|
||||||
|
 | |
| |
| |
| |
| |
|
Fusion gene ID: 35882 |
FusionGeneSummary for SPTY2D1_SERGEF |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: SPTY2D1_SERGEF | Fusion gene ID: 35882 | Hgene | Tgene | Gene symbol | SPTY2D1 | SERGEF | Gene ID | 144108 | 26297 |
| Gene name | SPT2 chromatin protein domain containing 1 | secretion regulating guanine nucleotide exchange factor | |
| Synonyms | Spt2 | DELGEF|Gnefr | |
| Cytomap | 11p15.1 | 11p15.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | protein SPT2 homologSPT2 domain-containing protein 1SPT2, Suppressor of Ty, domain containing 1 | secretion-regulating guanine nucleotide exchange factordeafness locus associated putative guanine nucleotide exchange factorguanine nucleotide exchange factor-related protein | |
| Modification date | 20180523 | 20180519 | |
| UniProtAcc | Q68D10 | Q9UGK8 | |
| Ensembl transtripts involved in fusion gene | ENST00000336349, ENST00000543776, | ENST00000265965, ENST00000528200, ENST00000532265, ENST00000532212, | |
| Fusion gene scores | * DoF score | 1 X 1 X 1=1 | 6 X 5 X 6=180 |
| # samples | 1 | 7 | |
| ** MAII score | log2(1/1*10)=3.32192809488736 | log2(7/180*10)=-1.36257007938471 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: SPTY2D1 [Title/Abstract] AND SERGEF [Title/Abstract] AND fusion [Title/Abstract] | ||
| Functional or gene categories assigned by FusionGDB annotation | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | SERGEF | GO:0050709 | negative regulation of protein secretion | 12459492 |
| Fusion gene information from three resources (ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018)) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Data type | Source | Cancer type | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| TCGA | LD | SKCM | TCGA-DA-A1HW-06A | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| * LD: Li Ding group's fusion gene list RV: Roel Verhaak group's fusion gene list ChiTaRs fusion database |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000336349 | ENST00000265965 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| 5CDS-3UTR | ENST00000336349 | ENST00000528200 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| 5CDS-intron | ENST00000336349 | ENST00000532265 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| 5CDS-intron | ENST00000336349 | ENST00000532212 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| intron-3CDS | ENST00000543776 | ENST00000265965 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| intron-3UTR | ENST00000543776 | ENST00000528200 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| intron-intron | ENST00000543776 | ENST00000532265 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
| intron-intron | ENST00000543776 | ENST00000532212 | SPTY2D1 | chr11 | 18655745 | - | SERGEF | chr11 | 17809960 | - |
Top |
FusionProtFeatures for SPTY2D1_SERGEF |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| SPTY2D1 | SERGEF |
| Probable guanine nucleotide exchange factor (GEF), whichmay be involved in the secretion process. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at . * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | >SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 352_402 | 349 | 459 | Repeat | Note=RCC1 7 |
| Tgene | >SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 352_402 | 293 | 351 | Repeat | Note=RCC1 7 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | >SPTY2D1 | chr11:18655745 | chr11:17809960 | ENST00000336349 | - | 1 | 6 | 123_148 | 20 | 686 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | >SPTY2D1 | chr11:18655745 | chr11:17809960 | ENST00000336349 | - | 1 | 6 | 45_81 | 20 | 686 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | >SPTY2D1 | chr11:18655745 | chr11:17809960 | ENST00000336349 | - | 1 | 6 | 645_685 | 20 | 686 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | >SPTY2D1 | chr11:18655745 | chr11:17809960 | ENST00000336349 | - | 1 | 6 | 278_552 | 20 | 686 | Compositional bias | Note=Ser-rich |
