FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35917

FusionGeneSummary for SRCIN1_FNDC8

check button Fusion gene summary
Fusion gene informationFusion gene name: SRCIN1_FNDC8
Fusion gene ID: 35917
HgeneTgene
Gene symbol

SRCIN1

FNDC8

Gene ID

80725

54752

Gene nameSRC kinase signaling inhibitor 1fibronectin type III domain containing 8
SynonymsP140|SNIP-
Cytomap

17q12

17q12

Type of geneprotein-codingprotein-coding
DescriptionSRC kinase signaling inhibitor 1P130Cas-associated proteinSNAP-25-interacting proteinSNAP25-interacting proteinp140Capfibronectin type III domain-containing protein 8
Modification date2018051920180522
UniProtAcc

Q9C0H9

Q8TC99

Ensembl transtripts involved in fusion geneENST00000264659, ENST00000578925, 
ENST00000398579, 
ENST00000158009, 
Fusion gene scores* DoF score8 X 7 X 5=2802 X 1 X 2=4
# samples 62
** MAII scorelog2(6/280*10)=-2.22239242133645
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: SRCIN1 [Title/Abstract] AND FNDC8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSRCIN1

GO:0061098

positive regulation of protein tyrosine kinase activity

17525734

HgeneSRCIN1

GO:0061099

negative regulation of protein tyrosine kinase activity

17525734


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E9-A1RF-01ASRCIN1chr17

36717699

-FNDC8chr17

33454061

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264659ENST00000158009SRCIN1chr17

36717699

-FNDC8chr17

33454061

+
In-frameENST00000578925ENST00000158009SRCIN1chr17

36717699

-FNDC8chr17

33454061

+
5UTR-3CDSENST00000398579ENST00000158009SRCIN1chr17

36717699

-FNDC8chr17

33454061

+

Top

FusionProtFeatures for SRCIN1_FNDC8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SRCIN1

Q9C0H9

FNDC8

Q8TC99

Acts as a negative regulator of SRC by activating CSKwhich inhibits SRC activity and downstream signaling, leading toimpaired cell spreading and migration. Regulates dendritic spinemorphology. Involved in calcium-dependent exocytosis. May play arole in neurotransmitter release or synapse maintenance.{ECO:0000269|PubMed:14657239, ECO:0000269|PubMed:17525734,ECO:0000269|PubMed:19146815}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSRCIN1chr17:36717699chr17:33454061ENST00000264659-719471_5045661184Compositional biasNote=Pro-rich
TgeneFNDC8chr17:36717699chr17:33454061ENST00000158009+04179_28069325DomainFibronectin type-III

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSRCIN1chr17:36717699chr17:33454061ENST00000264659-719654_6745661184Coiled coilOntology_term=ECO:0000255
HgeneSRCIN1chr17:36717699chr17:33454061ENST00000264659-719726_7465661184Coiled coilOntology_term=ECO:0000255
HgeneSRCIN1chr17:36717699chr17:33454061ENST00000264659-719956_10145661184Compositional biasNote=Pro-rich


Top

FusionGeneSequence for SRCIN1_FNDC8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SRCIN1_ENST00000264659_chr17_36717699_-_FNDC8_ENST00000158009_chr17_33454061_+_822aa
MGNAPSQDPERSSPPMLSADDAEYPREYRTLGGGGGGGSGGRRFSNVGLVHTSERRHTVIAAQSLEALSGLQKADADRKRDAFMDHLKSK
YPQHALALRGQQDRMREQPNYWSFKTRSSRHTQGAQPGLADQAAKLSYASAESLETMSEAELPLGFSRMNRFRQSLPLSRSASQTKLRSP
GVLFLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVFYELEDVRDIQDRSIIKIYRKEPLYAAFPGS
HLTNGDLRREMVYASRESSPTRRLNNLSPAPHLASGSPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPPSYAGSPVHHAAERLGGAPAAQG
VSPSPSAILERRDVKPDEDLASKAGGMVLVKGEGLYADPYGLLHEGRLSLAAAAGDPFAYPGAGGLYKRGSVRSLSTYSAAALQSDLEDS
LYKAAGGGGPLYGDGYGFRLPPSSPQKLADVAAPPGGPPPPHSPYSGPPSRGSPVRQSFRKDSGSSSVFAESPGGKTRSAGSASTAGAPP
SELFPGPGERSLVGFGPPVPAKDTETRKPLPVEDSDCSSDETSISAFSSTLLNPIKLAVTQPNSSFFAGMLEGELNKLSFSPMAKNAENE
DLALGPCPCPSKSQMATRGLLDLDNPELETETSSTHSESSVVVDLPDTPFIFEHTVNNSTAVISWTYALGKQPVSFYQLLLQEVAKTQEN
ELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMR

>In-frame_SRCIN1_ENST00000578925_chr17_36717699_-_FNDC8_ENST00000158009_chr17_33454061_+_856aa
MGNAPSQDPERSSPPMLSADDAEYPREYRTLGGGGGGGSGGRRFSNVGLVHTSERRHTVIAAQSLEALSGLQKADADRKRDAFMDHLKSK
YPQHALALRGQQDRMREQVGGWTVDPVCLLSSLCSHLHGDSAPSGAGQPAQQPNYWSFKTRSSRHTQGAQPGLADQAAKLSYASAESLET
MSEAELPLGFSRMNRFRQSLPLSRSASQTKLRSPGVLFLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEA
RNVFYELEDVRDIQDRSIIKIYRKEPLYAAFPGSHLTNGDLRREMVYASRESSPTRRLNNLSPAPHLASGSPPPGLPSGLPSGLQSGSPS
RSRLSYAGGRPPSYAGSPVHHAAERLGGAPAAQGVSPSPSAILERRDVKPDEDLASKAGGMVLVKGEGLYADPYGLLHEGRLSLAAAAGD
PFAYPGAGGLYKRGSVRSLSTYSAAALQSDLEDSLYKAAGGGGPLYGDGYGFRLPPSSPQKLADVAAPPGGPPPPHSPYSGPPSRGSPVR
QSFRKDSGSSSVFAESPGGKTRSAGSASTAGAPPSELFPGPGERSLVGFGPPVPAKDTETRKPLPVEDSDCSSDETSISAFSSTLLNPIK
LAVTQPNSSFFAGMLEGELNKLSFSPMAKNAENEDLALGPCPCPSKSQMATRGLLDLDNPELETETSSTHSESSVVVDLPDTPFIFEHTV
NNSTAVISWTYALGKQPVSFYQLLLQEVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SRCIN1_ENST00000264659_chr17_36717699_-_FNDC8_ENST00000158009_chr17_33454061_+_2466nt
ATGGGGAACGCTCCGTCCCAAGATCCGGAGCGGAGCAGCCCCCCCATGCTGTCTGCGGACGATGCGGAGTACCCGCGGGAGTACCGGACC
CTGGGGGGCGGGGGCGGCGGGGGCAGCGGGGGCCGGCGCTTCTCCAACGTGGGGCTGGTGCACACGTCCGAGCGGCGGCACACGGTGATC
GCGGCCCAGAGTCTGGAGGCGCTCAGCGGGCTCCAGAAGGCGGACGCCGACCGCAAGCGTGATGCCTTCATGGACCACCTGAAGAGCAAG
TACCCACAGCACGCCCTGGCCCTGCGAGGCCAGCAGGACAGGATGCGAGAGCAGCCAAACTACTGGAGTTTCAAGACCCGCAGCTCACGC
CACACTCAGGGAGCCCAGCCCGGGCTGGCAGACCAGGCGGCAAAGCTGTCCTACGCCTCCGCCGAGTCGCTGGAGACCATGTCGGAGGCC
GAGCTGCCCCTGGGCTTCAGCAGGATGAACCGCTTCCGACAGAGCCTGCCTCTCTCCCGCTCGGCCAGCCAGACCAAGCTGCGCTCCCCA
GGGGTGCTGTTCCTGCAGTTCGGGGAGGAGACTCGGCGCGTGCACATCACGCACGAGGTCAGCAGCCTGGACACGCTGCACGCACTCATC
GCGCACATGTTCCCGCAGAAGCTCACCATGGGCATGCTTAAGTCGCCCAATACCGCCATCCTCATCAAAGACGAGGCTCGCAACGTCTTC
TACGAGCTGGAGGACGTCCGGGACATCCAGGACCGCAGTATTATCAAGATCTACAGAAAGGAGCCCCTCTACGCTGCCTTCCCTGGCTCA
CATCTCACCAACGGGGACCTCCGGAGAGAGATGGTGTACGCATCGCGGGAGTCCTCGCCCACGCGGCGCCTCAACAACCTGTCACCAGCG
CCGCACCTGGCATCCGGCTCGCCGCCGCCCGGGCTGCCGTCGGGGCTGCCGTCCGGGCTGCAGTCCGGTTCGCCGTCGCGTTCGCGCCTA
TCGTACGCCGGGGGGCGCCCGCCTTCGTACGCCGGCAGCCCGGTGCACCACGCGGCCGAGAGGCTGGGAGGCGCCCCGGCCGCCCAGGGC
GTCAGCCCCAGCCCCAGCGCCATCCTGGAGCGGCGCGACGTGAAGCCGGACGAGGACCTGGCGAGCAAGGCGGGCGGCATGGTGCTGGTG
AAAGGCGAGGGCCTCTATGCTGACCCCTACGGGCTGCTGCACGAGGGCCGTCTGAGCCTGGCCGCGGCCGCCGGCGACCCGTTCGCCTAC
CCGGGCGCCGGCGGCCTCTACAAGCGCGGCTCGGTGCGCTCGCTCAGCACCTACTCGGCCGCCGCGCTGCAGTCCGATCTGGAGGACTCC
CTGTACAAGGCGGCGGGCGGCGGCGGCCCGCTGTACGGCGACGGCTACGGCTTCCGCCTGCCGCCTTCGTCACCGCAGAAGCTGGCCGAC
GTGGCAGCACCCCCCGGAGGTCCCCCGCCACCGCACAGCCCCTACTCGGGGCCGCCCAGCCGCGGCTCGCCAGTGCGCCAGTCCTTCCGC
AAGGACTCGGGCTCCTCGTCCGTCTTTGCCGAGAGTCCTGGAGGGAAGACCCGCAGCGCGGGGAGCGCCTCGACGGCCGGAGCTCCCCCT
TCGGAGCTCTTCCCTGGGCCTGGGGAACGCTCGCTGGTTGGGTTCGGGCCGCCAGTGCCAGCCAAGGACACGGAGACCAGGAAGCCGCTG
CCAGTAGAGGATTCAGACTGCAGCTCTGATGAGACCAGCATCTCTGCCTTCTCATCCACCTTGCTGAACCCCATCAAATTAGCTGTGACC
CAGCCCAACAGCAGCTTCTTTGCAGGGATGCTGGAGGGGGAGCTGAACAAACTCAGCTTCTCCCCAATGGCCAAGAATGCAGAAAATGAG
GACCTGGCGCTCGGCCCCTGCCCATGCCCATCGAAGTCCCAGATGGCCACAAGGGGCCTGCTGGACCTTGACAACCCTGAGCTGGAGACA
GAAACCTCCTCAACGCACTCAGAATCTTCTGTGGTTGTGGACCTGCCGGACACCCCCTTCATCTTTGAGCACACCGTCAACAATTCCACA
GCTGTGATTTCCTGGACCTACGCCTTGGGCAAGCAGCCGGTCAGTTTCTACCAGCTCCTGTTACAGGAGGTGGCCAAGACACAGGAGAAT
GAGTTGCCCGAGGCAAAGAATCGTCCATGGATCTTCAACAAGATTTTGGGCACTACTGTCAAGCTGATGGAGCTAAAGCCTAACACGTGT
TACTGCCTCAGTGTCCGTGCAGCCAACACAGCTGGGGTGGGGAAGTGGTGCAAGCCCTACAAATTTGCAACCCTGGCCACTGACTTCAGC
AGCTTTCCTGAGAACTACCCCATCCAGATCACCGTGCGGCGCAAGGAACCCCGGCAAAAGATCGTGTCCATCGGGCCGGAGGAGATGCGG

>In-frame_SRCIN1_ENST00000578925_chr17_36717699_-_FNDC8_ENST00000158009_chr17_33454061_+_2568nt
ATGGGGAACGCTCCGTCCCAAGATCCGGAGCGGAGCAGCCCCCCCATGCTGTCTGCGGACGATGCGGAGTACCCGCGGGAGTACCGGACC
CTGGGGGGCGGGGGCGGCGGGGGCAGCGGGGGCCGGCGCTTCTCCAACGTGGGGCTGGTGCACACGTCCGAGCGGCGGCACACGGTGATC
GCGGCCCAGAGTCTGGAGGCGCTCAGCGGGCTCCAGAAGGCGGACGCCGACCGCAAGCGTGATGCCTTCATGGACCACCTGAAGAGCAAG
TACCCACAGCACGCCCTGGCCCTGCGAGGCCAGCAGGACAGGATGCGAGAGCAGGTTGGCGGCTGGACCGTGGACCCCGTATGCCTCCTC
AGCTCCCTCTGCTCCCACCTCCATGGCGACTCCGCCCCCTCCGGGGCTGGCCAGCCGGCCCAGCAGCCAAACTACTGGAGTTTCAAGACC
CGCAGCTCACGCCACACTCAGGGAGCCCAGCCCGGGCTGGCAGACCAGGCGGCAAAGCTGTCCTACGCCTCCGCCGAGTCGCTGGAGACC
ATGTCGGAGGCCGAGCTGCCCCTGGGCTTCAGCAGGATGAACCGCTTCCGACAGAGCCTGCCTCTCTCCCGCTCGGCCAGCCAGACCAAG
CTGCGCTCCCCAGGGGTGCTGTTCCTGCAGTTCGGGGAGGAGACTCGGCGCGTGCACATCACGCACGAGGTCAGCAGCCTGGACACGCTG
CACGCACTCATCGCGCACATGTTCCCGCAGAAGCTCACCATGGGCATGCTTAAGTCGCCCAATACCGCCATCCTCATCAAAGACGAGGCT
CGCAACGTCTTCTACGAGCTGGAGGACGTCCGGGACATCCAGGACCGCAGTATTATCAAGATCTACAGAAAGGAGCCCCTCTACGCTGCC
TTCCCTGGCTCACATCTCACCAACGGGGACCTCCGGAGAGAGATGGTGTACGCATCGCGGGAGTCCTCGCCCACGCGGCGCCTCAACAAC
CTGTCACCAGCGCCGCACCTGGCATCCGGCTCGCCGCCGCCCGGGCTGCCGTCGGGGCTGCCGTCCGGGCTGCAGTCCGGTTCGCCGTCG
CGTTCGCGCCTATCGTACGCCGGGGGGCGCCCGCCTTCGTACGCCGGCAGCCCGGTGCACCACGCGGCCGAGAGGCTGGGAGGCGCCCCG
GCCGCCCAGGGCGTCAGCCCCAGCCCCAGCGCCATCCTGGAGCGGCGCGACGTGAAGCCGGACGAGGACCTGGCGAGCAAGGCGGGCGGC
ATGGTGCTGGTGAAAGGCGAGGGCCTCTATGCTGACCCCTACGGGCTGCTGCACGAGGGCCGTCTGAGCCTGGCCGCGGCCGCCGGCGAC
CCGTTCGCCTACCCGGGCGCCGGCGGCCTCTACAAGCGCGGCTCGGTGCGCTCGCTCAGCACCTACTCGGCCGCCGCGCTGCAGTCCGAT
CTGGAGGACTCCCTGTACAAGGCGGCGGGCGGCGGCGGCCCGCTGTACGGCGACGGCTACGGCTTCCGCCTGCCGCCTTCGTCACCGCAG
AAGCTGGCCGACGTGGCAGCACCCCCCGGAGGTCCCCCGCCACCGCACAGCCCCTACTCGGGGCCGCCCAGCCGCGGCTCGCCAGTGCGC
CAGTCCTTCCGCAAGGACTCGGGCTCCTCGTCCGTCTTTGCCGAGAGTCCTGGAGGGAAGACCCGCAGCGCGGGGAGCGCCTCGACGGCC
GGAGCTCCCCCTTCGGAGCTCTTCCCTGGGCCTGGGGAACGCTCGCTGGTTGGGTTCGGGCCGCCAGTGCCAGCCAAGGACACGGAGACC
AGGAAGCCGCTGCCAGTAGAGGATTCAGACTGCAGCTCTGATGAGACCAGCATCTCTGCCTTCTCATCCACCTTGCTGAACCCCATCAAA
TTAGCTGTGACCCAGCCCAACAGCAGCTTCTTTGCAGGGATGCTGGAGGGGGAGCTGAACAAACTCAGCTTCTCCCCAATGGCCAAGAAT
GCAGAAAATGAGGACCTGGCGCTCGGCCCCTGCCCATGCCCATCGAAGTCCCAGATGGCCACAAGGGGCCTGCTGGACCTTGACAACCCT
GAGCTGGAGACAGAAACCTCCTCAACGCACTCAGAATCTTCTGTGGTTGTGGACCTGCCGGACACCCCCTTCATCTTTGAGCACACCGTC
AACAATTCCACAGCTGTGATTTCCTGGACCTACGCCTTGGGCAAGCAGCCGGTCAGTTTCTACCAGCTCCTGTTACAGGAGGTGGCCAAG
ACACAGGAGAATGAGTTGCCCGAGGCAAAGAATCGTCCATGGATCTTCAACAAGATTTTGGGCACTACTGTCAAGCTGATGGAGCTAAAG
CCTAACACGTGTTACTGCCTCAGTGTCCGTGCAGCCAACACAGCTGGGGTGGGGAAGTGGTGCAAGCCCTACAAATTTGCAACCCTGGCC
ACTGACTTCAGCAGCTTTCCTGAGAACTACCCCATCCAGATCACCGTGCGGCGCAAGGAACCCCGGCAAAAGATCGTGTCCATCGGGCCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SRCIN1_ENST00000264659_chr17_36717699_-_FNDC8_ENST00000158009_chr17_33454061_+_2989nt
ACACTCGCTCTCGCACACTCGGTGACACGCCCGCGCGCGCGCTCACCCACACGCCCGGCCGCCGGCGCCCTCCCAGCTGGTCCACCCCGG
CGGGGCCCGCGCCCCCGGCCCGCCCGCCTGGCACCGCGCCCCGGGGCTGGGGCCGAGCGAGGAGCCCGCGAGGCGGCGAGAGGGCGAGCG
CCAGGCAGGCCGGCCCGGGGCCCCCGCCCCCCGCGCCCCCGCCCGATGGGGAACGCTCCGTCCCAAGATCCGGAGCGGAGCAGCCCCCCC
ATGCTGTCTGCGGACGATGCGGAGTACCCGCGGGAGTACCGGACCCTGGGGGGCGGGGGCGGCGGGGGCAGCGGGGGCCGGCGCTTCTCC
AACGTGGGGCTGGTGCACACGTCCGAGCGGCGGCACACGGTGATCGCGGCCCAGAGTCTGGAGGCGCTCAGCGGGCTCCAGAAGGCGGAC
GCCGACCGCAAGCGTGATGCCTTCATGGACCACCTGAAGAGCAAGTACCCACAGCACGCCCTGGCCCTGCGAGGCCAGCAGGACAGGATG
CGAGAGCAGCCAAACTACTGGAGTTTCAAGACCCGCAGCTCACGCCACACTCAGGGAGCCCAGCCCGGGCTGGCAGACCAGGCGGCAAAG
CTGTCCTACGCCTCCGCCGAGTCGCTGGAGACCATGTCGGAGGCCGAGCTGCCCCTGGGCTTCAGCAGGATGAACCGCTTCCGACAGAGC
CTGCCTCTCTCCCGCTCGGCCAGCCAGACCAAGCTGCGCTCCCCAGGGGTGCTGTTCCTGCAGTTCGGGGAGGAGACTCGGCGCGTGCAC
ATCACGCACGAGGTCAGCAGCCTGGACACGCTGCACGCACTCATCGCGCACATGTTCCCGCAGAAGCTCACCATGGGCATGCTTAAGTCG
CCCAATACCGCCATCCTCATCAAAGACGAGGCTCGCAACGTCTTCTACGAGCTGGAGGACGTCCGGGACATCCAGGACCGCAGTATTATC
AAGATCTACAGAAAGGAGCCCCTCTACGCTGCCTTCCCTGGCTCACATCTCACCAACGGGGACCTCCGGAGAGAGATGGTGTACGCATCG
CGGGAGTCCTCGCCCACGCGGCGCCTCAACAACCTGTCACCAGCGCCGCACCTGGCATCCGGCTCGCCGCCGCCCGGGCTGCCGTCGGGG
CTGCCGTCCGGGCTGCAGTCCGGTTCGCCGTCGCGTTCGCGCCTATCGTACGCCGGGGGGCGCCCGCCTTCGTACGCCGGCAGCCCGGTG
CACCACGCGGCCGAGAGGCTGGGAGGCGCCCCGGCCGCCCAGGGCGTCAGCCCCAGCCCCAGCGCCATCCTGGAGCGGCGCGACGTGAAG
CCGGACGAGGACCTGGCGAGCAAGGCGGGCGGCATGGTGCTGGTGAAAGGCGAGGGCCTCTATGCTGACCCCTACGGGCTGCTGCACGAG
GGCCGTCTGAGCCTGGCCGCGGCCGCCGGCGACCCGTTCGCCTACCCGGGCGCCGGCGGCCTCTACAAGCGCGGCTCGGTGCGCTCGCTC
AGCACCTACTCGGCCGCCGCGCTGCAGTCCGATCTGGAGGACTCCCTGTACAAGGCGGCGGGCGGCGGCGGCCCGCTGTACGGCGACGGC
TACGGCTTCCGCCTGCCGCCTTCGTCACCGCAGAAGCTGGCCGACGTGGCAGCACCCCCCGGAGGTCCCCCGCCACCGCACAGCCCCTAC
TCGGGGCCGCCCAGCCGCGGCTCGCCAGTGCGCCAGTCCTTCCGCAAGGACTCGGGCTCCTCGTCCGTCTTTGCCGAGAGTCCTGGAGGG
AAGACCCGCAGCGCGGGGAGCGCCTCGACGGCCGGAGCTCCCCCTTCGGAGCTCTTCCCTGGGCCTGGGGAACGCTCGCTGGTTGGGTTC
GGGCCGCCAGTGCCAGCCAAGGACACGGAGACCAGGAAGCCGCTGCCAGTAGAGGATTCAGACTGCAGCTCTGATGAGACCAGCATCTCT
GCCTTCTCATCCACCTTGCTGAACCCCATCAAATTAGCTGTGACCCAGCCCAACAGCAGCTTCTTTGCAGGGATGCTGGAGGGGGAGCTG
AACAAACTCAGCTTCTCCCCAATGGCCAAGAATGCAGAAAATGAGGACCTGGCGCTCGGCCCCTGCCCATGCCCATCGAAGTCCCAGATG
GCCACAAGGGGCCTGCTGGACCTTGACAACCCTGAGCTGGAGACAGAAACCTCCTCAACGCACTCAGAATCTTCTGTGGTTGTGGACCTG
CCGGACACCCCCTTCATCTTTGAGCACACCGTCAACAATTCCACAGCTGTGATTTCCTGGACCTACGCCTTGGGCAAGCAGCCGGTCAGT
TTCTACCAGCTCCTGTTACAGGAGGTGGCCAAGACACAGGAGAATGAGTTGCCCGAGGCAAAGAATCGTCCATGGATCTTCAACAAGATT
TTGGGCACTACTGTCAAGCTGATGGAGCTAAAGCCTAACACGTGTTACTGCCTCAGTGTCCGTGCAGCCAACACAGCTGGGGTGGGGAAG
TGGTGCAAGCCCTACAAATTTGCAACCCTGGCCACTGACTTCAGCAGCTTTCCTGAGAACTACCCCATCCAGATCACCGTGCGGCGCAAG
GAACCCCGGCAAAAGATCGTGTCCATCGGGCCGGAGGAGATGCGGAGGCTGGAGGATCTGGAATACCTATTTCCCTGTTAAGGGGGAGGG
CCCCAGGACACCCCTCACCTACTTTCAGCTTCAACCCCAGGCCCTCAGAAACCAGAGCCATGAGACCTACCATACCACCAGCACCCTGCG
GGCCCGGGGTCTGGCAGAGTGGTATGGGCACCCCACCCCTGGGCTGGGGCCAAGGCTACATAGGGGCCCCATTCACCTGGAGGCATCTCA
GGCCAGGCCATGCCAGGCTCAGCCACTGCCCACAGCTGCTAGACTCCCTCCTCCTCCAAATCTGGGCTGGGTCTAGGTCCCTCATTAAAG

