|
Fusion gene ID: 35963 |
FusionGeneSummary for SRFBP1_PRM1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: SRFBP1_PRM1 | Fusion gene ID: 35963 | Hgene | Tgene | Gene symbol | SRFBP1 | PRM1 | Gene ID | 153443 | 137902 |
Gene name | serum response factor binding protein 1 | peroxidasin like | |
Synonyms | BUD22|P49|Rlb1|STRAP|p49/STRAP | PMR1|PRM1|VPO2 | |
Cytomap | 5q23.1 | 8q11.22-q11.23 | |
Type of gene | protein-coding | protein-coding | |
Description | serum response factor-binding protein 1BUD22 homologSRF-dependent transcription regulation-associated protein | peroxidasin-like proteincardiac peroxidasecardiovascular peroxidase 2peroxidasin homolog-likepolysomal ribonuclease 1 homologvascular peroxidase 2 | |
Modification date | 20180523 | 20180523 | |
UniProtAcc | Q8NEF9 | P04553 | |
Ensembl transtripts involved in fusion gene | ENST00000504881, ENST00000339397, | ENST00000312511, | |
Fusion gene scores | * DoF score | 2 X 2 X 2=8 | 2 X 1 X 2=4 |
# samples | 2 | 2 | |
** MAII score | log2(2/8*10)=1.32192809488736 | log2(2/4*10)=2.32192809488736 | |
Context | PubMed: SRFBP1 [Title/Abstract] AND PRM1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Functional or gene categories assigned by FusionGDB annotation |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Fusion gene information from three resources (ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018)) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Data type | Source | Cancer type | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
TCGA | LD | LUAD | TCGA-50-5944-01A | SRFBP1 | chr5 | 121330365 | + | PRM1 | chr16 | 11375087 | - |
* LD: Li Ding group's fusion gene list RV: Roel Verhaak group's fusion gene list ChiTaRs fusion database |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
intron-3CDS | ENST00000504881 | ENST00000312511 | SRFBP1 | chr5 | 121330365 | + | PRM1 | chr16 | 11375087 | - |
In-frame | ENST00000339397 | ENST00000312511 | SRFBP1 | chr5 | 121330365 | + | PRM1 | chr16 | 11375087 | - |
Top |
FusionProtFeatures for SRFBP1_PRM1 |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
SRFBP1 | PRM1 |
May be involved in regulating transcriptional activationof cardiac genes during the aging process. May play a role inbiosynthesis and/or processing of SLC2A4 in adipose cells (Bysimilarity). {ECO:0000250|UniProtKB:Q9CZ91}. | Protamines substitute for histones in the chromatin ofsperm during the haploid phase of spermatogenesis. They compactsperm DNA into a highly condensed, stable and inactive complex. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at . * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
FusionGeneSequence for SRFBP1_PRM1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. (nt: nucleotides, aa: amino acids) |
* Fusion amino acid sequences. |
>In-frame_SRFBP1_ENST00000339397_chr5_121330365_+_PRM1_ENST00000312511_chr16_11375087_-_90aa MAQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLKNQRRAQRLLEEIHAMKELKPDIVTKSALGDDINFEKIFKK |
* Fusion transcript sequences (only coding sequence (CDS) region). |
>In-frame_SRFBP1_ENST00000339397_chr5_121330365_+_PRM1_ENST00000312511_chr16_11375087_-_270nt ATGGCTCAGCCGGGAACTCTGAACCTCAATAACGAGGTTGTGAAGATGAGAAAAGAAGTGAAGAGAATTCGAGTTTTAGTTATCCGAAAA CTTGTCAGGAGTGTTGGCCGACTGAAGTCAAAAAAGGGTACTGAAGATGCACTGTTAAAAAACCAAAGACGGGCGCAAAGATTGCTTGAA GAAATCCATGCCATGAAGGAATTGAAACCTGACATAGTAACTAAATCTGCTCTTGGTGATGATATCAACTTTGAAAAAATCTTCAAAAAG |
* Fusion transcript sequences (Full-length transcript). |
>In-frame_SRFBP1_ENST00000339397_chr5_121330365_+_PRM1_ENST00000312511_chr16_11375087_-_669nt GTGGCGACGCAGCCGCGGTCTGAGAGACCGGTTCACGTGCAGGCAGCGGCGGATCATATTCCTTCATCTACCATGGCTCAGCCGGGAACT CTGAACCTCAATAACGAGGTTGTGAAGATGAGAAAAGAAGTGAAGAGAATTCGAGTTTTAGTTATCCGAAAACTTGTCAGGAGTGTTGGC CGACTGAAGTCAAAAAAGGGTACTGAAGATGCACTGTTAAAAAACCAAAGACGGGCGCAAAGATTGCTTGAAGAAATCCATGCCATGAAG GAATTGAAACCTGACATAGTAACTAAATCTGCTCTTGGTGATGATATCAACTTTGAAAAAATCTTCAAAAAGGCAGAGCTGGCCCCTGAC TCACAGCCCACAGAGTTCCACCTGCTCACAGGTTGGCTGGCTCAGCCAAGGTGGTGCCCTGCTCTGAGCATTCAGGCCAAGCCCATCCTG CACCATGGCCAGGTACAGATGCTGTCGCAGCCAGAGCCGGAGCAGATATTACCGCCAGAGACAAAGAAGTCGCAGACGAAGGAGGCGGAG CTGCCAGACACGGAGGAGAGCCATGAGAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATG |
Top |
FusionGenePPI for SRFBP1_PRM1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in . |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
SRFBP1 | SRF, FBL, BYSL, DDX10, FBXW5, C10orf12, CDC14B, TRIM25 | PRM1 | SRPK1 |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
RelatedDrugs for SRFBP1_PRM1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.0 2018-04-02) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for SRFBP1_PRM1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |