FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35762

FusionGeneSummary for SPOP_TAOK1

check button Fusion gene summary
Fusion gene informationFusion gene name: SPOP_TAOK1
Fusion gene ID: 35762
HgeneTgene
Gene symbol

SPOP

TAOK1

Gene ID

8405

57551

Gene namespeckle type BTB/POZ proteinTAO kinase 1
SynonymsBTBD32|TEF2KFC-B|MAP3K16|MARKK|PSK-2|PSK2|TAO1|hKFC-B|hTAOK1
Cytomap

17q21.33

17q11.2

Type of geneprotein-codingprotein-coding
Descriptionspeckle-type POZ proteinHIB homolog 1roadkill homolog 1serine/threonine-protein kinase TAO1MARK KinaseSTE20-like kinase PSK2kinase from chicken homolog Bmicrotubule affinity regulating kinase kinaseprostate-derived STE20-like kinase 2prostate-derived sterile 20-like kinase 2serine/threonine protein kin
Modification date2018052320180523
UniProtAcc

O43791

Q7L7X3

Ensembl transtripts involved in fusion geneENST00000393328, ENST00000393331, 
ENST00000347630, ENST00000504102, 
ENST00000503676, ENST00000513080, 
ENST00000261716, ENST00000536202, 
Fusion gene scores* DoF score20 X 8 X 13=20807 X 7 X 3=147
# samples 228
** MAII scorelog2(22/2080*10)=-3.24100809950379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/147*10)=-0.877744249949002
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SPOP [Title/Abstract] AND TAOK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTAOK1

GO:0006974

cellular response to DNA damage stimulus

17396146

TgeneTAOK1

GO:0046330

positive regulation of JNK cascade

16407310

TgeneTAOK1

GO:0097194

execution phase of apoptosis

16407310


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E2-A14V-01ASPOPchr17

47679227

-TAOK1chr17

27869579

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393328ENST00000261716SPOPchr17

47679227

-TAOK1chr17

27869579

+
Frame-shiftENST00000393328ENST00000536202SPOPchr17

47679227

-TAOK1chr17

27869579

+
Frame-shiftENST00000393331ENST00000261716SPOPchr17

47679227

-TAOK1chr17

27869579

+
In-frameENST00000393331ENST00000536202SPOPchr17

47679227

-TAOK1chr17

27869579

+
Frame-shiftENST00000347630ENST00000261716SPOPchr17

47679227

-TAOK1chr17

27869579

+
In-frameENST00000347630ENST00000536202SPOPchr17

47679227

-TAOK1chr17

27869579

+
Frame-shiftENST00000504102ENST00000261716SPOPchr17

47679227

-TAOK1chr17

27869579

+
In-frameENST00000504102ENST00000536202SPOPchr17

47679227

-TAOK1chr17

27869579

+
In-frameENST00000503676ENST00000261716SPOPchr17

47679227

-TAOK1chr17

27869579

+
Frame-shiftENST00000503676ENST00000536202SPOPchr17

47679227

-TAOK1chr17

27869579

+
intron-3CDSENST00000513080ENST00000261716SPOPchr17

47679227

-TAOK1chr17

27869579

+
intron-3CDSENST00000513080ENST00000536202SPOPchr17

47679227

-TAOK1chr17

27869579

+

Top

FusionProtFeatures for SPOP_TAOK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SPOP

O43791

TAOK1

Q7L7X3

Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3ubiquitin-protein ligase complex that mediates the ubiquitinationof target proteins, leading most often to their proteasomaldegradation. In complex with CUL3, involved in ubiquitination andproteasomal degradation of BRMS1, DAXX, PDX1/IPF1, GLI2 and GLI3.In complex with CUL3, involved in ubiquitination of H2AFY andBMI1; this does not lead to their proteasomal degradation.Inhibits transcriptional activation of PDX1/IPF1 targets, such asinsulin, by promoting PDX1/IPF1 degradation. The cullin-RING-basedBCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containinghomodimeric SPOP has higher ubiquitin ligase activity than thecomplex that contains the heterodimer formed by SPOP and SPOPL.{ECO:0000269|PubMed:14528312, ECO:0000269|PubMed:15897469,ECO:0000269|PubMed:16524876, ECO:0000269|PubMed:19818708,ECO:0000269|PubMed:22085717, ECO:0000269|PubMed:22632832}. Serine/threonine-protein kinase involved in variousprocesses such as p38/MAPK14 stress-activated MAPK cascade, DNAdamage response and regulation of cytoskeleton stability.Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator ofthe p38/MAPK14 stress-activated MAPK cascade by mediatingphosphorylation and subsequent activation of the upstream MAP2K3and MAP2K6 kinases. Involved in G-protein coupled receptorsignaling to p38/MAPK14. In response to DNA damage, involved inthe G2/M transition DNA damage checkpoint by activating thep38/MAPK14 stress-activated MAPK cascade, probably by mediatingphosphorylation of MAP2K3 and MAP2K6. Acts as a regulator ofcytoskeleton stability by phosphorylating 'Thr-208' of MARK2,leading to activate MARK2 kinase activity and subsequentphosphorylation and detachment of MAPT/TAU from microtubules. Alsoacts as a regulator of apoptosis: regulates apoptoticmorphological changes, including cell contraction, membraneblebbing and apoptotic bodies formation via activation of theMAPK8/JNK cascade. {ECO:0000269|PubMed:12665513,ECO:0000269|PubMed:13679851, ECO:0000269|PubMed:16407310,ECO:0000269|PubMed:17396146, ECO:0000269|PubMed:17900936}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPOPchr17:47679227chr17:27869579ENST00000347630-1011173_297326375DomainBTB
HgeneSPOPchr17:47679227chr17:27869579ENST00000347630-101131_161326375DomainMATH
HgeneSPOPchr17:47679227chr17:27869579ENST00000393328-1011173_297326375DomainBTB
HgeneSPOPchr17:47679227chr17:27869579ENST00000393328-101131_161326375DomainMATH
HgeneSPOPchr17:47679227chr17:27869579ENST00000393331-1112173_297326375DomainBTB
HgeneSPOPchr17:47679227chr17:27869579ENST00000393331-111231_161326375DomainMATH
HgeneSPOPchr17:47679227chr17:27869579ENST00000503676-1011173_297326375DomainBTB
HgeneSPOPchr17:47679227chr17:27869579ENST00000503676-101131_161326375DomainMATH
HgeneSPOPchr17:47679227chr17:27869579ENST00000504102-910173_297326375DomainBTB
HgeneSPOPchr17:47679227chr17:27869579ENST00000504102-91031_161326375DomainMATH
HgeneSPOPchr17:47679227chr17:27869579ENST00000347630-1011123_133326375RegionNote=Important for binding substrate proteins
HgeneSPOPchr17:47679227chr17:27869579ENST00000347630-1011186_217326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000347630-101171_191326375RegionNote=Required for nuclear localization
HgeneSPOPchr17:47679227chr17:27869579ENST00000393328-1011123_133326375RegionNote=Important for binding substrate proteins
HgeneSPOPchr17:47679227chr17:27869579ENST00000393328-1011186_217326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000393328-101171_191326375RegionNote=Required for nuclear localization
HgeneSPOPchr17:47679227chr17:27869579ENST00000393331-1112123_133326375RegionNote=Important for binding substrate proteins
HgeneSPOPchr17:47679227chr17:27869579ENST00000393331-1112186_217326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000393331-111271_191326375RegionNote=Required for nuclear localization
HgeneSPOPchr17:47679227chr17:27869579ENST00000503676-1011123_133326375RegionNote=Important for binding substrate proteins
HgeneSPOPchr17:47679227chr17:27869579ENST00000503676-1011186_217326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000503676-101171_191326375RegionNote=Required for nuclear localization
HgeneSPOPchr17:47679227chr17:27869579ENST00000504102-910123_133326375RegionNote=Important for binding substrate proteins
HgeneSPOPchr17:47679227chr17:27869579ENST00000504102-910186_217326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000504102-91071_191326375RegionNote=Required for nuclear localization
TgeneTAOK1chr17:47679227chr17:27869579ENST00000536202+1618754_877700854Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPOPchr17:47679227chr17:27869579ENST00000347630-1011297_355326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000393328-1011297_355326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000393331-1112297_355326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000503676-1011297_355326375RegionNote=Important for homodimerization
HgeneSPOPchr17:47679227chr17:27869579ENST00000504102-910297_355326375RegionNote=Important for homodimerization
TgeneTAOK1chr17:47679227chr17:27869579ENST00000261716+1820458_6518481002Coiled coilOntology_term=ECO:0000255
TgeneTAOK1chr17:47679227chr17:27869579ENST00000261716+1820754_8778481002Coiled coilOntology_term=ECO:0000255
TgeneTAOK1chr17:47679227chr17:27869579ENST00000536202+1618458_651700854Coiled coilOntology_term=ECO:0000255
TgeneTAOK1chr17:47679227chr17:27869579ENST00000261716+1820330_3348481002Compositional biasNote=Poly-Glu
TgeneTAOK1chr17:47679227chr17:27869579ENST00000261716+1820347_3798481002Compositional biasNote=Ser-rich
TgeneTAOK1chr17:47679227chr17:27869579ENST00000536202+1618330_334700854Compositional biasNote=Poly-Glu
TgeneTAOK1chr17:47679227chr17:27869579ENST00000536202+1618347_379700854Compositional biasNote=Ser-rich
TgeneTAOK1chr17:47679227chr17:27869579ENST00000261716+182028_2818481002DomainProtein kinase
TgeneTAOK1chr17:47679227chr17:27869579ENST00000536202+161828_281700854DomainProtein kinase
TgeneTAOK1chr17:47679227chr17:27869579ENST00000261716+182034_428481002Nucleotide bindingATP
TgeneTAOK1chr17:47679227chr17:27869579ENST00000536202+161834_42700854Nucleotide bindingATP


Top

FusionGeneSequence for SPOP_TAOK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SPOP_ENST00000393328_chr17_47679227_-_TAOK1_ENST00000261716_chr17_27869579_+_154aa
IEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQ

>In-frame_SPOP_ENST00000393331_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_154aa
IEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQ

>In-frame_SPOP_ENST00000347630_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_154aa
IEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQ

>In-frame_SPOP_ENST00000504102_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_154aa
IEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQ

>In-frame_SPOP_ENST00000503676_chr17_47679227_-_TAOK1_ENST00000261716_chr17_27869579_+_154aa
IEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SPOP_ENST00000393328_chr17_47679227_-_TAOK1_ENST00000261716_chr17_27869579_+_462nt
ATTGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTT
GACTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCT
GGTTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAA
GGTGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCT
CTGAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATG

>In-frame_SPOP_ENST00000393331_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_462nt
ATTGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTT
GACTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCT
GGTTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAA
GGTGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCT
CTGAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATG

>In-frame_SPOP_ENST00000347630_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_462nt
ATTGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTT
GACTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCT
GGTTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAA
GGTGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCT
CTGAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATG

>In-frame_SPOP_ENST00000504102_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_462nt
ATTGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTT
GACTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCT
GGTTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAA
GGTGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCT
CTGAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATG

>In-frame_SPOP_ENST00000503676_chr17_47679227_-_TAOK1_ENST00000261716_chr17_27869579_+_462nt
ATTGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTT
GACTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCT
GGTTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAA
GGTGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCT
CTGAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SPOP_ENST00000393328_chr17_47679227_-_TAOK1_ENST00000261716_chr17_27869579_+_10690nt
GTGCTGACGCCATGACGCCCCGGCTGGTGTGTGTCGGTGTGTATGTGTGTGTGTGAGTGTGCGCGCTCCGAGTGTGTGTGTATTTGTGTA
TCGGCGGTCCCGCAGGTCCCGGATGTTGCGGACAGTATGAGGCAAGCGCAGGGGGACGGGGACCAGCAGCTGTCGCCGCCGCTCTCAGAT
CGAGTCTTGCTCTGTCACCCAGGCTGGAGTGCAGTGGCGCGATCTCAGCTCACTGCCACCTTTGCCTCCTGGGTTCAAGCGATTCTTCTG
CCTCAGCCTCCCGAGTAGCTGGGATTACAGGGTGAAGAGGGAACAGAAATCTTTGCCCCCTGACTTTGGAAATCTCGTTTAACCTTCAAA
CTGGCGATGTCAAGGGTTCCAAGTCCTCCACCTCCGGCAGAAATGTCGAGTGGCCCCGTAGCTGAGAGTTGGTGCTACACACAGATCAAG
GTAGTGAAATTCTCCTACATGTGGACCATCAATAACTTTAGCTTTTGCCGGGAGGAAATGGGTGAAGTCATTAAAAGTTCTACATTTTCA
TCAGGAGCAAATGATAAACTGAAATGGTGTTTGCGAGTAAACCCCAAAGGGTTAGATGAAGAAAGCAAAGATTACCTGTCACTTTACCTG
TTACTGGTCAGCTGTCCAAAGAGTGAAGTTCGGGCAAAATTCAAATTCTCCATCCTGAATGCCAAGGGAGAAGAAACCAAAGCTATGGAG
AGTCAACGGGCATATAGGTTTGTGCAAGGCAAAGACTGGGGATTCAAGAAATTCATCCGTAGAGATTTTCTTTTGGATGAGGCCAACGGG
CTTCTCCCTGATGACAAGCTTACCCTCTTCTGCGAGGTGAGTGTTGTGCAAGATTCTGTCAACATTTCTGGCCAGAATACCATGAACATG
GTAAAGGTTCCTGAGTGCCGGCTGGCAGATGAGTTAGGAGGACTGTGGGAGAATTCCCGGTTCACAGACTGCTGCTTGTGTGTTGCCGGC
CAGGAATTCCAGGCTCACAAGGCTATCTTAGCAGCTCGTTCTCCGGTTTTTAGTGCCATGTTTGAACATGAAATGGAGGAGAGCAAAAAG
AATCGAGTTGAAATCAATGATGTGGAGCCTGAAGTTTTTAAGGAAATGATGTGCTTCATTTACACGGGGAAGGCTCCAAACCTCGACAAA
ATGGCTGATGATTTGCTGGCAGCTGCTGACAAGTATGCCCTGGAGCGCTTAAAGGTCATGTGTGAGGATGCCCTCTGCAGTAACCTGTCC
GTGGAGAACGCTGCAGAAATTCTCATCCTGGCCGACCTCCACAGTGCAGATCAGTTGAAAACTCAGGCAGTGGATTTCATCAACTAATTG
AAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTTGACT
CTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCTGGTT
GGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAAGGTG
GACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCTCTGA
GGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATGTCTT
ATACATAACTTAATAATTGAGAGTGGCAATTCCGCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATCACAGCAGCCTCCTCA
CTTGGGTACTACAGTGTGGAAGCTGAGTGCATATGGTATATTTTATTCATTTTTGTAAAGCGTTCTGTTTTGTGTTTACTAATTGGGATG
TCATAGTACTTGGCTGCCGGGTTTGTTTGTTTTTGGGGAAATTTTGAAAAGTGGAGTTGATATTAAAAATAAATGTGTATGTGTGTACAT
ATATATACACACACATACACATATATTATGCATGTGGTGAAAAGAATTGGCTAGATAGGGGATTTTTCTGAACACTGCAAAAATAGAACG
TAGCAAAATGGCTTCAGTTATCACTTTTGGGTGTCTGTATCCTAAGAAGTTTCTGAAAAGATCTAAAGCCTTTTTATCCCATATCCCAAA
TTCTTATGAGCCACTCACAGCAGGCAGCATATGTTGAAATAAGTTATTACTGGTACACACCTGCATTGCCTCACCAGTGTATTTATTTGT
TATTAAATTGATCTGACTTCTCAGCCTCATTTGGACTAAAAAAAGAAAGCAGAAATCCATGAACACATTGCTTCTCGGCCTTTTGGCTAA
GATCAAGTGTAGAAATCCATGAACACTAAAGGACTTCATTGATTTTTTCAGAGAGTAGAAAACAACTTAGTTTTTCTTTTTTCCTGAATG
CGTCATAGGCTTGTGAGTGATTTTTGTCCATTCAATTGTGCCTTCTTTGTATTATGATAAGATGGGGGTACTTAAGGAGATCACAAGTTG
TGTGAGGATTGCATTAACAAACCTATGAGCCTTCAATGGGGAAGACCAGAAGGGTGAGAGGGGCCCTGAAAGTTCATATGGTGGGTATGT
CCCGCAGCAGAGTGAGGAGATGAAGCTTACGTGTCCTGACGTTTTGTTGCTTATACTGTGATATCTCATCCTAGCTAAGCTCTATAATGC
CCAAGACCCCAAACAGTACTTTTACTTTGTTTGTACAAAAACAAAGACATATAGCCAATACAAATCAAATGCCGGAGGTGTTTGATGCCA
TATTTGCAAATTGCCATCTATTGAAATTCTCGTCACACTACATAGACATAATTGTTATCTCCTTTTGGCTTATGTGATTTTCTGTTTACA
AGTAGAATAGCCAATTATTTAAATGTTTAGTTGCCACAGTGAACCAGGAGTCACTGAGCCAATGACTTTACCAGCTGCTGACTAATCTTC
ATCACCACTGTAGATTTTGCTGCATGTGCAGGTCCTCTATTTTTAATTGCTGTTTTCGTTGCTGCAGTACTTTACAAACTTCTAGTTCGT
TGAGACTTAGTGACCATTTGGCATCAAGTTAACATCACACAATAGGAAACACCACTTCCACAAGTCTCAAGCCTCAGTGCTAAAGTACTA
CTGAAAAGGAACTAGGAAGTTTGGCCAATTAAAAAAAAAAAGTAAAATAAGTTATAGTGGTCAGGGAATCTCTTGACGAAAGCTAACTCT
TATTTTTCAGGGGGCACATGTTTTGTTTTGTTATGTTTTGTTGTACAATGAAGGATGAACCCAATGCTAAAAAGTCAGTTATTTTCTTGG
TTTTCCATTTCTTGTATATAAATTGTGTTGGAGGTGGGTAGGAAGCTGTGAGTATGACTTGAAGAAAAATATCCTTTTCAGTGACAAATC
AGAGTTTCTTACAAGTTATTGTCCTGCTCCCTTCCAAGTTGTCTTGAAGAATCCTTGCTGCTAACTCTGGATCCTGCTTTTCCTATAGTC
AGAGGGCTCCAAGGTAGAACTCTCTAAGTCCCTCTCAATGGCACTCTTTGCCTAGACCAAACTAATGACCAAACAGTAATCAATCTATCA
CTGTTGAAGTCCTGGTTTTCTCAACCAAATTTTAAGTCTTTCCCAGGTATGTCAGTCGAGTTGCCATGAATCCTCACCTGTAGGAGTTTC
TGGGATTCATTTTAAGGAAACTGGAAGAAAATTAATGTTTTAATGTAAATGTTTTTAAAACCAAGATCACCATAGAGTTCACACAAAATT
TTAGGCAGTGTTTCAAGAAGCACTCTTATGTGTTGTTCTTTCAGCCCATGCTCCAGGTCACCGGTTTTTAGGTAAACATGACATGACATG
TACTTGTAATATCAGTGAAAGGGGCTTTTAGTCGTCTCAGTATCTTTTTTGCATTCAGGTATTATAGCGTTTCCAACAAATTGAGAAATT
ACTTATTTGGTGTAAAATGACGAGAGAGCTTTAGAATTTAATAAAATGTCAAAAATACAATTTGATACCCTTAAAAATTATTCATAGATC
TGGCTGCTCTGTACTACTGGATGGGTGGAATAGGGAAGCAGATCACTTTTGCATACAAAAACTCTTTCAAACCCAAAATATTATTGGTGG
TACATTTTAAAGTCCAATTGTGGACTTAAATTAGTCAAATTGAGAGTTACTGAGTCCATTCAGATCTCCAGTAGGGTTTTGTATCTAATG
TATTTGGCCACCAGTTTTACATGTAGGTCATGACTATACCTGGATTTTATCATTAAGTTAACTTTAAAGTATATACAGTTTGCAAAAAAT
GATTCAAATTAATTGGTTTGTATATGTTTGTGAGATCTAGCTTCTGAGGAATCTCATACATAGTAGGAACCATCATAGAGTAAAGCTTGT
AGCAGAAAAATTGGAAGGGTTTTGAGATATCCTAGAGAAAGAGCAAGCACTTTCTGAATCAGTGGGGAAATATCAATATTTGATCAAATT
AACACTACCTCCTTCCCAGTGTTGGTGTTCACTCACTATATGTCTTTAAGAAAATTAAAACTATGGAAAATTTGTCTAGCATATCAGAAG
TTGTAAATGCTATATCTGGTATCCAGAGGCTGGCTGTAAAAAGTTCCTTGGGGTCACTCTATCTCACATTTTTTTTGGTTAGCATTTTAA
AAATGCAAAGCCACATACTTTGAAATATATTATTCCAAATTGAGCTCCCTTCCCTTTGCACATATTTTTTCCTCCCCTTATTGAAGTCAG
CTCTAACCCCAAATTCTAGTATCCAAAAGTATTTTTATTTGTATAATGCTATCTGAAAAATGTGTTTATATTATATTTTCAGAGCTGCAA
TTCTTATTCGCCATTTCAATACCTAGAGATAGAGAGTCTTGTATTTGAAGCCACACACACTGGTGTAATATGCTTAGTACTCTAGGTCAA
GGATTTGTTGGTAAATGGAACATTTTAGCATAGTCATGATTTTTGGTTGCCTAGACATCAGGTAAACATTCAGTACACTAAAGAAACTAT
CCTGGACACTCCCTCCTGCTTCCACCAATTTTTTTCTCACCCCCTTTTCAAAAATTGAAAACTCTATGAGTGTCTTTTTGAGACCATAAA
GCAGACTTTAGTAACTTTCTATTTCTGTAAGTACTAAATGTCTGGCATTTTAAACTTTTGTAGAATACATTATGTTGGACACTGGAATAA
TACTATTTATTTTCACCTGTGAAAAATGACTTCATTGTACTTGAAACACCTCCTTTGCATTTCTCCATTTGTGCCATTCACTAGTGGAAA
TAAATTGTATTATACCATGATCTACTGGCTTTTTAAAACTGTATTAAATATGCACATTTTTGGTATAGCTATTATCATTTGTATGTATAT
ATTGTATATACATATGAGTGTCTGTATGTGTGTATAGATGGATGGATGTAACTCATACTGTACATTTCCATCAGGGCACTTAAAAGTTCT
GTTATTTTTGTTTGGTTTTGTTATTTCAGTCCTCAGTTAAGGCAAGAATGCATGTGTTTCTTAAGAATGAGTACTCTGCGTTGATGTTTA
TGAGAAGGTGGTCATTAGATGCAGTCTTTTCCTTTTTAATCCCCTCTTAGCACTTCTGTGAGTGGAGAGGACATTAAGTAAAATTTGGAA
TCATAAGTTGCAATGCAGTAAAATGGTGCTGGGGAAGGAGCCAGTTAGTGTTTCTGTGAGTTTGTGTTGTGATGCAATAAGAGATAAGTA
ATGCAGAGAGAAATGAACCATGGAAAGTAAGAACACTGATGGTGATTCCTCTGCAAAGATGATAAGAAAAAGAACCAATAAATCACACAA
TCTTTATGTGCTTTCTATATGTATTTCTTAGTAGTGATACCATTGATCCTCTTACTTTTTTTACTCCATTAATACTAATAATTATATACT
TTGCTGAGGATCAAAACAGCCAAGAAAGGAATTACTGCTAAAGCATCTAAGATTCTCCTGAACTGTAAAATCAACAGGAAATGGCCACTG
GGAGAGAAGGATTTGGTATTGGGTGAGGGGCTTTCTCCCTTTACCTGCCTCTTCTTGCTTGCTAATAGTAAGTTCTTTGTGCACCTTCCA
CCACTTCTGAGCCACTACTATTCAAGTAGAGATTTGCCCCAACACATTAACTTTTTCCTTGGAGATTTATATGGTCCTGCATTTTGTCCT
GTGCTCACAATGTGAAGTGTCTTCTGTATTCAAATCAAAAAATAATATATTTAAGGTATATAAGTGTGAATCTCCTATAATGATGGAAGA
AGAGGTTCTCTTGTCTTAGATAGAAAAGAGCCTTCTCCAAGAGCAATGTCAAAACTTGGGCTGTCATCTTTGAGCTGTTTACCAAAATAC
AGACCATTATTGAAGAAAAACAAATTATCTATTTTGTTTTCCCCCATCTAACATGATAGTGCCCCCAACCAGGTTGTAGCATTGCCTTTT
AAAAGAGACTCACTCACTCTTAGTTTTTAAGAACTGGAAATTTCCCATCCTCAGATCCCTTAAAGGATGAAGAGTTGGCTGTACACTTAG
CGGACTTGCCTCTTGTATGCAAGGACTACTGATTGAAGTCTGTTTTGCTGTGTCTGGTTATGTTGTCTGCACTTTTATGAAATCACTACA
ATAGGTCTGCATTGGAAATGACTATTAATTTGTAAAGAAGTAAGTTTTATTAAACACTGTCTAGAAAAAGAAAGTGAAGCTGAGAACTCT
TCCTTTATTGTGCATTTATATTTTCTGCTGAATTCCGGTAGTTCCCTTTAAAGTCATGTTGACTAATGTTTTCCTCCTTGTTTGTATTCA
GATTTCCAAAATTTCACTCATACAAGGGAAGAGACTCCATTTAGCTTAACGGTAGTCTTTAGATCATAAGAAATATATAAATTAGTATGC
ACCTTATCTGCCTGTTGTGGGTTTCTTAAACTTGCACTTCCTACCCACCCAAAGATAGATATCCTTTAAAGAAAATAAAGGCAGAGAATT
AAAACTGGGGAGCCATTTACTATGTCACCATCACTGTTAACTGTTTCCCAGCAATCTAAACTTTTTGAAGTTTCAGAGGTGTATTTTTTT
TTTGTATATATGTCTGTGTGATTGTATTGTTTTGTTTCTAAATATACAAGGAATTCTTTAAATAGAGAAAAAGGTTAATCCTCACTGAAA
CACCAGGATGCCCACTGGATATACTAATCTGAACATCTGTAGGTAGTTTGTCATGAAAAAGTGGAGAGAAGATGAGACTTTTGAATGAAT
GAAAAAGGGTATCTTGATACCCAGAATTCCCCCCAAAGTACGGGTAATTCAACCTGCACAGTTTTCTTTCACTCAAAGTGTTCAGCACTT
GTGAGTGAAAAATCATGTAATTATCTGTAAATATGTAGCTAACAAATTGACCTAGTTTCTGTATTTTTTTGTTTTTGTACTAAAGTTTAT
AGGTCTGTGCCAGCTAGAGAGAAGTTGCTGTCATTACCAGTTGTGGTCCTAGCATCTAACCCTGAAACCATCCTAGGTGACATTTTTAGA
ATTAATACTTAAATGTTAAACAGGGGGAAATGAAGCTTAATCATGGTCAGGTTTGAGATCTTTTGCAGTGAAATAATTTTATTTAATATA
AATGATCACATGTCCTCAATCATGAATGAGGTAGGGAGCCTCTCTCCCCCAGTGGCCATGTTTACAAAAGTGTGTTTTGTCTATAAAGTG
CAAGTGTTTTAATGTTTATGTAAATTATGCAGGTGATAACATGGTTTGGAACTGTTTATTGGGCTCTTTAACTGAATTTTCAAATGAAAT
GAACTATGCTTATTGCTGGCACATTGATCCCATTTCTGGAACATTTTTCCTATTTCCAGAGTTACATATGTTCTTTTGTCATTACCCAAT
TTAACCTCCCTTTCTCTGATATGCCTTGTAGCCAAAGTATTAAAGGCTGATGAACATAGACAAGGGAAATGCATTTCTTAGAAATCCGTG
AACCCTCAGTTGTATGCTTTCAGTACTCGTGTTAATATGTTTCTATGGCAACTCTGAGGTCAGTGGTTTAGAAATGAGATACCAGTGTTA
ATGAAAAGTGTGTGCTCTTTGCTTTTGCATGGCTTGGCTTAGTATCCAAGGTATATTAGGGCCACTTGAAAGCATGAAGACCAGTTATAT
AGGGAACAGGTTTCTCTCAGTGGCACATTTTGCTTTTTCTGAGCCCCAAATACATTGCCTGGGCATGAACATTGTTACCGTAAATTGCAC
ATGGTCATGGACTGAATTATGTGACTTTAAAGGATGTAACTGCCCAACATTTGCAGATTCTGGGTGGTCTATGTGACCATTTGTCTCGTA
TCCAAAAACCCCGGGGCTATTGGAACCCTTCCAACACTTTTTCCTTTGTCATAGACAAGTTTATATATAACTTACCAAGATGTTGGCTGT
CCTGGTGTATTGCCAGACAGCTCTCTTTTGGTTCCCATTCCAAATGTGCTGCTGTCCTTCTTTGCATTTCACAATATCAAAGAAACCACC
ACCCTTCTTCCTAACAGCATTTTATGCCTTTTATTCCACATTAAATGGGAATTGTGCCTACTTAGGAGTGCCCCTCCAATTAATTACATG
TGTCCAAGAATAATCCAAGCTAGAGACACAAGGTGGGAAAACATTTCAAAAAAAAAAAGTCCTCTTAAGGCCAGTAATTTATCTGAAAAG
GTATTTTATCACACCTTGACACCTTATATATGAGCCTATTAGGAGCTGCAGGTGGTTTCATAGGGTAAAATCCAAGAAAAGAGAAGGATG
TGTGGGGTTTCTATTAGAAGATAATTTTGTTCTCATTTTACCTTTTCTTTTATGATCCTTCTCTGCTAGAACAGGTTAATTCTCCAAATT
TGTTTTGTTTTGTTTTGTTATTTTTTAGGGAACTCTTTTGCAAAAGCAATGGTCGGATGTAAATAACATTTAAAGTATAGTGCACATAAC
TTCCCCGGACTGTTCCAATCTGATAATTTGTAAATGCTTTAGAGTTTTTTTAATTAACACTTGTGTTGCTAAATTCTATTTATGTAAGTC
TGCTAAAGTTTTTTAGCCCACTTAAAACTTAAGACAACCATTTAAAATAATGGATGGGTTACTATGAGCAATTTCGCTTTCAGAACCCCC
TTGTTTTAGTATATGAAAAAGCCTAATGCGCATTAATGAGGTTGAAGAGACTATGAGAAATATGTATAGTGTATATTTTAAAACAGCTTT
GCTTGTATTGTGAAGATTTAAAAACAAACTTGAGATTTTTAACGTAACTATTAACACAGTTTTAACATAAGTTATCCCACTGGGTTTAAG
AGCATCTTGAATGTATAATCCTTTTTGTAACCCAGGTTGGTTTCTACTTTTACCAGTCACCCAAACATATTTATGTTTTTAGTTTTATGT
ACTCATTTCCCTTTGTTTTCCTCAAACAGCATGATTTTTTTGCACATGTAGAAATTTTTTAAAAGAAAGAAATTAGTACATCATTTTCTC
TGGATTTTCTTCACTTCCCTCTTCCTTTCTACTAACTCCTTCCTTAAAGGCCATATCACTCCATTTGCATTATTTGTGCAAATGCCAGGG
TTGGTTTTTATTTTTATTTTTGCTATTTACCTAAAAAAAGAAAATGCTTCAGTCAATTGCTTTTTTATTTAAAAAAAAAAAGAAAAAAAG
CTGTAACCTTATCATTTCTGAGTAGACCATTGAGCGATGAATGCACACCTGTAGTAGCCCAGGACCAGCTGTGGTGGCTAAAGGGAATAT
GTTAATTAAGCAAGAGGTTCTTTTCTAAAAGTGGTATCTGTTATCCACAATGTATTTTAGTTATTCCCACAAGTCAGGGGTCCAGATAAA
ATGAGGGTTATCAGCTAACTGATATGCTATCATTGAGGTTCATCAATGAATTTGTACATTTCTAGTTCCCTTTGGTGAAGGGAAAAATGA
TGATTTTGCAAGACCTAGATTTTGGCTTGGTTTCTTGCCTCCTTTTTTGGCAGCCTTCATCTTCTCATCTCCCAAACCCCCTGAGCCCGT
AGGGTTTTCATAGTGGACAAAGAACTTGTGGTCTTTTAAAACTGGGACTGATACTTTTTTGAGAGAGTATCGTGTCGAAAGTGTGATGTT
CTACCACTTTACCAATAACTAATTTTAAATACACATTGTCCTCTCGATTTTTGGACCAAACAGACGCTCACAGTGGAGGCTTATCAAGGG
TTGCATTGGGGAAGAAGCCTCTCCCTCTCTGTCAGCACCAGCTGGTAAAGGTGACTGTACAGATGTGCATTTTCCTTTTGGTATAAATGG
TCCACAGCACTAACTGGTAAGGCTTATTGTACAGTATATTGTCAGTATTCTTCTGGTTCAGCATACCTTATAGTTCATATATAACCTGTA
TTAATTGTATAGATTGTGCATTAAAAGCTGTTACCAAGTTGTCAGAACATAAGAGCGAAAACAAGGTCATATGTAATATTTTGTTTGTAA