>In-frame_SRCIN1_ENST00000578925_chr17_36717699_-_FNDC8_ENST00000158009_chr17_33454061_+_3003nt
GGCGGGGCCCGCGCCCCCGGCCCGCCCGCCTGGCACCGCGCCCCGGGGCTGGGGCCGAGCGAGGAGCCCGCGAGGCGGCGAGAGGGCGAG
CGCCAGGCAGGCCGGCCCGGGGCCCCCGCCCCCCGCGCCCCCGCCCGATGGGGAACGCTCCGTCCCAAGATCCGGAGCGGAGCAGCCCCC
CCATGCTGTCTGCGGACGATGCGGAGTACCCGCGGGAGTACCGGACCCTGGGGGGCGGGGGCGGCGGGGGCAGCGGGGGCCGGCGCTTCT
CCAACGTGGGGCTGGTGCACACGTCCGAGCGGCGGCACACGGTGATCGCGGCCCAGAGTCTGGAGGCGCTCAGCGGGCTCCAGAAGGCGG
ACGCCGACCGCAAGCGTGATGCCTTCATGGACCACCTGAAGAGCAAGTACCCACAGCACGCCCTGGCCCTGCGAGGCCAGCAGGACAGGA
TGCGAGAGCAGGTTGGCGGCTGGACCGTGGACCCCGTATGCCTCCTCAGCTCCCTCTGCTCCCACCTCCATGGCGACTCCGCCCCCTCCG
GGGCTGGCCAGCCGGCCCAGCAGCCAAACTACTGGAGTTTCAAGACCCGCAGCTCACGCCACACTCAGGGAGCCCAGCCCGGGCTGGCAG
ACCAGGCGGCAAAGCTGTCCTACGCCTCCGCCGAGTCGCTGGAGACCATGTCGGAGGCCGAGCTGCCCCTGGGCTTCAGCAGGATGAACC
GCTTCCGACAGAGCCTGCCTCTCTCCCGCTCGGCCAGCCAGACCAAGCTGCGCTCCCCAGGGGTGCTGTTCCTGCAGTTCGGGGAGGAGA
CTCGGCGCGTGCACATCACGCACGAGGTCAGCAGCCTGGACACGCTGCACGCACTCATCGCGCACATGTTCCCGCAGAAGCTCACCATGG
GCATGCTTAAGTCGCCCAATACCGCCATCCTCATCAAAGACGAGGCTCGCAACGTCTTCTACGAGCTGGAGGACGTCCGGGACATCCAGG
ACCGCAGTATTATCAAGATCTACAGAAAGGAGCCCCTCTACGCTGCCTTCCCTGGCTCACATCTCACCAACGGGGACCTCCGGAGAGAGA
TGGTGTACGCATCGCGGGAGTCCTCGCCCACGCGGCGCCTCAACAACCTGTCACCAGCGCCGCACCTGGCATCCGGCTCGCCGCCGCCCG
GGCTGCCGTCGGGGCTGCCGTCCGGGCTGCAGTCCGGTTCGCCGTCGCGTTCGCGCCTATCGTACGCCGGGGGGCGCCCGCCTTCGTACG
CCGGCAGCCCGGTGCACCACGCGGCCGAGAGGCTGGGAGGCGCCCCGGCCGCCCAGGGCGTCAGCCCCAGCCCCAGCGCCATCCTGGAGC
GGCGCGACGTGAAGCCGGACGAGGACCTGGCGAGCAAGGCGGGCGGCATGGTGCTGGTGAAAGGCGAGGGCCTCTATGCTGACCCCTACG
GGCTGCTGCACGAGGGCCGTCTGAGCCTGGCCGCGGCCGCCGGCGACCCGTTCGCCTACCCGGGCGCCGGCGGCCTCTACAAGCGCGGCT
CGGTGCGCTCGCTCAGCACCTACTCGGCCGCCGCGCTGCAGTCCGATCTGGAGGACTCCCTGTACAAGGCGGCGGGCGGCGGCGGCCCGC
TGTACGGCGACGGCTACGGCTTCCGCCTGCCGCCTTCGTCACCGCAGAAGCTGGCCGACGTGGCAGCACCCCCCGGAGGTCCCCCGCCAC