| Hgene | >SPTY2D1 | chr11:18655745 | chr11:17809960 | ENST00000336349 | - | 1 | 6 | 591_595 | 20 | 686 | Compositional bias | Note=Poly-Asp |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 120_171 | 349 | 459 | Repeat | Note=RCC1 3 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 15_67 | 349 | 459 | Repeat | Note=RCC1 1 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 172_230 | 349 | 459 | Repeat | Note=RCC1 4 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 231_283 | 349 | 459 | Repeat | Note=RCC1 5 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 284_351 | 349 | 459 | Repeat | Note=RCC1 6 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000265965 | - | 9 | 11 | 68_119 | 349 | 459 | Repeat | Note=RCC1 2 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 120_171 | 293 | 351 | Repeat | Note=RCC1 3 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 15_67 | 293 | 351 | Repeat | Note=RCC1 1 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 172_230 | 293 | 351 | Repeat | Note=RCC1 4 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 231_283 | 293 | 351 | Repeat | Note=RCC1 5 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 284_351 | 293 | 351 | Repeat | Note=RCC1 6 |
| Tgene | SERGEF | chr11:18655745 | chr11:17809960 | ENST00000528200 | - | 8 | 10 | 68_119 | 293 | 351 | Repeat | Note=RCC1 2 |
Top |
FusionGeneSequence for SPTY2D1_SERGEF |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. (nt: nucleotides, aa: amino acids) |
| * Fusion amino acid sequences. |
| >In-frame_SPTY2D1_ENST00000336349_chr11_18655745_-_SERGEF_ENST00000265965_chr11_17809960_-_129aa MDFREILMIASKGQGVNNVPVECVTLGAGMSMACAEMALKPTSGPQSRCRLCCHRQDSLWAVGLATPWPSASCQLTLHWSRTPRSPTFPQ |
| * Fusion transcript sequences (only coding sequence (CDS) region). |
| >In-frame_SPTY2D1_ENST00000336349_chr11_18655745_-_SERGEF_ENST00000265965_chr11_17809960_-_389nt ATGGACTTCAGAGAAATTCTCATGATAGCTTCCAAGGGACAAGGTGTCAACAATGTGCCGGTGGAGTGTGTTACTCTTGGGGCTGGAATG AGCATGGCATGTGCGGAGATGGCACTGAAGCCAACGTCTGGGCCCCAAAGCCGGTGCAGGCTCTGCTGTCATCGTCAGGACTCCTTGTGG GCTGTGGGGCTGGCCACTCCTTGGCCCTCTGCCAGCTGCCAGCTCACCCTGCATTGGTCCAGGACCCCAAGGTCACCTACCTTTCCCCAG ATGCCATCGAGGACACTGAATCTCAGAAAGCCATGGACAAAGAGAGAAACTGGAAGGAAAGACAATCAGAAACTTCAACCCAAAGCCAAT |
| * Fusion transcript sequences (Full-length transcript). |
| >In-frame_SPTY2D1_ENST00000336349_chr11_18655745_-_SERGEF_ENST00000265965_chr11_17809960_-_662nt TAAAAGCGGAAGTTACGCAGGGACTCGCGAGCGCTGTGGCGGCCCTGAAAGGATATAGGCCGTGGAGGGAAGGGGGCGGGCAGACGGCAT AGGAAGGCGCCGGAAGTGGTCCCGCAGAGGCGGGGTGGGAGTGGGGCTCCCGAGGCAGTGCAGTTGGCTGTAGCTGGGCGCCTCGGTTAG GTGCGCTGTCAGTCCTTTCCGAGTGCCTGGCCCAGTCTCTCCCGCCTCGGCCCAACATGGACTTCAGAGAAATTCTCATGATAGCTTCCA AGGGACAAGGTGTCAACAATGTGCCGGTGGAGTGTGTTACTCTTGGGGCTGGAATGAGCATGGCATGTGCGGAGATGGCACTGAAGCCAA CGTCTGGGCCCCAAAGCCGGTGCAGGCTCTGCTGTCATCGTCAGGACTCCTTGTGGGCTGTGGGGCTGGCCACTCCTTGGCCCTCTGCCA GCTGCCAGCTCACCCTGCATTGGTCCAGGACCCCAAGGTCACCTACCTTTCCCCAGATGCCATCGAGGACACTGAATCTCAGAAAGCCAT GGACAAAGAGAGAAACTGGAAGGAAAGACAATCAGAAACTTCAACCCAAAGCCAATCTGACTGGTCCAGAAATGGGGGACTGTGATAGAG |
Top |
FusionGenePPI for SPTY2D1_SERGEF |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in . |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| SPTY2D1 | SCYL1, SCAF4, NIFK, NPM1, ZBTB38, SNIP1, RNMTL1, ZRSR2, KRAS, GDI1, MYH6, CENPU, RRP8, KBTBD7, RBM34, H2AFY2, ZNF692, MAGEB10, PLEKHO1, RPL18, SART3, GPATCH4, DGCR8, RPS14 | SERGEF | EXOC2, KDM1A, PRMT6, DPH3 |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
RelatedDrugs for SPTY2D1_SERGEF |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.0 2018-04-02) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for SPTY2D1_SERGEF |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|