>In-frame_SPOP_ENST00000393331_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_3231nt
GGGGAGGAGGCCGCGCGGGGTGGGGTCTGGCGGTACGCGCTGGCTGCGTCGACGTGCTGACGCCATGACGCCCCGGCTGGTGTGTGTCGG
TGTGTATGTGTGTGTGTGAGTGTGCGCGCTCCGAGTGTGTGTGTATTTGTGTATCGGCGGTCCCGCAGGTCCCGGATGTTGCGGACAGTA
TGAGGCAAGCGCAGGGGGACGGGGACCAGCAGCTGTCGCCGCCGCTCTCAGATCGAGTCTTGCTCTGTCACCCAGGCTGGAGTGCAGTGG
CGCGATCTCAGCTCACTGCCACCTTTGCCTCCTGGGTTCAAGCGATTCTTCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCTCTGG
GAACCACCCTTCTACTTTCTGTCTCTAGGAATTTCACTACTCTAGGGTGAAGAGGGAACAGAAATCTTTGCCCCCTGACTTTGGAAATCT
CGTTTAACCTTCAAACTGGCGATGTCAAGGGTTCCAAGTCCTCCACCTCCGGCAGAAATGTCGAGTGGCCCCGTAGCTGAGAGTTGGTGC
TACACACAGATCAAGGTAGTGAAATTCTCCTACATGTGGACCATCAATAACTTTAGCTTTTGCCGGGAGGAAATGGGTGAAGTCATTAAA
AGTTCTACATTTTCATCAGGAGCAAATGATAAACTGAAATGGTGTTTGCGAGTAAACCCCAAAGGGTTAGATGAAGAAAGCAAAGATTAC
CTGTCACTTTACCTGTTACTGGTCAGCTGTCCAAAGAGTGAAGTTCGGGCAAAATTCAAATTCTCCATCCTGAATGCCAAGGGAGAAGAA
ACCAAAGCTATGGAGAGTCAACGGGCATATAGGTTTGTGCAAGGCAAAGACTGGGGATTCAAGAAATTCATCCGTAGAGATTTTCTTTTG
GATGAGGCCAACGGGCTTCTCCCTGATGACAAGCTTACCCTCTTCTGCGAGGTGAGTGTTGTGCAAGATTCTGTCAACATTTCTGGCCAG
AATACCATGAACATGGTAAAGGTTCCTGAGTGCCGGCTGGCAGATGAGTTAGGAGGACTGTGGGAGAATTCCCGGTTCACAGACTGCTGC
TTGTGTGTTGCCGGCCAGGAATTCCAGGCTCACAAGGCTATCTTAGCAGCTCGTTCTCCGGTTTTTAGTGCCATGTTTGAACATGAAATG
GAGGAGAGCAAAAAGAATCGAGTTGAAATCAATGATGTGGAGCCTGAAGTTTTTAAGGAAATGATGTGCTTCATTTACACGGGGAAGGCT
CCAAACCTCGACAAAATGGCTGATGATTTGCTGGCAGCTGCTGACAAGTATGCCCTGGAGCGCTTAAAGGTCATGTGTGAGGATGCCCTC
TGCAGTAACCTGTCCGTGGAGAACGCTGCAGAAATTCTCATCCTGGCCGACCTCCACAGTGCAGATCAGTTGAAAACTCAGGCAGTGGAT
TTCATCAACTAATTGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGA
TTGAAGCTTTTGACTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACC
CGGGAGCTTCTGGTTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCC
ATCCAATGCAAGGTGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATA
GCCCCCAGGCTCTGAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATG
GGTCACACATGTCTTATACATAACTTAATAATTGAGAGTGGCAATTCCGCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATC
ACAGCAGCCTCCTCACTTGGGTACTACAGTGTGGAAGCTGAGTGCATATGGTATATTTTATTCATTTTTGTAAAGCGTTCTGTTTTGTGT
TTACTAATTGGGATGTCATAGTACTTGGCTGCCGGGTTTGTTTGTTTTTGGGGAAATTTTGAAAAGTGGAGTTGATATTAAAAATAAATG
TGTATGTGTGTACATATATATACACACACATACACATATATTATGCATGTGGTGAAAAGAATTGGCTAGATAGGGGATTTTTCTGAACAC
TGCAAAAATAGAACGTAGCAAAATGGCTTCAGTTATCACTTTTGGGTGTCTGTATCCTAAGAAGTTTCTGAAAAGATCTAAAGCCTTTTT
ATCCCATATCCCAAATTCTTATGAGCCACTCACAGCAGGCAGCATATGTTGAAATAAGTTATTACTGGTACACACCTGCATTGCCTCACC
AGTGTATTTATTTGTTATTAAATTGATCTGACTTCTCAGCCTCATTTGGACTAAAAAAAGAAAGCAGAAATCCATGAACACATTGCTTCT
CGGCCTTTTGGCTAAGATCAAGTGTAGAAATCCATGAACACTAAAGGACTTCATTGATTTTTTCAGAGAGTAGAAAACAACTTAGTTTTT
CTTTTTTCCTGAATGCGTCATAGGCTTGTGAGTGATTTTTGTCCATTCAATTGTGCCTTCTTTGTATTATGATAAGATGGGGGTACTTAA
GGAGATCACAAGTTGTGTGAGGATTGCATTAACAAACCTATGAGCCTTCAATGGGGAAGACCAGAAGGGTGAGAGGGGCCCTGAAAGTTC
ATATGGTGGGTATGTCCCGCAGCAGAGTGAGGAGATGAAGCTTACGTGTCCTGACGTTTTGTTGCTTATACTGTGATATCTCATCCTAGC
TAAGCTCTATAATGCCCAAGACCCCAAACAGTACTTTTACTTTGTTTGTACAAAAACAAAGACATATAGCCAATACAAATCAAATGCCGG
AGGTGTTTGATGCCATATTTGCAAATTGCCATCTATTGAAATTCTCGTCACACTACATAGACATAATTGTTATCTCCTTTTGGCTTATGT
GATTTTCTGTTTACAAGTAGAATAGCCAATTATTTAAATGTTTAGTTGCCACAGTGAACCAGGAGTCACTGAGCCAATGACTTTACCAGC

>In-frame_SPOP_ENST00000347630_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_3108nt
GGGGAGGAGGCCGCGCGGGGTGGGGTCTGGCGGTACGCGCTGGCTGCGTCGACGTGCTGACGCCATGACGCCCCGGCTGGTGTGTGTCGG
TGTGTATGTGTGTGTGTGAGTGTGCGCGCTCCGAGTGTGTGTGTATTTGTGTATCGGCGGTCCCGCAGGTCCCGGATGTTGCGGACAGTA
TGAGGCAAGCGCAGGGGGACGGGGACCAGCAGCTGTCGCCGCCGCTCTCAGAGATTTCCTGTTAGACAAGACAAATTAGAGTTTTCCTAC
TGACTTAACTTGGGTGAAGAGGGAACAGAAATCTTTGCCCCCTGACTTTGGAAATCTCGTTTAACCTTCAAACTGGCGATGTCAAGGGTT
CCAAGTCCTCCACCTCCGGCAGAAATGTCGAGTGGCCCCGTAGCTGAGAGTTGGTGCTACACACAGATCAAGGTAGTGAAATTCTCCTAC
ATGTGGACCATCAATAACTTTAGCTTTTGCCGGGAGGAAATGGGTGAAGTCATTAAAAGTTCTACATTTTCATCAGGAGCAAATGATAAA
CTGAAATGGTGTTTGCGAGTAAACCCCAAAGGGTTAGATGAAGAAAGCAAAGATTACCTGTCACTTTACCTGTTACTGGTCAGCTGTCCA
AAGAGTGAAGTTCGGGCAAAATTCAAATTCTCCATCCTGAATGCCAAGGGAGAAGAAACCAAAGCTATGGAGAGTCAACGGGCATATAGG
TTTGTGCAAGGCAAAGACTGGGGATTCAAGAAATTCATCCGTAGAGATTTTCTTTTGGATGAGGCCAACGGGCTTCTCCCTGATGACAAG
CTTACCCTCTTCTGCGAGGTGAGTGTTGTGCAAGATTCTGTCAACATTTCTGGCCAGAATACCATGAACATGGTAAAGGTTCCTGAGTGC
CGGCTGGCAGATGAGTTAGGAGGACTGTGGGAGAATTCCCGGTTCACAGACTGCTGCTTGTGTGTTGCCGGCCAGGAATTCCAGGCTCAC
AAGGCTATCTTAGCAGCTCGTTCTCCGGTTTTTAGTGCCATGTTTGAACATGAAATGGAGGAGAGCAAAAAGAATCGAGTTGAAATCAAT
GATGTGGAGCCTGAAGTTTTTAAGGAAATGATGTGCTTCATTTACACGGGGAAGGCTCCAAACCTCGACAAAATGGCTGATGATTTGCTG
GCAGCTGCTGACAAGTATGCCCTGGAGCGCTTAAAGGTCATGTGTGAGGATGCCCTCTGCAGTAACCTGTCCGTGGAGAACGCTGCAGAA
ATTCTCATCCTGGCCGACCTCCACAGTGCAGATCAGTTGAAAACTCAGGCAGTGGATTTCATCAACTAATTGAAGAAGAGATGTTGGCTT
TGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTTGACTCTGAAAGCATGAGACTAG
GTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCTGGTTGGTCACACAACCCTACTG
GGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAAGGTGGACCCCAGCCATGGGGTC
ACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCTCTGAGGCGGACAGCTTCTGGGG
GACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATGTCTTATACATAACTTAATAATT
GAGAGTGGCAATTCCGCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATCACAGCAGCCTCCTCACTTGGGTACTACAGTGTG
GAAGCTGAGTGCATATGGTATATTTTATTCATTTTTGTAAAGCGTTCTGTTTTGTGTTTACTAATTGGGATGTCATAGTACTTGGCTGCC
GGGTTTGTTTGTTTTTGGGGAAATTTTGAAAAGTGGAGTTGATATTAAAAATAAATGTGTATGTGTGTACATATATATACACACACATAC
ACATATATTATGCATGTGGTGAAAAGAATTGGCTAGATAGGGGATTTTTCTGAACACTGCAAAAATAGAACGTAGCAAAATGGCTTCAGT
TATCACTTTTGGGTGTCTGTATCCTAAGAAGTTTCTGAAAAGATCTAAAGCCTTTTTATCCCATATCCCAAATTCTTATGAGCCACTCAC
AGCAGGCAGCATATGTTGAAATAAGTTATTACTGGTACACACCTGCATTGCCTCACCAGTGTATTTATTTGTTATTAAATTGATCTGACT
TCTCAGCCTCATTTGGACTAAAAAAAGAAAGCAGAAATCCATGAACACATTGCTTCTCGGCCTTTTGGCTAAGATCAAGTGTAGAAATCC
ATGAACACTAAAGGACTTCATTGATTTTTTCAGAGAGTAGAAAACAACTTAGTTTTTCTTTTTTCCTGAATGCGTCATAGGCTTGTGAGT
GATTTTTGTCCATTCAATTGTGCCTTCTTTGTATTATGATAAGATGGGGGTACTTAAGGAGATCACAAGTTGTGTGAGGATTGCATTAAC
AAACCTATGAGCCTTCAATGGGGAAGACCAGAAGGGTGAGAGGGGCCCTGAAAGTTCATATGGTGGGTATGTCCCGCAGCAGAGTGAGGA
GATGAAGCTTACGTGTCCTGACGTTTTGTTGCTTATACTGTGATATCTCATCCTAGCTAAGCTCTATAATGCCCAAGACCCCAAACAGTA
CTTTTACTTTGTTTGTACAAAAACAAAGACATATAGCCAATACAAATCAAATGCCGGAGGTGTTTGATGCCATATTTGCAAATTGCCATC
TATTGAAATTCTCGTCACACTACATAGACATAATTGTTATCTCCTTTTGGCTTATGTGATTTTCTGTTTACAAGTAGAATAGCCAATTAT
TTAAATGTTTAGTTGCCACAGTGAACCAGGAGTCACTGAGCCAATGACTTTACCAGCTGCTGACTAATCTTCATCACCACTGTAGATTTT

>In-frame_SPOP_ENST00000504102_chr17_47679227_-_TAOK1_ENST00000536202_chr17_27869579_+_3128nt
AAGATAGGCGGAGTCTTGAGGGAGGAGGAGCAGGGAAACCCAGGGAGGGGAGGGGAGGAGAAGGGAGTAATGGGGAGGAGGCCGCGCGGG
GTGGGGTCTGGCGGTACGCGCTGGCTGCGTCGACGTGCTGACGCCATGACGCCCCGGCTGGTGTGTGTCGGTGTGTATGTGTGTGTGTGA
GTGTGCGCGCTCCGAGTGTGTGTGTATTTGTGTATCGGCGGTCCCGCAGGTCCCGGATGTTGCGGACAGTATGAGGCAAGCGCAGGGGGA
CGGGGACCAGCAGCTGTCGCCGCCGCTCTCAGGGTGAAGAGGGAACAGAAATCTTTGCCCCCTGACTTTGGAAATCTCGTTTAACCTTCA
AACTGGCGATGTCAAGGGTTCCAAGTCCTCCACCTCCGGCAGAAATGTCGAGTGGCCCCGTAGCTGAGAGTTGGTGCTACACACAGATCA
AGGTAGTGAAATTCTCCTACATGTGGACCATCAATAACTTTAGCTTTTGCCGGGAGGAAATGGGTGAAGTCATTAAAAGTTCTACATTTT
CATCAGGAGCAAATGATAAACTGAAATGGTGTTTGCGAGTAAACCCCAAAGGGTTAGATGAAGAAAGCAAAGATTACCTGTCACTTTACC
TGTTACTGGTCAGCTGTCCAAAGAGTGAAGTTCGGGCAAAATTCAAATTCTCCATCCTGAATGCCAAGGGAGAAGAAACCAAAGCTATGG
AGAGTCAACGGGCATATAGGTTTGTGCAAGGCAAAGACTGGGGATTCAAGAAATTCATCCGTAGAGATTTTCTTTTGGATGAGGCCAACG
GGCTTCTCCCTGATGACAAGCTTACCCTCTTCTGCGAGGTGAGTGTTGTGCAAGATTCTGTCAACATTTCTGGCCAGAATACCATGAACA
TGGTAAAGGTTCCTGAGTGCCGGCTGGCAGATGAGTTAGGAGGACTGTGGGAGAATTCCCGGTTCACAGACTGCTGCTTGTGTGTTGCCG
GCCAGGAATTCCAGGCTCACAAGGCTATCTTAGCAGCTCGTTCTCCGGTTTTTAGTGCCATGTTTGAACATGAAATGGAGGAGAGCAAAA
AGAATCGAGTTGAAATCAATGATGTGGAGCCTGAAGTTTTTAAGGAAATGATGTGCTTCATTTACACGGGGAAGGCTCCAAACCTCGACA
AAATGGCTGATGATTTGCTGGCAGCTGCTGACAAGTATGCCCTGGAGCGCTTAAAGGTCATGTGTGAGGATGCCCTCTGCAGTAACCTGT
CCGTGGAGAACGCTGCAGAAATTCTCATCCTGGCCGACCTCCACAGTGCAGATCAGTTGAAAACTCAGGCAGTGGATTTCATCAACTAAT
TGAAGAAGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTTGA
CTCTGAAAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCTGG
TTGGTCACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAAGG
TGGACCCCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCTCT
GAGGCGGACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATGTC
TTATACATAACTTAATAATTGAGAGTGGCAATTCCGCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATCACAGCAGCCTCCT
CACTTGGGTACTACAGTGTGGAAGCTGAGTGCATATGGTATATTTTATTCATTTTTGTAAAGCGTTCTGTTTTGTGTTTACTAATTGGGA
TGTCATAGTACTTGGCTGCCGGGTTTGTTTGTTTTTGGGGAAATTTTGAAAAGTGGAGTTGATATTAAAAATAAATGTGTATGTGTGTAC
ATATATATACACACACATACACATATATTATGCATGTGGTGAAAAGAATTGGCTAGATAGGGGATTTTTCTGAACACTGCAAAAATAGAA
CGTAGCAAAATGGCTTCAGTTATCACTTTTGGGTGTCTGTATCCTAAGAAGTTTCTGAAAAGATCTAAAGCCTTTTTATCCCATATCCCA
AATTCTTATGAGCCACTCACAGCAGGCAGCATATGTTGAAATAAGTTATTACTGGTACACACCTGCATTGCCTCACCAGTGTATTTATTT
GTTATTAAATTGATCTGACTTCTCAGCCTCATTTGGACTAAAAAAAGAAAGCAGAAATCCATGAACACATTGCTTCTCGGCCTTTTGGCT
AAGATCAAGTGTAGAAATCCATGAACACTAAAGGACTTCATTGATTTTTTCAGAGAGTAGAAAACAACTTAGTTTTTCTTTTTTCCTGAA
TGCGTCATAGGCTTGTGAGTGATTTTTGTCCATTCAATTGTGCCTTCTTTGTATTATGATAAGATGGGGGTACTTAAGGAGATCACAAGT
TGTGTGAGGATTGCATTAACAAACCTATGAGCCTTCAATGGGGAAGACCAGAAGGGTGAGAGGGGCCCTGAAAGTTCATATGGTGGGTAT
GTCCCGCAGCAGAGTGAGGAGATGAAGCTTACGTGTCCTGACGTTTTGTTGCTTATACTGTGATATCTCATCCTAGCTAAGCTCTATAAT
GCCCAAGACCCCAAACAGTACTTTTACTTTGTTTGTACAAAAACAAAGACATATAGCCAATACAAATCAAATGCCGGAGGTGTTTGATGC
CATATTTGCAAATTGCCATCTATTGAAATTCTCGTCACACTACATAGACATAATTGTTATCTCCTTTTGGCTTATGTGATTTTCTGTTTA
CAAGTAGAATAGCCAATTATTTAAATGTTTAGTTGCCACAGTGAACCAGGAGTCACTGAGCCAATGACTTTACCAGCTGCTGACTAATCT

>In-frame_SPOP_ENST00000503676_chr17_47679227_-_TAOK1_ENST00000261716_chr17_27869579_+_10956nt
ATATAGCTTAAAGCATTTAACTGGAAAGGACCTTGGAAATCCTTTTAAAGGAGGATGGGGGTGGAAATGCACAGGTTGCTTCTCTCTCTC
TCTCTCTTTTTTTTTTTTTTTGAGACGGTCACCCAGGCTGTAGTGCAGTGGCGTGATCTCGGCTCACTGTGGCCTCCACCTCCCAAGTAG
CTGGGATTACAGGCTTGCGCCATCATGCAGGGCTAATTTTTGTATTTTTAGTAGAGACGAGGTTTCATCATGTTGGCCAGGCTGGTCTGG
AACTCCTGACCTCAAGTGATCTGCCCACCTTGGCCTCCCAAAGTGCTGGGATTAAAGGCATGAGCCACCACGCCTGGCCTAGGTTGTTCC
TCTACTGTGAATCTTGAGGTTATGGTTTCCACTAGACTATAGTGCTCAACTATAGTGGCCTATTTTAAGTGGCCTTATAATTCCTAACCA
AAGTGACTTGTGAAACAGAGGACCCTGGATAAATTTAAATGTTATAAAGATGATAAAATGTACAGAGATTTCCTGTTAGACAAGACAAAT
TAGAGTTTTCCTACTGACTTAACTTGGGTGAAGAGGGAACAGAAATCTTTGCCCCCTGACTTTGGAAATCTCGTTTAACCTTCAAACTGG
CGATGTCAAGGGTTCCAAGTCCTCCACCTCCGGCAGAAATGTCGAGTGGCCCCGTAGCTGAGAGTTGGTGCTACACACAGATCAAGGTAG
TGAAATTCTCCTACATGTGGACCATCAATAACTTTAGCTTTTGCCGGGAGGAAATGGGTGAAGTCATTAAAAGTTCTACATTTTCATCAG
GAGCAAATGATAAACTGAAATGGTGTTTGCGAGTAAACCCCAAAGGGTTAGATGAAGAAAGCAAAGATTACCTGTCACTTTACCTGTTAC
TGGTCAGCTGTCCAAAGAGTGAAGTTCGGGCAAAATTCAAATTCTCCATCCTGAATGCCAAGGGAGAAGAAACCAAAGCTATGGAGAGTC
AACGGGCATATAGGTTTGTGCAAGGCAAAGACTGGGGATTCAAGAAATTCATCCGTAGAGATTTTCTTTTGGATGAGGCCAACGGGCTTC
TCCCTGATGACAAGCTTACCCTCTTCTGCGAGGTGAGTGTTGTGCAAGATTCTGTCAACATTTCTGGCCAGAATACCATGAACATGGTAA
AGGTTCCTGAGTGCCGGCTGGCAGATGAGTTAGGAGGACTGTGGGAGAATTCCCGGTTCACAGACTGCTGCTTGTGTGTTGCCGGCCAGG
AATTCCAGGCTCACAAGGCTATCTTAGCAGCTCGTTCTCCGGTTTTTAGTGCCATGTTTGAACATGAAATGGAGGAGAGCAAAAAGAATC
GAGTTGAAATCAATGATGTGGAGCCTGAAGTTTTTAAGGAAATGATGTGCTTCATTTACACGGGGAAGGCTCCAAACCTCGACAAAATGG
CTGATGATTTGCTGGCAGCTGCTGACAAGTATGCCCTGGAGCGCTTAAAGGTCATGTGTGAGGATGCCCTCTGCAGTAACCTGTCCGTGG
AGAACGCTGCAGAAATTCTCATCCTGGCCGACCTCCACAGTGCAGATCAGTTGAAAACTCAGGCAGTGGATTTCATCAACTAATTGAAGA
AGAGATGTTGGCTTTGCAGAATGAGCGCACAGAACGAATACGAAGCCTGTTGGAACGTCAAGCCAGAGAGATTGAAGCTTTTGACTCTGA
AAGCATGAGACTAGGTTTTAGTAATATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCGGGAGCTTCTGGTTGGTC
ACACAACCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCCCACCACAAGCTTGGGGCCATCCAATGCAAGGTGGACC
CCAGCCATGGGGTCACCCTTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCTCTGAGGCG
GACAGCTTCTGGGGGACGGACGGAGCAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATGTCTTATAC
ATAACTTAATAATTGAGAGTGGCAATTCCGCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATCACAGCAGCCTCCTCACTTG
GGTACTACAGTGTGGAAGCTGAGTGCATATGGTATATTTTATTCATTTTTGTAAAGCGTTCTGTTTTGTGTTTACTAATTGGGATGTCAT
AGTACTTGGCTGCCGGGTTTGTTTGTTTTTGGGGAAATTTTGAAAAGTGGAGTTGATATTAAAAATAAATGTGTATGTGTGTACATATAT
ATACACACACATACACATATATTATGCATGTGGTGAAAAGAATTGGCTAGATAGGGGATTTTTCTGAACACTGCAAAAATAGAACGTAGC
AAAATGGCTTCAGTTATCACTTTTGGGTGTCTGTATCCTAAGAAGTTTCTGAAAAGATCTAAAGCCTTTTTATCCCATATCCCAAATTCT
TATGAGCCACTCACAGCAGGCAGCATATGTTGAAATAAGTTATTACTGGTACACACCTGCATTGCCTCACCAGTGTATTTATTTGTTATT
AAATTGATCTGACTTCTCAGCCTCATTTGGACTAAAAAAAGAAAGCAGAAATCCATGAACACATTGCTTCTCGGCCTTTTGGCTAAGATC
AAGTGTAGAAATCCATGAACACTAAAGGACTTCATTGATTTTTTCAGAGAGTAGAAAACAACTTAGTTTTTCTTTTTTCCTGAATGCGTC
ATAGGCTTGTGAGTGATTTTTGTCCATTCAATTGTGCCTTCTTTGTATTATGATAAGATGGGGGTACTTAAGGAGATCACAAGTTGTGTG
AGGATTGCATTAACAAACCTATGAGCCTTCAATGGGGAAGACCAGAAGGGTGAGAGGGGCCCTGAAAGTTCATATGGTGGGTATGTCCCG
CAGCAGAGTGAGGAGATGAAGCTTACGTGTCCTGACGTTTTGTTGCTTATACTGTGATATCTCATCCTAGCTAAGCTCTATAATGCCCAA
GACCCCAAACAGTACTTTTACTTTGTTTGTACAAAAACAAAGACATATAGCCAATACAAATCAAATGCCGGAGGTGTTTGATGCCATATT
TGCAAATTGCCATCTATTGAAATTCTCGTCACACTACATAGACATAATTGTTATCTCCTTTTGGCTTATGTGATTTTCTGTTTACAAGTA
GAATAGCCAATTATTTAAATGTTTAGTTGCCACAGTGAACCAGGAGTCACTGAGCCAATGACTTTACCAGCTGCTGACTAATCTTCATCA
CCACTGTAGATTTTGCTGCATGTGCAGGTCCTCTATTTTTAATTGCTGTTTTCGTTGCTGCAGTACTTTACAAACTTCTAGTTCGTTGAG
ACTTAGTGACCATTTGGCATCAAGTTAACATCACACAATAGGAAACACCACTTCCACAAGTCTCAAGCCTCAGTGCTAAAGTACTACTGA
AAAGGAACTAGGAAGTTTGGCCAATTAAAAAAAAAAAGTAAAATAAGTTATAGTGGTCAGGGAATCTCTTGACGAAAGCTAACTCTTATT
TTTCAGGGGGCACATGTTTTGTTTTGTTATGTTTTGTTGTACAATGAAGGATGAACCCAATGCTAAAAAGTCAGTTATTTTCTTGGTTTT
CCATTTCTTGTATATAAATTGTGTTGGAGGTGGGTAGGAAGCTGTGAGTATGACTTGAAGAAAAATATCCTTTTCAGTGACAAATCAGAG
TTTCTTACAAGTTATTGTCCTGCTCCCTTCCAAGTTGTCTTGAAGAATCCTTGCTGCTAACTCTGGATCCTGCTTTTCCTATAGTCAGAG
GGCTCCAAGGTAGAACTCTCTAAGTCCCTCTCAATGGCACTCTTTGCCTAGACCAAACTAATGACCAAACAGTAATCAATCTATCACTGT
TGAAGTCCTGGTTTTCTCAACCAAATTTTAAGTCTTTCCCAGGTATGTCAGTCGAGTTGCCATGAATCCTCACCTGTAGGAGTTTCTGGG
ATTCATTTTAAGGAAACTGGAAGAAAATTAATGTTTTAATGTAAATGTTTTTAAAACCAAGATCACCATAGAGTTCACACAAAATTTTAG
GCAGTGTTTCAAGAAGCACTCTTATGTGTTGTTCTTTCAGCCCATGCTCCAGGTCACCGGTTTTTAGGTAAACATGACATGACATGTACT
TGTAATATCAGTGAAAGGGGCTTTTAGTCGTCTCAGTATCTTTTTTGCATTCAGGTATTATAGCGTTTCCAACAAATTGAGAAATTACTT
ATTTGGTGTAAAATGACGAGAGAGCTTTAGAATTTAATAAAATGTCAAAAATACAATTTGATACCCTTAAAAATTATTCATAGATCTGGC
TGCTCTGTACTACTGGATGGGTGGAATAGGGAAGCAGATCACTTTTGCATACAAAAACTCTTTCAAACCCAAAATATTATTGGTGGTACA
TTTTAAAGTCCAATTGTGGACTTAAATTAGTCAAATTGAGAGTTACTGAGTCCATTCAGATCTCCAGTAGGGTTTTGTATCTAATGTATT
TGGCCACCAGTTTTACATGTAGGTCATGACTATACCTGGATTTTATCATTAAGTTAACTTTAAAGTATATACAGTTTGCAAAAAATGATT
CAAATTAATTGGTTTGTATATGTTTGTGAGATCTAGCTTCTGAGGAATCTCATACATAGTAGGAACCATCATAGAGTAAAGCTTGTAGCA
GAAAAATTGGAAGGGTTTTGAGATATCCTAGAGAAAGAGCAAGCACTTTCTGAATCAGTGGGGAAATATCAATATTTGATCAAATTAACA
CTACCTCCTTCCCAGTGTTGGTGTTCACTCACTATATGTCTTTAAGAAAATTAAAACTATGGAAAATTTGTCTAGCATATCAGAAGTTGT
AAATGCTATATCTGGTATCCAGAGGCTGGCTGTAAAAAGTTCCTTGGGGTCACTCTATCTCACATTTTTTTTGGTTAGCATTTTAAAAAT
GCAAAGCCACATACTTTGAAATATATTATTCCAAATTGAGCTCCCTTCCCTTTGCACATATTTTTTCCTCCCCTTATTGAAGTCAGCTCT
AACCCCAAATTCTAGTATCCAAAAGTATTTTTATTTGTATAATGCTATCTGAAAAATGTGTTTATATTATATTTTCAGAGCTGCAATTCT
TATTCGCCATTTCAATACCTAGAGATAGAGAGTCTTGTATTTGAAGCCACACACACTGGTGTAATATGCTTAGTACTCTAGGTCAAGGAT
TTGTTGGTAAATGGAACATTTTAGCATAGTCATGATTTTTGGTTGCCTAGACATCAGGTAAACATTCAGTACACTAAAGAAACTATCCTG
GACACTCCCTCCTGCTTCCACCAATTTTTTTCTCACCCCCTTTTCAAAAATTGAAAACTCTATGAGTGTCTTTTTGAGACCATAAAGCAG
ACTTTAGTAACTTTCTATTTCTGTAAGTACTAAATGTCTGGCATTTTAAACTTTTGTAGAATACATTATGTTGGACACTGGAATAATACT
ATTTATTTTCACCTGTGAAAAATGACTTCATTGTACTTGAAACACCTCCTTTGCATTTCTCCATTTGTGCCATTCACTAGTGGAAATAAA
TTGTATTATACCATGATCTACTGGCTTTTTAAAACTGTATTAAATATGCACATTTTTGGTATAGCTATTATCATTTGTATGTATATATTG
TATATACATATGAGTGTCTGTATGTGTGTATAGATGGATGGATGTAACTCATACTGTACATTTCCATCAGGGCACTTAAAAGTTCTGTTA
TTTTTGTTTGGTTTTGTTATTTCAGTCCTCAGTTAAGGCAAGAATGCATGTGTTTCTTAAGAATGAGTACTCTGCGTTGATGTTTATGAG
AAGGTGGTCATTAGATGCAGTCTTTTCCTTTTTAATCCCCTCTTAGCACTTCTGTGAGTGGAGAGGACATTAAGTAAAATTTGGAATCAT
AAGTTGCAATGCAGTAAAATGGTGCTGGGGAAGGAGCCAGTTAGTGTTTCTGTGAGTTTGTGTTGTGATGCAATAAGAGATAAGTAATGC
AGAGAGAAATGAACCATGGAAAGTAAGAACACTGATGGTGATTCCTCTGCAAAGATGATAAGAAAAAGAACCAATAAATCACACAATCTT
TATGTGCTTTCTATATGTATTTCTTAGTAGTGATACCATTGATCCTCTTACTTTTTTTACTCCATTAATACTAATAATTATATACTTTGC
TGAGGATCAAAACAGCCAAGAAAGGAATTACTGCTAAAGCATCTAAGATTCTCCTGAACTGTAAAATCAACAGGAAATGGCCACTGGGAG
AGAAGGATTTGGTATTGGGTGAGGGGCTTTCTCCCTTTACCTGCCTCTTCTTGCTTGCTAATAGTAAGTTCTTTGTGCACCTTCCACCAC
TTCTGAGCCACTACTATTCAAGTAGAGATTTGCCCCAACACATTAACTTTTTCCTTGGAGATTTATATGGTCCTGCATTTTGTCCTGTGC
TCACAATGTGAAGTGTCTTCTGTATTCAAATCAAAAAATAATATATTTAAGGTATATAAGTGTGAATCTCCTATAATGATGGAAGAAGAG
GTTCTCTTGTCTTAGATAGAAAAGAGCCTTCTCCAAGAGCAATGTCAAAACTTGGGCTGTCATCTTTGAGCTGTTTACCAAAATACAGAC
CATTATTGAAGAAAAACAAATTATCTATTTTGTTTTCCCCCATCTAACATGATAGTGCCCCCAACCAGGTTGTAGCATTGCCTTTTAAAA
GAGACTCACTCACTCTTAGTTTTTAAGAACTGGAAATTTCCCATCCTCAGATCCCTTAAAGGATGAAGAGTTGGCTGTACACTTAGCGGA
CTTGCCTCTTGTATGCAAGGACTACTGATTGAAGTCTGTTTTGCTGTGTCTGGTTATGTTGTCTGCACTTTTATGAAATCACTACAATAG
GTCTGCATTGGAAATGACTATTAATTTGTAAAGAAGTAAGTTTTATTAAACACTGTCTAGAAAAAGAAAGTGAAGCTGAGAACTCTTCCT
TTATTGTGCATTTATATTTTCTGCTGAATTCCGGTAGTTCCCTTTAAAGTCATGTTGACTAATGTTTTCCTCCTTGTTTGTATTCAGATT
TCCAAAATTTCACTCATACAAGGGAAGAGACTCCATTTAGCTTAACGGTAGTCTTTAGATCATAAGAAATATATAAATTAGTATGCACCT
TATCTGCCTGTTGTGGGTTTCTTAAACTTGCACTTCCTACCCACCCAAAGATAGATATCCTTTAAAGAAAATAAAGGCAGAGAATTAAAA
CTGGGGAGCCATTTACTATGTCACCATCACTGTTAACTGTTTCCCAGCAATCTAAACTTTTTGAAGTTTCAGAGGTGTATTTTTTTTTTG
TATATATGTCTGTGTGATTGTATTGTTTTGTTTCTAAATATACAAGGAATTCTTTAAATAGAGAAAAAGGTTAATCCTCACTGAAACACC
AGGATGCCCACTGGATATACTAATCTGAACATCTGTAGGTAGTTTGTCATGAAAAAGTGGAGAGAAGATGAGACTTTTGAATGAATGAAA
AAGGGTATCTTGATACCCAGAATTCCCCCCAAAGTACGGGTAATTCAACCTGCACAGTTTTCTTTCACTCAAAGTGTTCAGCACTTGTGA
GTGAAAAATCATGTAATTATCTGTAAATATGTAGCTAACAAATTGACCTAGTTTCTGTATTTTTTTGTTTTTGTACTAAAGTTTATAGGT
CTGTGCCAGCTAGAGAGAAGTTGCTGTCATTACCAGTTGTGGTCCTAGCATCTAACCCTGAAACCATCCTAGGTGACATTTTTAGAATTA
ATACTTAAATGTTAAACAGGGGGAAATGAAGCTTAATCATGGTCAGGTTTGAGATCTTTTGCAGTGAAATAATTTTATTTAATATAAATG
ATCACATGTCCTCAATCATGAATGAGGTAGGGAGCCTCTCTCCCCCAGTGGCCATGTTTACAAAAGTGTGTTTTGTCTATAAAGTGCAAG
TGTTTTAATGTTTATGTAAATTATGCAGGTGATAACATGGTTTGGAACTGTTTATTGGGCTCTTTAACTGAATTTTCAAATGAAATGAAC
TATGCTTATTGCTGGCACATTGATCCCATTTCTGGAACATTTTTCCTATTTCCAGAGTTACATATGTTCTTTTGTCATTACCCAATTTAA
CCTCCCTTTCTCTGATATGCCTTGTAGCCAAAGTATTAAAGGCTGATGAACATAGACAAGGGAAATGCATTTCTTAGAAATCCGTGAACC
CTCAGTTGTATGCTTTCAGTACTCGTGTTAATATGTTTCTATGGCAACTCTGAGGTCAGTGGTTTAGAAATGAGATACCAGTGTTAATGA
AAAGTGTGTGCTCTTTGCTTTTGCATGGCTTGGCTTAGTATCCAAGGTATATTAGGGCCACTTGAAAGCATGAAGACCAGTTATATAGGG
AACAGGTTTCTCTCAGTGGCACATTTTGCTTTTTCTGAGCCCCAAATACATTGCCTGGGCATGAACATTGTTACCGTAAATTGCACATGG
TCATGGACTGAATTATGTGACTTTAAAGGATGTAACTGCCCAACATTTGCAGATTCTGGGTGGTCTATGTGACCATTTGTCTCGTATCCA
AAAACCCCGGGGCTATTGGAACCCTTCCAACACTTTTTCCTTTGTCATAGACAAGTTTATATATAACTTACCAAGATGTTGGCTGTCCTG
GTGTATTGCCAGACAGCTCTCTTTTGGTTCCCATTCCAAATGTGCTGCTGTCCTTCTTTGCATTTCACAATATCAAAGAAACCACCACCC
TTCTTCCTAACAGCATTTTATGCCTTTTATTCCACATTAAATGGGAATTGTGCCTACTTAGGAGTGCCCCTCCAATTAATTACATGTGTC
CAAGAATAATCCAAGCTAGAGACACAAGGTGGGAAAACATTTCAAAAAAAAAAAGTCCTCTTAAGGCCAGTAATTTATCTGAAAAGGTAT
TTTATCACACCTTGACACCTTATATATGAGCCTATTAGGAGCTGCAGGTGGTTTCATAGGGTAAAATCCAAGAAAAGAGAAGGATGTGTG
GGGTTTCTATTAGAAGATAATTTTGTTCTCATTTTACCTTTTCTTTTATGATCCTTCTCTGCTAGAACAGGTTAATTCTCCAAATTTGTT
TTGTTTTGTTTTGTTATTTTTTAGGGAACTCTTTTGCAAAAGCAATGGTCGGATGTAAATAACATTTAAAGTATAGTGCACATAACTTCC
CCGGACTGTTCCAATCTGATAATTTGTAAATGCTTTAGAGTTTTTTTAATTAACACTTGTGTTGCTAAATTCTATTTATGTAAGTCTGCT
AAAGTTTTTTAGCCCACTTAAAACTTAAGACAACCATTTAAAATAATGGATGGGTTACTATGAGCAATTTCGCTTTCAGAACCCCCTTGT
TTTAGTATATGAAAAAGCCTAATGCGCATTAATGAGGTTGAAGAGACTATGAGAAATATGTATAGTGTATATTTTAAAACAGCTTTGCTT
GTATTGTGAAGATTTAAAAACAAACTTGAGATTTTTAACGTAACTATTAACACAGTTTTAACATAAGTTATCCCACTGGGTTTAAGAGCA
TCTTGAATGTATAATCCTTTTTGTAACCCAGGTTGGTTTCTACTTTTACCAGTCACCCAAACATATTTATGTTTTTAGTTTTATGTACTC
ATTTCCCTTTGTTTTCCTCAAACAGCATGATTTTTTTGCACATGTAGAAATTTTTTAAAAGAAAGAAATTAGTACATCATTTTCTCTGGA
TTTTCTTCACTTCCCTCTTCCTTTCTACTAACTCCTTCCTTAAAGGCCATATCACTCCATTTGCATTATTTGTGCAAATGCCAGGGTTGG
TTTTTATTTTTATTTTTGCTATTTACCTAAAAAAAGAAAATGCTTCAGTCAATTGCTTTTTTATTTAAAAAAAAAAAGAAAAAAAGCTGT
AACCTTATCATTTCTGAGTAGACCATTGAGCGATGAATGCACACCTGTAGTAGCCCAGGACCAGCTGTGGTGGCTAAAGGGAATATGTTA
ATTAAGCAAGAGGTTCTTTTCTAAAAGTGGTATCTGTTATCCACAATGTATTTTAGTTATTCCCACAAGTCAGGGGTCCAGATAAAATGA
GGGTTATCAGCTAACTGATATGCTATCATTGAGGTTCATCAATGAATTTGTACATTTCTAGTTCCCTTTGGTGAAGGGAAAAATGATGAT
TTTGCAAGACCTAGATTTTGGCTTGGTTTCTTGCCTCCTTTTTTGGCAGCCTTCATCTTCTCATCTCCCAAACCCCCTGAGCCCGTAGGG
TTTTCATAGTGGACAAAGAACTTGTGGTCTTTTAAAACTGGGACTGATACTTTTTTGAGAGAGTATCGTGTCGAAAGTGTGATGTTCTAC
CACTTTACCAATAACTAATTTTAAATACACATTGTCCTCTCGATTTTTGGACCAAACAGACGCTCACAGTGGAGGCTTATCAAGGGTTGC
ATTGGGGAAGAAGCCTCTCCCTCTCTGTCAGCACCAGCTGGTAAAGGTGACTGTACAGATGTGCATTTTCCTTTTGGTATAAATGGTCCA
CAGCACTAACTGGTAAGGCTTATTGTACAGTATATTGTCAGTATTCTTCTGGTTCAGCATACCTTATAGTTCATATATAACCTGTATTAA
TTGTATAGATTGTGCATTAAAAGCTGTTACCAAGTTGTCAGAACATAAGAGCGAAAACAAGGTCATATGTAATATTTTGTTTGTAAGTAT


Top

FusionGenePPI for SPOP_TAOK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SPOPZBTB16, DPPA2, RXRB, DDIT3, RTN3, MYD88, SIRT2, DOK2, KPNA6, GDI1, PIP5K1B, TRAF1, TRAF6, AR, BMI1, NCOA3, CUL3, ESR1, DAXX, SPOP, PIP4K2B, UBE2E3, FADD, PIAS1, GIT2, SRRM1, ATM, GLI2, DEK, BRMS1, NUP50, RTN4, GCC1, ERG, ERF, PGR, GLI3, UBE2D1, UBE2D2, NANOG, PTEN, DUSP7, EGLN2, RFWD2, SOST, ARIH1, MSRB3, BRD4, BRD3, BRD2TAOK1STK4, CSNK1E, DYNC1I1, GEMIN7, WT1, C8orf33, SRBD1, MAP3K7, STK25, STK26, NTRK1, SNW1, FAM206A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SPOP_TAOK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SPOP_TAOK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSPOPC0014170Endometrial Neoplasms1CTD_human
HgeneSPOPC0033578Prostatic Neoplasms1CTD_human
TgeneTAOK1C0018781Noise-induced hearing loss1CTD_human