FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35937

FusionGeneSummary for SREBF1_MED9

check button Fusion gene summary
Fusion gene informationFusion gene name: SREBF1_MED9
Fusion gene ID: 35937
HgeneTgene
Gene symbol

SREBF1

MED9

Gene ID

6720

55090

Gene namesterol regulatory element binding transcription factor 1mediator complex subunit 9
SynonymsSREBP1|bHLHd1MED25
Cytomap

17p11.2

17p11.2

Type of geneprotein-codingprotein-coding
Descriptionsterol regulatory element-binding protein 1class D basic helix-loop-helix protein 1mediator of RNA polymerase II transcription subunit 9mediator of RNA polymerase II transcription, subunit 9 homologmediator subunit 25
Modification date2018052220180523
UniProtAcc

P36956

Q9NWA0

Ensembl transtripts involved in fusion geneENST00000338854, ENST00000395757, 
ENST00000355815, ENST00000261646, 
ENST00000435530, ENST00000583732, 
ENST00000268711, ENST00000580462, 
ENST00000585041, 
Fusion gene scores* DoF score6 X 3 X 6=1083 X 1 X 2=6
# samples 62
** MAII scorelog2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/6*10)=1.73696559416621
Context

PubMed: SREBF1 [Title/Abstract] AND MED9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSREBF1

GO:0045944

positive regulation of transcription by RNA polymerase II

26437365


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-K4-A5RH-01ASREBF1chr17

17740041

-MED9chr17

17394593

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000338854ENST00000268711SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000338854ENST00000580462SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000338854ENST00000585041SREBF1chr17

17740041

-MED9chr17

17394593

+
intron-3CDSENST00000395757ENST00000268711SREBF1chr17

17740041

-MED9chr17

17394593

+
intron-intronENST00000395757ENST00000580462SREBF1chr17

17740041

-MED9chr17

17394593

+
intron-intronENST00000395757ENST00000585041SREBF1chr17

17740041

-MED9chr17

17394593

+
In-frameENST00000355815ENST00000268711SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000355815ENST00000580462SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000355815ENST00000585041SREBF1chr17

17740041

-MED9chr17

17394593

+
In-frameENST00000261646ENST00000268711SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000261646ENST00000580462SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000261646ENST00000585041SREBF1chr17

17740041

-MED9chr17

17394593

+
In-frameENST00000435530ENST00000268711SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000435530ENST00000580462SREBF1chr17

17740041

-MED9chr17

17394593

+
5CDS-intronENST00000435530ENST00000585041SREBF1chr17

17740041

-MED9chr17

17394593

+
intron-3CDSENST00000583732ENST00000268711SREBF1chr17

17740041

-MED9chr17

17394593

+
intron-intronENST00000583732ENST00000580462SREBF1chr17

17740041

-MED9chr17

17394593

+
intron-intronENST00000583732ENST00000585041SREBF1chr17

17740041

-MED9chr17

17394593

+

Top

FusionProtFeatures for SREBF1_MED9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SREBF1

P36956

MED9

Q9NWA0

Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMED9chr17:17740041chr17:17394593ENST00000268711+02112_13974147Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119427_462301148Compositional biasNote=Gly/Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-11961_178301148Compositional biasNote=Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119427_462301072Compositional biasNote=Gly/Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-11961_178301072Compositional biasNote=Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120427_462301178Compositional biasNote=Gly/Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-12061_178301178Compositional biasNote=Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18427_46230471Compositional biasNote=Gly/Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-1861_17830471Compositional biasNote=Pro/Ser-rich
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119323_373301148DomainbHLH
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119323_373301072DomainbHLH
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120323_373301178DomainbHLH
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18323_37330471DomainbHLH
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-1191_60301148RegionNote=Transcriptional activation (acidic)
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119373_394301148RegionNote=Leucine-zipper
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-1191_60301072RegionNote=Transcriptional activation (acidic)
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119373_394301072RegionNote=Leucine-zipper
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-1201_60301178RegionNote=Transcriptional activation (acidic)
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120373_394301178RegionNote=Leucine-zipper
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-181_6030471RegionNote=Transcriptional activation (acidic)
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18373_39430471RegionNote=Leucine-zipper
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-1191_487301148Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119509_547301148Topological domainLumenal
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119569_1147301148Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-1191_487301072Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119509_547301072Topological domainLumenal
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119569_1147301072Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-1201_487301178Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120509_547301178Topological domainLumenal
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120569_1147301178Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-181_48730471Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18509_54730471Topological domainLumenal
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18569_114730471Topological domainCytoplasmic
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119488_508301148TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119548_568301148TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119488_508301072TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119548_568301072TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120488_508301178TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120548_568301178TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18488_50830471TransmembraneHelical
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18548_56830471TransmembraneHelical
TgeneMED9chr17:17740041chr17:17394593ENST00000268711+0217_5474147Compositional biasNote=Pro-rich


Top

FusionGeneSequence for SREBF1_MED9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SREBF1_ENST00000338854_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_102aa
MDEPPFSEAALEQALGEPCDLDAALLTDIEAWTRTARRSTRT_TPSKASSRRCASSSAPCPAST_APNSSSSSCRASGSKSGPRMSFCKS

>In-frame_SREBF1_ENST00000355815_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_102aa
MDEPPFSEAALEQALGEPCDLDAALLTDIEAWTRTARRSTRT_TPSKASSRRCASSSAPCPAST_APNSSSSSCRASGSKSGPRMSFCKS

>In-frame_SREBF1_ENST00000261646_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_102aa
MDEPPFSEAALEQALGEPCDLDAALLTDIEAWTRTARRSTRT_TPSKASSRRCASSSAPCPAST_APNSSSSSCRASGSKSGPRMSFCKS

>In-frame_SREBF1_ENST00000435530_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_102aa
MDEPPFSEAALEQALGEPCDLDAALLTDIEAWTRTARRSTRT_TPSKASSRRCASSSAPCPAST_APNSSSSSCRASGSKSGPRMSFCKS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SREBF1_ENST00000338854_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_308nt
ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAA
GCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCACCATGC
CCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGT

>In-frame_SREBF1_ENST00000355815_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_308nt
ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAA
GCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCACCATGC
CCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGT

>In-frame_SREBF1_ENST00000261646_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_308nt
ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAA
GCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCACCATGC
CCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGT

>In-frame_SREBF1_ENST00000435530_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_308nt
ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAA
GCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCACCATGC
CCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SREBF1_ENST00000338854_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_2233nt
AGCAGAGCTGCGGCCGGGGGAACCCAGTTTCCGAGGAACTTTTCGCCGGCGCCGGGCCGCCTCTGAGGCCAGGGCAGGACACGAACGCGC
GGAGCGGCGGCGGCGACTGAGAGCCGGGGCCGCGGCGGCGCTCCCTAGGAAGGGCCGTACGAGGCGGCGGGCCCGGCGGGCCTCCCGGAG
GAGGCGGCTGCGCCATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGC
TGACCGACATCGAAGCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCT
CATCAGCACCATGCCCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGA
GCTTCTGCAAAAGTACAAGAGCCTCTGCATGTTCGAAATCCCCAAGGAGTAGAGTGAGGCTGACTTCCTTAGAAAGAGGGGGAAGCCAAT
GGCCTGTCTCCCCACTACCATCCCCAAACGCTCCTTGGGGCGTGGTTCCTGTGGACCCCAGCTCAGCTCGTCAAGCTGCAGGGGCGGGGC
TCCTGTGCTGCTGCGCGCGCTTCGCCTGTGCGGGAGCCAGCGCAGAGCTTGGCTGCGCCGGGGGTTCCTCGTGTAGATCCATATGTCTAG
ATGCATAATAACTGGAGTGCCTGCTGGTGGAAGTCAGAATGCTCCTGGAGGCTGCAGAGGGGGTGGAGGACTCTCCCCTGCCTCTGGGGA
GGGGGCCATCTGCTGCGCCCGGCCCCACTGACAGATCTGAAGAGCACAGTAGGAAGGGAGGCGGCTCCTCTTTGCTTCCTTCCCTCTCTC
TCCTCCCACCCCCATAGGATCAGTGTGTACCAGGTACACATTGTTCCTGTTAACAGCAGCTTCTTGAAACATTTGCATAGAATTCACTGG
ACGAATTAAGCCTGCACTCATATGGCATAGAATTGTGAGAGAATGTTTTGAAAGGCCAGAGGGTGGCCTTTTTCCCCAAACAGTTTGGTT
CCTTTTATGTTTGAGCCAGTGAAGGGAACTACGCTTTGGGGGCTTCAGCCTAGAGCCCTGCCAGGCAGCCCCTGGCTCCAGGTTCCCTGC
CTCCTAGCGCTCTCCTCGCCTTCAGCTCTTGCTCCCTTCCTCGTTCATCACCCTCAGTCAGTGCCCAAGAGTGGCCAAACCGCTTCACAT
CTGCAGTGCTTCCCCAGGGTTGACAAGGGGCCGTCCTTTCCACACAGGCCAGAAGAGGTCTTCAGGCGAACCGACCTTCCCCCTTCTGGC
ATTTCAGATTCCCCTTGCTCTGGTTAAAAGGTCTTTCCCTCGTGGCCTTTGCACTTGCGGCAGCAACGTGTACTACACTGCAGAAGGGTT
CAGTATGCACCTTGTGTTGAGAGAGAGGCAACCCTGGGGGCCAGTTCAGGTGGTCCCCAACCATAAGCTAGGTCTGAAAGTTACACAGCC
AAGTTTGAGCTCTTAAAAGTTGATGAACAGCCTCATTTCCCCAGCTTCCCTGATTTCTTCCAGATGGGACGTTTTATTTGTGTGCTCTCC
CTTGACTGTCAGATTGAAGTAAGAGCAGTTCTCTCCGTTGCCTCTCGAGGAGGAGGTGCGAAGTCCTGGAGTATTGTTTGGGTCTCGGAA
TGGGCGCATAACCTGCGCTGACCAGTTTAGGGGCTTAGCAGATGCCTGCCAGCTGACCTCGTTGGCAGGAGGGTTGGGTGGAGATGTTTT
TAGCAGAGCTTCCATTAGTGTAGACCTGTAGCCACCTGTCAGAAGGTGGGTGGCATATTGGGGACCTGGGAATGTGTGAAGGAGGAGATC
AAATTTCAGTGGCTTTGGACAGAAAAGAAGGCTCTGGATTTAAGCGGGTGGTCACCTGTGAGACCAGGTCTACCTTGGGACTGTTATTTA
ACTGAATCAGTTATTTCCTTGAAATTTCACAGTAGTGGGTGGGCCTGTTTTAAGGCTCTGACAGATACCACGAAACATGAAGCACGTGGA
ACTACAAGACCCCCGGGGTCTTTCTGAGTGCAAGGCTGAAATGGACAAGGGCTCCTCACGGGGGTGGAGGGAGCCGGAGCCTGCCTTGTG

>In-frame_SREBF1_ENST00000355815_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_2209nt
CAGTTTCCGAGGAACTTTTCGCCGGCGCCGGGCCGCCTCTGAGGCCAGGGCAGGACACGAACGCGCGGAGCGGCGGCGGCGACTGAGAGC
CGGGGCCGCGGCGGCGCTCCCTAGGAAGGGCCGTACGAGGCGGCGGGCCCGGCGGGCCTCCCGGAGGAGGCGGCTGCGCCATGGACGAGC
CACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAAGCATGGACAA
GGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCACCATGCCCGGCATCCA
CCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGTACAAGAGCCT
CTGCATGTTCGAAATCCCCAAGGAGTAGAGTGAGGCTGACTTCCTTAGAAAGAGGGGGAAGCCAATGGCCTGTCTCCCCACTACCATCCC
CAAACGCTCCTTGGGGCGTGGTTCCTGTGGACCCCAGCTCAGCTCGTCAAGCTGCAGGGGCGGGGCTCCTGTGCTGCTGCGCGCGCTTCG
CCTGTGCGGGAGCCAGCGCAGAGCTTGGCTGCGCCGGGGGTTCCTCGTGTAGATCCATATGTCTAGATGCATAATAACTGGAGTGCCTGC
TGGTGGAAGTCAGAATGCTCCTGGAGGCTGCAGAGGGGGTGGAGGACTCTCCCCTGCCTCTGGGGAGGGGGCCATCTGCTGCGCCCGGCC
CCACTGACAGATCTGAAGAGCACAGTAGGAAGGGAGGCGGCTCCTCTTTGCTTCCTTCCCTCTCTCTCCTCCCACCCCCATAGGATCAGT
GTGTACCAGGTACACATTGTTCCTGTTAACAGCAGCTTCTTGAAACATTTGCATAGAATTCACTGGACGAATTAAGCCTGCACTCATATG
GCATAGAATTGTGAGAGAATGTTTTGAAAGGCCAGAGGGTGGCCTTTTTCCCCAAACAGTTTGGTTCCTTTTATGTTTGAGCCAGTGAAG
GGAACTACGCTTTGGGGGCTTCAGCCTAGAGCCCTGCCAGGCAGCCCCTGGCTCCAGGTTCCCTGCCTCCTAGCGCTCTCCTCGCCTTCA
GCTCTTGCTCCCTTCCTCGTTCATCACCCTCAGTCAGTGCCCAAGAGTGGCCAAACCGCTTCACATCTGCAGTGCTTCCCCAGGGTTGAC
AAGGGGCCGTCCTTTCCACACAGGCCAGAAGAGGTCTTCAGGCGAACCGACCTTCCCCCTTCTGGCATTTCAGATTCCCCTTGCTCTGGT
TAAAAGGTCTTTCCCTCGTGGCCTTTGCACTTGCGGCAGCAACGTGTACTACACTGCAGAAGGGTTCAGTATGCACCTTGTGTTGAGAGA
GAGGCAACCCTGGGGGCCAGTTCAGGTGGTCCCCAACCATAAGCTAGGTCTGAAAGTTACACAGCCAAGTTTGAGCTCTTAAAAGTTGAT
GAACAGCCTCATTTCCCCAGCTTCCCTGATTTCTTCCAGATGGGACGTTTTATTTGTGTGCTCTCCCTTGACTGTCAGATTGAAGTAAGA
GCAGTTCTCTCCGTTGCCTCTCGAGGAGGAGGTGCGAAGTCCTGGAGTATTGTTTGGGTCTCGGAATGGGCGCATAACCTGCGCTGACCA
GTTTAGGGGCTTAGCAGATGCCTGCCAGCTGACCTCGTTGGCAGGAGGGTTGGGTGGAGATGTTTTTAGCAGAGCTTCCATTAGTGTAGA
CCTGTAGCCACCTGTCAGAAGGTGGGTGGCATATTGGGGACCTGGGAATGTGTGAAGGAGGAGATCAAATTTCAGTGGCTTTGGACAGAA
AAGAAGGCTCTGGATTTAAGCGGGTGGTCACCTGTGAGACCAGGTCTACCTTGGGACTGTTATTTAACTGAATCAGTTATTTCCTTGAAA
TTTCACAGTAGTGGGTGGGCCTGTTTTAAGGCTCTGACAGATACCACGAAACATGAAGCACGTGGAACTACAAGACCCCCGGGGTCTTTC
TGAGTGCAAGGCTGAAATGGACAAGGGCTCCTCACGGGGGTGGAGGGAGCCGGAGCCTGCCTTGTGTTCCTTTTTTGACTTGTGACATTT