CGCACAGCCCCTACTCGGGGCCGCCCAGCCGCGGCTCGCCAGTGCGCCAGTCCTTCCGCAAGGACTCGGGCTCCTCGTCCGTCTTTGCCG
AGAGTCCTGGAGGGAAGACCCGCAGCGCGGGGAGCGCCTCGACGGCCGGAGCTCCCCCTTCGGAGCTCTTCCCTGGGCCTGGGGAACGCT
CGCTGGTTGGGTTCGGGCCGCCAGTGCCAGCCAAGGACACGGAGACCAGGAAGCCGCTGCCAGTAGAGGATTCAGACTGCAGCTCTGATG
AGACCAGCATCTCTGCCTTCTCATCCACCTTGCTGAACCCCATCAAATTAGCTGTGACCCAGCCCAACAGCAGCTTCTTTGCAGGGATGC
TGGAGGGGGAGCTGAACAAACTCAGCTTCTCCCCAATGGCCAAGAATGCAGAAAATGAGGACCTGGCGCTCGGCCCCTGCCCATGCCCAT
CGAAGTCCCAGATGGCCACAAGGGGCCTGCTGGACCTTGACAACCCTGAGCTGGAGACAGAAACCTCCTCAACGCACTCAGAATCTTCTG
TGGTTGTGGACCTGCCGGACACCCCCTTCATCTTTGAGCACACCGTCAACAATTCCACAGCTGTGATTTCCTGGACCTACGCCTTGGGCA
AGCAGCCGGTCAGTTTCTACCAGCTCCTGTTACAGGAGGTGGCCAAGACACAGGAGAATGAGTTGCCCGAGGCAAAGAATCGTCCATGGA
TCTTCAACAAGATTTTGGGCACTACTGTCAAGCTGATGGAGCTAAAGCCTAACACGTGTTACTGCCTCAGTGTCCGTGCAGCCAACACAG
CTGGGGTGGGGAAGTGGTGCAAGCCCTACAAATTTGCAACCCTGGCCACTGACTTCAGCAGCTTTCCTGAGAACTACCCCATCCAGATCA
CCGTGCGGCGCAAGGAACCCCGGCAAAAGATCGTGTCCATCGGGCCGGAGGAGATGCGGAGGCTGGAGGATCTGGAATACCTATTTCCCT
GTTAAGGGGGAGGGCCCCAGGACACCCCTCACCTACTTTCAGCTTCAACCCCAGGCCCTCAGAAACCAGAGCCATGAGACCTACCATACC
ACCAGCACCCTGCGGGCCCGGGGTCTGGCAGAGTGGTATGGGCACCCCACCCCTGGGCTGGGGCCAAGGCTACATAGGGGCCCCATTCAC
CTGGAGGCATCTCAGGCCAGGCCATGCCAGGCTCAGCCACTGCCCACAGCTGCTAGACTCCCTCCTCCTCCAAATCTGGGCTGGGTCTAG


Top

FusionGenePPI for SRCIN1_FNDC8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SRCIN1BCAR1, CRK, SNAP25, SRC, CSK, SORBS3, SYP, NUFIP1, BCAS4, CKAP5, CDH1FNDC8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSRCIN1chr17:36717699chr17:33454061ENST00000264659-719647_6975661184SNAP25


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SRCIN1_FNDC8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SRCIN1_FNDC8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource