATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGA
GACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCAAACAAAGACATGGTGGTCCAGCTCATTGA
CGACTTCAAGATTTCAGGCATGAATGGGATACATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATC
CAACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGAAGGACACGTCTGCCACATCCCAGTCAGTTAATGGATCAC
CCCAAGCGGAACAACCTTCATTGGAATCTACAAGCAAAGAAGCCTTCTTTAGCAGAGTGGAAACATTTTCTTCTTTGAAATGGGCAGGTA
AGCCCTTTGAGCTGTCTCCACTCGTCTGTGCAAAATATGGCTGGGTCACAGTGGAATGTGATATGCTCAAGTGCTCTAGCTGTCAAGCTT
TTCTCTGTGCCAGTTTACAACCAGCTTTTGACTTTGACAGATATAAGCAACGATGTGCTGAGCTGAAGAAAGCCTTGTGTACTGCCCATG
AGAAGTTCTGTTTCTGGCCAGACAGCCCATCCCCAGACCGATTTGGGATGTTGCCCCTGGATGAGCCTGCTATTCTTGTTAGTGAATTCC
TAGATCGTTTTCAAAGCCTTTGTCACTTGGACCTCCAGCTTCCTTCCCTAAGGCCGGAGGACTTGAAAACTATGTGCTTGACAGAAGACA
AGATCAGTCTTCTCCTACACTTGCTTGAAGATGAACTTGATCACCGAACTGATGAGAGAAAAACTACAATCAAATTAGGCTCAGACATCC
AAGTCCACGTCACTGCCTGTATTCTCTCTGTGTGTGGCTGGGCGTGTAGCTCCCCAATCCCAGGCCTTGAGGGGCGACCAGAGCGCTTAC
CTCTGGTGCCTGAATCTCCTCGGAGGATGATGACCCGGAGCCAGGATGCCACTTTCTCCCCAGGCTCAGAGCAGGCTGAAAAGAGCCCTG
GTCCCATTGTCTCTCGAACTCGGAGCTGGGACTCTTCCAGTCCTGTTGACCGTCCTGAGCCAGAGGCTGCTAGCCCCACCACCAGAACTC
GCCCAGTGACCCGAAGCATGGGAACAGGAGACACCCCTGGCCTGGAGGTACCATCTAGCCCTCTGCGGAAAGCCAAGCGAGCTCGCCTCT
GCTCCTCCAGCAGTTCGGACACATCTTCCCGAAGCTTCTTTGATCCCACCTCTCAGCATAGAGACTGGTGCCCTTGGGTGAATATCACAC
TTGGCAAAGAAAGCAGGGAGAATGGTGGAACTGAACCAGATGCCAGCGCCCCAGCAGAGCCAGGCTGGAAAGCAGTGCTGACCATCCTCT
TGGCGCACAAACAGTCTAGCCAGCCAGCTGAAACGGACTCCATGAGTCTCTCTGAGAAATCAAGGAAAGTATTCCGAATATTTCGGCAGT
GGGAATCTCTGTGCTCATGCTGAAGATACTCCAGCGCCTTCCTGGAGATAGCTGGAATGAGAGTGACTTTTTGAAAAATTAAGGCTGAGT
TCCTTTCGGTCAGCTGACACTAAGTTTTTCCTGTTCTGGGTTAATCATAAGGAGCCCCCTGCCATAGCAAAGGCAGTGAGTGTCAACTAT
CTGCATCTGGCTGAGAGAGACCCGTTTCCTTTCAGGGATGTGGACAGGGTAAGGGCAGCAAGCATGGTTCTGTTAAAGGAGTGTGGGATT
AACAGACTAGAAGGAAGACTAAGGACCTGACCACCCATTTCAGCATCTTCAATGTGGAGCAGTGTTCTGAGGACTCTTCTATCCTAGGAC


Top

FusionGenePPI for SRPK2_ZC3HC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SRPK2U2AF2, RNPS1, SRSF1, SRSF3, SRSF2, SRSF5, SRSF6, SNRNP70, LUC7L3, SRPK1, VAV2, ARRB2, CUL3, APP, ESR1, BARD1, U2AF1, DDX46, RBM23, RBM39, PRPF38A, CTNNBL1, SNIP1, ACIN1, ARGLU1, SNRNP27, YTHDC1, DDX21, LUC7L, SRRM1, PABPC4, PRPF4B, SRRM2, PNN, SRPK2, SNRPD1, EIF4A3, HNRNPM, NOP2, DHX15, SNRPA, SNRPC, PCBP1, BCLAF1, RBBP6, PABPC1, C1orf35, DROSHA, LUC7L2, SRSF8, HNRNPC, RBM8A, MAGOH, SRSF7, TJP2, ALMS1, HNRNPCL1, CLASRP, DIDO1, DDX50, SNRPB, DGCR8, THRAP3, HNRNPH2, DDX39A, DDX39B, CPSF6, SON, NUDT21, NSG1, CHTOP, CDK13, FOXN3, EIF1AY, CHD2, TNFRSF10C, CASK, AURKA, CHUK, ARPC1B, UBD, NCK2, AHCYL1, TLE4, ERN1, DNAJC8, GABARAP, ZRANB2, TDP2, PAK4, ABL1, POLB, NELFE, ERCC3, MDK, PSMA3, DDX6, PTBP1, APEX1, GTF2E1, SRI, YWHAB, RPL22, MAGEB1, CBX5, CLK1, CLK3, CDK7, ADPRH, TPD52, RWDD2B, YPEL3, FGF12, WDR5, PPIA, RPL41, TRA2B, RNF4, MRPS6, PRKAA1, SRSF9, IFIT5, MPP3, TCOF1, TRA2A, DHX8, DRAP1, BRD3, SEC23B, HMGN3, ZRSR2, ENOX2, SNRNP35, C4orf46, C17orf85, TAF7L, FAM76B, ATAT1, ARL6IP4, AMMECR1L, CSAG1, RSRC2, NPM2, CAND1, LCA5, FAM90A1, MAPKAPK5, CCDC28A, ARHGAP12, CHERP, GPR114, DAW1, CLDN19, MARCH10, LRRN4CL, DBF4B, TNIP2, MCOLN3, EPS8L3, C16orf78, SDR42E1, TRIM41, SREK1, SRSF12, TTN, RTF1, RIT1, C18orf25, EVI5L, RPL39L, CCDC97, PELI1, NGLY1, RSRC1, EGLN2, UBE2E2, ALKBH3, YPEL2, RBM15, RIT2, VRK1, VIMP, CCM2, RSRP1, HIRIP3, LCE3D, NSRP1, GABARAPL1, KCNN2, CDC42EP4, EPB41L1, OCEL1, ZMAT4, EPB41L4A, PDE7B, NXT2, APOBEC3C, HOMER3, CBLN4, NSMCE4A, SLAIN2, NUP50, BAIAP2, DRG1, NOP16, PPIL1, HBS1L, MAB21L2, SUPT16H, SNURF, CACNG2, STON1, AES, CLK2, ZSCAN9, FXR2, LUZP4, BMI1, PPM1G, PRPF8, NTRK1, C5orf42, ACTB, ACTG1, ADAMTS18, AKAP13, ALDOA, ALPL, ANK3, ANKFY1, ANKRD35, AP1M1, KIAA1244, ARSG, ASL, BAG3, BAZ1A, BCL9L, BUD13, EFCAB12, ELP6, CADPS2, CALCOCO1, CAMSAP1, CARD11, CARHSP1, MTCL1, CCDC86, CCDC88B, CDK12, CEP170, CHD1L, CHEK2, CLASP1, CLASP2, CLCNKA, CLU, CPSF7, CRTC1, YBX3, DCAF10, DDX3X, DNAH6, DNAH9, DOCK3, ECT2, EED, EIF3A, EIF4B, EIF4G1, ELAVL3, ENSA, EPB41L4B, EPM2A, EPS8L1, ERBB3, ERC1, F5, AMER1, FAM179B, FAM43A, NXPE4, FBXO24, FCHO1, FGFR3, FIP1L1, FMNL1, GBF1, GCC2, GGCX, GHR, GLRA4, GLTSCR2, GNGT2, GSE1, GTPBP4, GXYLT2, HERC3, HIST1H2BK, HIVEP1, HMCN2, HMGA1, HMGN2, HMGXB4, HNRNPA1, HNRNPA3, HNRNPK, HTATSF1, IRS2, ISLR, JMJD1C, KANK2, KHDRBS1, KIF11, KRT78, LBR, LDHC, LINC00322, LMNA, LMNB1, LMO7, LRRC34, LRRC52, MACF1, MAP1S, MAP4, MAP7, MAP7D1, MAPKAPK3, MAPRE1, MAST2, MATR3, MDC1, MFSD10, MIB2, MIPOL1, ZAK, MMP23B, MYCBP2, MYLIP, MYO18B, MYO1E, MZT2B, NADK, NAGK, NCL, NGDN, NKAP, NOLC1, NSUN5P2, NTHL1, NXF1, OTOF, PALLD, PCF11, PDCL3, PHF6, PHLDB1, PKD1L2, PLEKHA5, PNMAL2, POLDIP3, PPHLN1, PPP1R13L, PRPF38B, PRRC2A, PRRC2B, PRRC2C, PSMD13, PTPN22, RABEP1, RASGRF1, RBM15B, RBM19, RBMX, RIPK3, RNF219, RPL13, RPL34, RPL37, RPLP2, RPS26, RRM2B, RRP1, RRP1B, RSL1D1, RXFP1, S100A4, SAFB, SART1, SBK1, SCAF1, SDK2, SEC16B, SERPING1, PNISR, SGPL1, SIPA1L3, SLC13A2, SLC17A6, SLFN5, SLTM, SMCHD1, SPDEF, SPEN, SRC, SRSF11, SRXN1, SYCP2, TCEANC2, TMEM57, TMPO, TMPRSS11A, TMSB10, TNFAIP8L2, TNS3, TOP1, TRIP12, TUBA1B, TXN, UBR4, UPF3B, USP36, USP39, VAC14, VSTM2L, WDR24, WDR70, XRCC5, YRDC, YTHDC2, ZC3H13, ZC3H18, ZCCHC17, ZDHHC5, ZFC3H1, ZFHX4, ZFP91, ZMYM4, ZNF140, ZNF234, ZNF529, ZNF592, ZNF593, ZNF616, FOXK2, FOXL2, FOXQ1, YBX1, AKT1, INO80B, TRIM25ZC3HC1CCNB1, SKP1, CUL1, RBX1, TNFSF11, PDPK1, TSC22D1, ALK, APP, EHD4, GTF3C4, AASDHPPT, HNRNPA1, PFKL, RPL38, TRIP13, FZR1, MAPK3, MAPK1, FAM188A, ATP6V1C2, GRN, HIST1H2BG, CDC5L, YWHAE, NXF2B, PLK1, SASS6, GPX7, TPR, FAM19A3, SRBD1, ETNPPL, SALL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SRPK2_ZC3HC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SRPK2_ZC3HC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneZC3HC1C1956346Coronary Artery Disease1CTD_human