>In-frame_SREBF1_ENST00000261646_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_2224nt
GCGGCCGGGGGAACCCAGTTTCCGAGGAACTTTTCGCCGGCGCCGGGCCGCCTCTGAGGCCAGGGCAGGACACGAACGCGCGGAGCGGCG
GCGGCGACTGAGAGCCGGGGCCGCGGCGGCGCTCCCTAGGAAGGGCCGTACGAGGCGGCGGGCCCGGCGGGCCTCCCGGAGGAGGCGGCT
GCGCCATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACA
TCGAAGCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCAC
CATGCCCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCA
AAAGTACAAGAGCCTCTGCATGTTCGAAATCCCCAAGGAGTAGAGTGAGGCTGACTTCCTTAGAAAGAGGGGGAAGCCAATGGCCTGTCT
CCCCACTACCATCCCCAAACGCTCCTTGGGGCGTGGTTCCTGTGGACCCCAGCTCAGCTCGTCAAGCTGCAGGGGCGGGGCTCCTGTGCT
GCTGCGCGCGCTTCGCCTGTGCGGGAGCCAGCGCAGAGCTTGGCTGCGCCGGGGGTTCCTCGTGTAGATCCATATGTCTAGATGCATAAT
AACTGGAGTGCCTGCTGGTGGAAGTCAGAATGCTCCTGGAGGCTGCAGAGGGGGTGGAGGACTCTCCCCTGCCTCTGGGGAGGGGGCCAT
CTGCTGCGCCCGGCCCCACTGACAGATCTGAAGAGCACAGTAGGAAGGGAGGCGGCTCCTCTTTGCTTCCTTCCCTCTCTCTCCTCCCAC
CCCCATAGGATCAGTGTGTACCAGGTACACATTGTTCCTGTTAACAGCAGCTTCTTGAAACATTTGCATAGAATTCACTGGACGAATTAA
GCCTGCACTCATATGGCATAGAATTGTGAGAGAATGTTTTGAAAGGCCAGAGGGTGGCCTTTTTCCCCAAACAGTTTGGTTCCTTTTATG
TTTGAGCCAGTGAAGGGAACTACGCTTTGGGGGCTTCAGCCTAGAGCCCTGCCAGGCAGCCCCTGGCTCCAGGTTCCCTGCCTCCTAGCG
CTCTCCTCGCCTTCAGCTCTTGCTCCCTTCCTCGTTCATCACCCTCAGTCAGTGCCCAAGAGTGGCCAAACCGCTTCACATCTGCAGTGC
TTCCCCAGGGTTGACAAGGGGCCGTCCTTTCCACACAGGCCAGAAGAGGTCTTCAGGCGAACCGACCTTCCCCCTTCTGGCATTTCAGAT
TCCCCTTGCTCTGGTTAAAAGGTCTTTCCCTCGTGGCCTTTGCACTTGCGGCAGCAACGTGTACTACACTGCAGAAGGGTTCAGTATGCA
CCTTGTGTTGAGAGAGAGGCAACCCTGGGGGCCAGTTCAGGTGGTCCCCAACCATAAGCTAGGTCTGAAAGTTACACAGCCAAGTTTGAG
CTCTTAAAAGTTGATGAACAGCCTCATTTCCCCAGCTTCCCTGATTTCTTCCAGATGGGACGTTTTATTTGTGTGCTCTCCCTTGACTGT
CAGATTGAAGTAAGAGCAGTTCTCTCCGTTGCCTCTCGAGGAGGAGGTGCGAAGTCCTGGAGTATTGTTTGGGTCTCGGAATGGGCGCAT
AACCTGCGCTGACCAGTTTAGGGGCTTAGCAGATGCCTGCCAGCTGACCTCGTTGGCAGGAGGGTTGGGTGGAGATGTTTTTAGCAGAGC
TTCCATTAGTGTAGACCTGTAGCCACCTGTCAGAAGGTGGGTGGCATATTGGGGACCTGGGAATGTGTGAAGGAGGAGATCAAATTTCAG
TGGCTTTGGACAGAAAAGAAGGCTCTGGATTTAAGCGGGTGGTCACCTGTGAGACCAGGTCTACCTTGGGACTGTTATTTAACTGAATCA
GTTATTTCCTTGAAATTTCACAGTAGTGGGTGGGCCTGTTTTAAGGCTCTGACAGATACCACGAAACATGAAGCACGTGGAACTACAAGA
CCCCCGGGGTCTTTCTGAGTGCAAGGCTGAAATGGACAAGGGCTCCTCACGGGGGTGGAGGGAGCCGGAGCCTGCCTTGTGTTCCTTTTT

>In-frame_SREBF1_ENST00000435530_chr17_17740041_-_MED9_ENST00000268711_chr17_17394593_+_2039nt
ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAA
GCATGGACAAGGACAGCCCGGAGGTCCACCAGGACCTGAACGCCCTCAAAAGCAAGTTCCAGGAGATGCGCAAGCTCATCAGCACCATGC
CCGGCATCCACCTGAGCCCCGAACAGCAGCAGCAGCAGCTGCAGAGCCTCCGGGAGCAAGTCAGGACCAAGAATGAGCTTCTGCAAAAGT
ACAAGAGCCTCTGCATGTTCGAAATCCCCAAGGAGTAGAGTGAGGCTGACTTCCTTAGAAAGAGGGGGAAGCCAATGGCCTGTCTCCCCA
CTACCATCCCCAAACGCTCCTTGGGGCGTGGTTCCTGTGGACCCCAGCTCAGCTCGTCAAGCTGCAGGGGCGGGGCTCCTGTGCTGCTGC
GCGCGCTTCGCCTGTGCGGGAGCCAGCGCAGAGCTTGGCTGCGCCGGGGGTTCCTCGTGTAGATCCATATGTCTAGATGCATAATAACTG
GAGTGCCTGCTGGTGGAAGTCAGAATGCTCCTGGAGGCTGCAGAGGGGGTGGAGGACTCTCCCCTGCCTCTGGGGAGGGGGCCATCTGCT
GCGCCCGGCCCCACTGACAGATCTGAAGAGCACAGTAGGAAGGGAGGCGGCTCCTCTTTGCTTCCTTCCCTCTCTCTCCTCCCACCCCCA
TAGGATCAGTGTGTACCAGGTACACATTGTTCCTGTTAACAGCAGCTTCTTGAAACATTTGCATAGAATTCACTGGACGAATTAAGCCTG
CACTCATATGGCATAGAATTGTGAGAGAATGTTTTGAAAGGCCAGAGGGTGGCCTTTTTCCCCAAACAGTTTGGTTCCTTTTATGTTTGA
GCCAGTGAAGGGAACTACGCTTTGGGGGCTTCAGCCTAGAGCCCTGCCAGGCAGCCCCTGGCTCCAGGTTCCCTGCCTCCTAGCGCTCTC
CTCGCCTTCAGCTCTTGCTCCCTTCCTCGTTCATCACCCTCAGTCAGTGCCCAAGAGTGGCCAAACCGCTTCACATCTGCAGTGCTTCCC
CAGGGTTGACAAGGGGCCGTCCTTTCCACACAGGCCAGAAGAGGTCTTCAGGCGAACCGACCTTCCCCCTTCTGGCATTTCAGATTCCCC
TTGCTCTGGTTAAAAGGTCTTTCCCTCGTGGCCTTTGCACTTGCGGCAGCAACGTGTACTACACTGCAGAAGGGTTCAGTATGCACCTTG
TGTTGAGAGAGAGGCAACCCTGGGGGCCAGTTCAGGTGGTCCCCAACCATAAGCTAGGTCTGAAAGTTACACAGCCAAGTTTGAGCTCTT
AAAAGTTGATGAACAGCCTCATTTCCCCAGCTTCCCTGATTTCTTCCAGATGGGACGTTTTATTTGTGTGCTCTCCCTTGACTGTCAGAT
TGAAGTAAGAGCAGTTCTCTCCGTTGCCTCTCGAGGAGGAGGTGCGAAGTCCTGGAGTATTGTTTGGGTCTCGGAATGGGCGCATAACCT
GCGCTGACCAGTTTAGGGGCTTAGCAGATGCCTGCCAGCTGACCTCGTTGGCAGGAGGGTTGGGTGGAGATGTTTTTAGCAGAGCTTCCA
TTAGTGTAGACCTGTAGCCACCTGTCAGAAGGTGGGTGGCATATTGGGGACCTGGGAATGTGTGAAGGAGGAGATCAAATTTCAGTGGCT
TTGGACAGAAAAGAAGGCTCTGGATTTAAGCGGGTGGTCACCTGTGAGACCAGGTCTACCTTGGGACTGTTATTTAACTGAATCAGTTAT
TTCCTTGAAATTTCACAGTAGTGGGTGGGCCTGTTTTAAGGCTCTGACAGATACCACGAAACATGAAGCACGTGGAACTACAAGACCCCC
GGGGTCTTTCTGAGTGCAAGGCTGAAATGGACAAGGGCTCCTCACGGGGGTGGAGGGAGCCGGAGCCTGCCTTGTGTTCCTTTTTTGACT


Top

FusionGenePPI for SREBF1_MED9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SREBF1LMNA, TWIST2, UBE2I, CREBBP, YY1, SP1, NR0B1, MAPK3, MAPK1, FBXW7, KLF13, EP300, AR, MED15, MED23, MED7, MED13, MED12, MED1, MED14, MED24, MED26, MED6, HNF4A, TRRAP, KAT2A, ATM, GCN1L1, TADA2B, TADA3, RUVBL2, SIRT1, MED25, MED17, MED21, CDK8, USF1, GSK3B, ZBTB7C, SREBF2, SREBF1, ZBTB7A, SCAP, INSIG1, INSIG2, EGF, ATXN1, ATXN1L, HSP90AA1, SMARCD3, ERLIN2, KLF5, ID2, ID3, PRMT5, PVALB, SORL1, MTNR1B, PLK1, TRIM25, POLR2AMED9MED10, MED13L, MED13, MED12, MED14, MED23, MED15, MED24, MED16, MED25, MED17, MED26, CDK8, CDK19, MED27, MED4, MED19, MED6, MED7, MED8, MED18, MED20, MED29, MED30, MED28, MED21, MED22, MED11, MED31, MED1, POLR2A, POLR2B, POLR2C, POLR2D, POLR2E, POLR2F, POLR2G, POLR2J, ZC3H13, OBFC1, APP, FBXW7, ESR1, CCNC, NRGN, TCL1B, SPAG9, CARM1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSREBF1chr17:17740041chr17:17394593ENST00000261646-119234_497301148LMNA
HgeneSREBF1chr17:17740041chr17:17394593ENST00000338854-119234_497301072LMNA
HgeneSREBF1chr17:17740041chr17:17394593ENST00000355815-120234_497301178LMNA
HgeneSREBF1chr17:17740041chr17:17394593ENST00000435530-18234_49730471LMNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SREBF1_MED9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SREBF1_MED9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSREBF1C0011853Diabetes Mellitus, Experimental2CTD_human
HgeneSREBF1C0400966Non-alcoholic Fatty Liver Disease2CTD_human
HgeneSREBF1C2239176Liver carcinoma2CTD_human
HgeneSREBF1C0015695Fatty Liver1CTD_human
HgeneSREBF1C0021655Insulin Resistance1CTD_human
HgeneSREBF1C0022661Kidney Failure, Chronic1CTD_human
HgeneSREBF1C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneSREBF1C0028754Obesity1CTD_human
HgeneSREBF1C0036341Schizophrenia1PSYGENET