FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35652

FusionGeneSummary for SPEN_PLEKHM2

check button Fusion gene summary
Fusion gene informationFusion gene name: SPEN_PLEKHM2
Fusion gene ID: 35652
HgeneTgene
Gene symbol

SPEN

PLEKHM2

Gene ID

64783

23207

Gene nameRNA binding motif protein 15pleckstrin homology and RUN domain containing M2
SynonymsOTT|OTT1|SPENSKIP
Cytomap

1p13.3

1p36.21

Type of geneprotein-codingprotein-coding
Descriptionputative RNA-binding protein 15one twenty two proteinone twenty-twoone-twenty two protein 1pleckstrin homology domain-containing family M member 2PH domain-containing family M member 2SifA (Salmonella-induced filaments A) and kinesin-interacting proteinnovel RUN and PH domain-containing proteinpleckstrin homology domain containing, family M
Modification date2018052320180523
UniProtAcc

Q96T58

Q8IWE5

Ensembl transtripts involved in fusion geneENST00000375759, ENST00000471538, 
ENST00000375799, ENST00000375793, 
ENST00000477849, 
Fusion gene scores* DoF score15 X 10 X 12=18001 X 2 X 2=4
# samples 222
** MAII scorelog2(22/1800*10)=-3.03242147769238
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: SPEN [Title/Abstract] AND PLEKHM2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSPEN

GO:0045892

negative regulation of transcription, DNA-templated

16129689

TgenePLEKHM2

GO:1903527

positive regulation of membrane tubulation

18996344


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-VS-A959-01ASPENchr1

16203173

+PLEKHM2chr1

16042732

+
TCGARVSARCTCGA-LI-A9QH-01ASPENchr1

16203173

+PLEKHM2chr1

16060292

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000375759ENST00000375799SPENchr1

16203173

+PLEKHM2chr1

16042732

+
Frame-shiftENST00000375759ENST00000375793SPENchr1

16203173

+PLEKHM2chr1

16042732

+
5CDS-intronENST00000375759ENST00000477849SPENchr1

16203173

+PLEKHM2chr1

16042732

+
3UTR-3CDSENST00000471538ENST00000375799SPENchr1

16203173

+PLEKHM2chr1

16042732

+
3UTR-3CDSENST00000471538ENST00000375793SPENchr1

16203173

+PLEKHM2chr1

16042732

+
3UTR-intronENST00000471538ENST00000477849SPENchr1

16203173

+PLEKHM2chr1

16042732

+
In-frameENST00000375759ENST00000375799SPENchr1

16203173

+PLEKHM2chr1

16060292

+
In-frameENST00000375759ENST00000375793SPENchr1

16203173

+PLEKHM2chr1

16060292

+
5CDS-3UTRENST00000375759ENST00000477849SPENchr1

16203173

+PLEKHM2chr1

16060292

+
3UTR-3CDSENST00000471538ENST00000375799SPENchr1

16203173

+PLEKHM2chr1

16060292

+
3UTR-3CDSENST00000471538ENST00000375793SPENchr1

16203173

+PLEKHM2chr1

16060292

+
3UTR-3UTRENST00000471538ENST00000477849SPENchr1

16203173

+PLEKHM2chr1

16060292

+

Top

FusionProtFeatures for SPEN_PLEKHM2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SPEN

Q96T58

PLEKHM2

Q8IWE5

May serve as a nuclear matrix platform that organizesand integrates transcriptional responses. In osteoblasts, supportstranscription activation: synergizes with RUNX2 to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element(OCFRE) (By similarity). Has also been shown to be an essentialcorepressor protein, which probably regulates different keypathways such as the Notch pathway. Negative regulator of theNotch pathway via its interaction with RBPSUH, which prevents theassociation between NOTCH1 and RBPSUH, and therefore suppressesthe transactivation activity of Notch signaling. Blocks thedifferentiation of precursor B-cells into marginal zone B-cells.Probably represses transcription via the recruitment of largecomplexes containing histone deacetylase proteins. May bind bothto DNA and RNA. {ECO:0000250, ECO:0000269|PubMed:11331609,ECO:0000269|PubMed:12374742}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315125_2772933665Compositional biasNote=Arg-rich
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3156_812933665DomainRRM 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3151170_11912933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3151408_14282933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3151496_15292933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3151592_16122933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3151928_19442933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315688_7152933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315977_10042933665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315240_3252933665Compositional biasNote=Ser-rich
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3152428_25202933665Compositional biasNote=Pro-rich
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3153220_34822933665Compositional biasNote=Pro-rich
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315616_8102933665Compositional biasNote=Arg-rich
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315624_6972933665Compositional biasNote=Tyr-rich
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3151_5732933665DNA bindingOntology_term=ECO:0000250
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3152201_27072933665DomainNote=RID
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315335_4152933665DomainRRM 2
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3153498_36642933665DomainSPOC
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315438_5132933665DomainRRM 3
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+315517_5892933665DomainRRM 4
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+1820317_3209741020Compositional biasNote=Poly-Lys
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+1820323_3269741020Compositional biasNote=Poly-Lys
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+1820506_5119741020Compositional biasNote=Poly-Gly
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+1820593_5969741020Compositional biasNote=Poly-Leu
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+182036_1589741020DomainRUN
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+1820771_8739741020DomainPH


Top

FusionGeneSequence for SPEN_PLEKHM2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SPEN_ENST00000375759_chr1_16203173_+_PLEKHM2_ENST00000375799_chr1_16060292_+_339aa
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIPSAARG
LDDTVSIASRSREVSGFRGGGGGPAYGPPPSLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGGFDRTRHYDQDYYRDPRERTLQH
GLYYASRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGRRPERNYQHSRSRSPHSSQSRNQSPQRLASQASRPTRSPS

>In-frame_SPEN_ENST00000375759_chr1_16203173_+_PLEKHM2_ENST00000375793_chr1_16060292_+_339aa
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIPSAARG
LDDTVSIASRSREVSGFRGGGGGPAYGPPPSLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGGFDRTRHYDQDYYRDPRERTLQH
GLYYASRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGRRPERNYQHSRSRSPHSSQSRNQSPQRLASQASRPTRSPS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SPEN_ENST00000375759_chr1_16203173_+_PLEKHM2_ENST00000375799_chr1_16060292_+_1019nt
ATGGTCCGGGAAACCAGGCATCTCTGGGTGGGCAACTTACCCGAGAACGTGCGGGAAGAGAAGATCATCGAGCATTTCAAACGATATGGC
CGCGTGGAAAGTGTCAAAATTCTTCCCAAGAGGGGATCTGAAGGAGGAGTGGCTGCCTTTGTGGATTTTGTGGACATCAAAAGTGCACAG
AAAGCTCACAACTCGGTCAACAAAATGGGTGACAGAGACCTACGCACGGATTATAATGAACCAGGCACCATCCCGAGTGCTGCTCGGGGA
TTGGATGATACAGTTTCCATAGCATCTCGTAGTAGAGAGGTTTCTGGGTTCAGAGGAGGTGGTGGAGGGCCTGCTTATGGTCCCCCACCG
TCACTTCATGCACGAGAAGGACGTTATGAGCGGAGACTTGATGGGGCTTCAGATAACAGGGAGCGTGCTTATGAACATAGTGCCTATGGA
CACCATGAACGGGGGACGGGAGGATTTGATCGGACAAGACATTACGATCAGGATTACTATAGAGATCCTCGAGAGCGGACTTTACAACAT
GGGCTCTATTACGCTTCTCGGAGTCGAAGTCCAAATCGCTTTGATGCTCATGACCCCCGATATGAACCTAGGGCTCGCGAGCAGTTTACA
CTGCCCAGTGTGGTACACAGGGATATCTACAGGGATGATATTACCCGGGAGGTACGAGGCAGAAGGCCAGAGCGGAATTACCAGCACAGC
AGGAGTCGGTCACCACATTCATCCCAGTCTAGAAATCAGTCTCCTCAGAGACTGGCTAGCCAAGCATCTAGACCCACAAGGTCCCCTAGC
GGCAGCGGCTCTAGAAGTAGATCCTCCAGTAGTGATTCAATCAGCAGCAGCAGTAGTACCAGCAGTGACAGGTGGACCTCCCCCACACGG
CGATCCAGGAAGCCTCCAACAAGAAGAAATTCGAGGATGCCTTGAGCCTCATCCACAGCGCCTGGCAGCGGAGCGACAGTCTCTGCCGCG

>In-frame_SPEN_ENST00000375759_chr1_16203173_+_PLEKHM2_ENST00000375793_chr1_16060292_+_1019nt
ATGGTCCGGGAAACCAGGCATCTCTGGGTGGGCAACTTACCCGAGAACGTGCGGGAAGAGAAGATCATCGAGCATTTCAAACGATATGGC
CGCGTGGAAAGTGTCAAAATTCTTCCCAAGAGGGGATCTGAAGGAGGAGTGGCTGCCTTTGTGGATTTTGTGGACATCAAAAGTGCACAG
AAAGCTCACAACTCGGTCAACAAAATGGGTGACAGAGACCTACGCACGGATTATAATGAACCAGGCACCATCCCGAGTGCTGCTCGGGGA
TTGGATGATACAGTTTCCATAGCATCTCGTAGTAGAGAGGTTTCTGGGTTCAGAGGAGGTGGTGGAGGGCCTGCTTATGGTCCCCCACCG
TCACTTCATGCACGAGAAGGACGTTATGAGCGGAGACTTGATGGGGCTTCAGATAACAGGGAGCGTGCTTATGAACATAGTGCCTATGGA
CACCATGAACGGGGGACGGGAGGATTTGATCGGACAAGACATTACGATCAGGATTACTATAGAGATCCTCGAGAGCGGACTTTACAACAT
GGGCTCTATTACGCTTCTCGGAGTCGAAGTCCAAATCGCTTTGATGCTCATGACCCCCGATATGAACCTAGGGCTCGCGAGCAGTTTACA
CTGCCCAGTGTGGTACACAGGGATATCTACAGGGATGATATTACCCGGGAGGTACGAGGCAGAAGGCCAGAGCGGAATTACCAGCACAGC
AGGAGTCGGTCACCACATTCATCCCAGTCTAGAAATCAGTCTCCTCAGAGACTGGCTAGCCAAGCATCTAGACCCACAAGGTCCCCTAGC
GGCAGCGGCTCTAGAAGTAGATCCTCCAGTAGTGATTCAATCAGCAGCAGCAGTAGTACCAGCAGTGACAGGTGGACCTCCCCCACACGG
CGATCCAGGAAGCCTCCAACAAGAAGAAATTCGAGGATGCCTTGAGCCTCATCCACAGCGCCTGGCAGCGGAGCGACAGTCTCTGCCGCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SPEN_ENST00000375759_chr1_16203173_+_PLEKHM2_ENST00000375799_chr1_16060292_+_2058nt
TGAGCTGCGAGGCCCGAGAGTCAGAACCTGGGGGAGAGGGATGGTCTCTGCACGGGGGGGAGCCGGAGGAGCCGCCGCCGCTGCCGACGC
CACCGCCGCAGCCGCCGCCGCCGCCGCCCCGGCACCCGCCTCCCGGCGCTGACGGTCTCGTACGAAGCCGGCGAGGGGGAGCCAGCAGCG
GCGGTCGCCGGCACGCCGCCCAGCATGGTCCGGGAAACCAGGCATCTCTGGGTGGGCAACTTACCCGAGAACGTGCGGGAAGAGAAGATC
ATCGAGCATTTCAAACGATATGGCCGCGTGGAAAGTGTCAAAATTCTTCCCAAGAGGGGATCTGAAGGAGGAGTGGCTGCCTTTGTGGAT
TTTGTGGACATCAAAAGTGCACAGAAAGCTCACAACTCGGTCAACAAAATGGGTGACAGAGACCTACGCACGGATTATAATGAACCAGGC
ACCATCCCGAGTGCTGCTCGGGGATTGGATGATACAGTTTCCATAGCATCTCGTAGTAGAGAGGTTTCTGGGTTCAGAGGAGGTGGTGGA
GGGCCTGCTTATGGTCCCCCACCGTCACTTCATGCACGAGAAGGACGTTATGAGCGGAGACTTGATGGGGCTTCAGATAACAGGGAGCGT
GCTTATGAACATAGTGCCTATGGACACCATGAACGGGGGACGGGAGGATTTGATCGGACAAGACATTACGATCAGGATTACTATAGAGAT
CCTCGAGAGCGGACTTTACAACATGGGCTCTATTACGCTTCTCGGAGTCGAAGTCCAAATCGCTTTGATGCTCATGACCCCCGATATGAA
CCTAGGGCTCGCGAGCAGTTTACACTGCCCAGTGTGGTACACAGGGATATCTACAGGGATGATATTACCCGGGAGGTACGAGGCAGAAGG
CCAGAGCGGAATTACCAGCACAGCAGGAGTCGGTCACCACATTCATCCCAGTCTAGAAATCAGTCTCCTCAGAGACTGGCTAGCCAAGCA
TCTAGACCCACAAGGTCCCCTAGCGGCAGCGGCTCTAGAAGTAGATCCTCCAGTAGTGATTCAATCAGCAGCAGCAGTAGTACCAGCAGT
GACAGGTGGACCTCCCCCACACGGCGATCCAGGAAGCCTCCAACAAGAAGAAATTCGAGGATGCCTTGAGCCTCATCCACAGCGCCTGGC
AGCGGAGCGACAGTCTCTGCCGCGGCCGAGCCTCCCGAGACCCCTGGTGCTGAGGCAGAGCTGGTTGGCGTCCCTGGTGGGCAGGAAAGG
AAGGCACGCCAGCCGGCAGGCACACTGTCACGGCTGTTGTCATGCTGTCGGGAGCCTACAGTCCACCCCTGCCCTGGGCGGCAGAACCAC
CGAGTGTGGCTTAAGACAGGGTCCCTCCACTCCAGGGATCCAGATCAGGTGCCCGGCACCCCTGGGCATCCTGCCCGACAGGTAGCGAAT
GGAGGTCGCTGGGGGCAGAGGGTCCGAGCCCTGTGGGCTCTGCGGATGCACGCCCTCCTCCCGGGCCTCCGCCTCAGTCTGCAGAATTTC
TGCCGAGTGGCACCGAGAACACCATCCATCTAAGGACGAACAAAAGAACCAGGAGGGCGGGACCCCCCTCTTCCTCTCCTGGGTTGGGGG
CTGGGGCCCTGAGTGCCCAGCCATCCTTGTTCGTGTTTGAACACTCTCCTGGCCACGTGGGGAAGCGGGAACACGGGGTGTCTGCGCATG
TTTCCTCCTCCTAGCTCCATCACTGCGCACACAGCTGCCTGCCTCGCCAGATGCAGGGGGGCGGGCAGCCCTCCCTGGCTGCCAGGAGGC
TCTGCATGCCCACAGTCCTGCCCTGCCTGTCCCCTCAACCCGGCAGTGCCTGTAGCACCGAGGAGCAAAGGGGGTGGATGGGGGGCTTGG
AGAAGGGCGGAGCCCACCAGCCTGGCATCCATGTTGACATCTTCTGACTGTCCCCTGCTTGGCTGGAGCCAGGCCCTTCCCTAGAGTTTC

>In-frame_SPEN_ENST00000375759_chr1_16203173_+_PLEKHM2_ENST00000375793_chr1_16060292_+_2058nt
TGAGCTGCGAGGCCCGAGAGTCAGAACCTGGGGGAGAGGGATGGTCTCTGCACGGGGGGGAGCCGGAGGAGCCGCCGCCGCTGCCGACGC
CACCGCCGCAGCCGCCGCCGCCGCCGCCCCGGCACCCGCCTCCCGGCGCTGACGGTCTCGTACGAAGCCGGCGAGGGGGAGCCAGCAGCG
GCGGTCGCCGGCACGCCGCCCAGCATGGTCCGGGAAACCAGGCATCTCTGGGTGGGCAACTTACCCGAGAACGTGCGGGAAGAGAAGATC
ATCGAGCATTTCAAACGATATGGCCGCGTGGAAAGTGTCAAAATTCTTCCCAAGAGGGGATCTGAAGGAGGAGTGGCTGCCTTTGTGGAT
TTTGTGGACATCAAAAGTGCACAGAAAGCTCACAACTCGGTCAACAAAATGGGTGACAGAGACCTACGCACGGATTATAATGAACCAGGC
ACCATCCCGAGTGCTGCTCGGGGATTGGATGATACAGTTTCCATAGCATCTCGTAGTAGAGAGGTTTCTGGGTTCAGAGGAGGTGGTGGA
GGGCCTGCTTATGGTCCCCCACCGTCACTTCATGCACGAGAAGGACGTTATGAGCGGAGACTTGATGGGGCTTCAGATAACAGGGAGCGT
GCTTATGAACATAGTGCCTATGGACACCATGAACGGGGGACGGGAGGATTTGATCGGACAAGACATTACGATCAGGATTACTATAGAGAT
CCTCGAGAGCGGACTTTACAACATGGGCTCTATTACGCTTCTCGGAGTCGAAGTCCAAATCGCTTTGATGCTCATGACCCCCGATATGAA
CCTAGGGCTCGCGAGCAGTTTACACTGCCCAGTGTGGTACACAGGGATATCTACAGGGATGATATTACCCGGGAGGTACGAGGCAGAAGG
CCAGAGCGGAATTACCAGCACAGCAGGAGTCGGTCACCACATTCATCCCAGTCTAGAAATCAGTCTCCTCAGAGACTGGCTAGCCAAGCA
TCTAGACCCACAAGGTCCCCTAGCGGCAGCGGCTCTAGAAGTAGATCCTCCAGTAGTGATTCAATCAGCAGCAGCAGTAGTACCAGCAGT
GACAGGTGGACCTCCCCCACACGGCGATCCAGGAAGCCTCCAACAAGAAGAAATTCGAGGATGCCTTGAGCCTCATCCACAGCGCCTGGC
AGCGGAGCGACAGTCTCTGCCGCGGCCGAGCCTCCCGAGACCCCTGGTGCTGAGGCAGAGCTGGTTGGCGTCCCTGGTGGGCAGGAAAGG
AAGGCACGCCAGCCGGCAGGCACACTGTCACGGCTGTTGTCATGCTGTCGGGAGCCTACAGTCCACCCCTGCCCTGGGCGGCAGAACCAC
CGAGTGTGGCTTAAGACAGGGTCCCTCCACTCCAGGGATCCAGATCAGGTGCCCGGCACCCCTGGGCATCCTGCCCGACAGGTAGCGAAT
GGAGGTCGCTGGGGGCAGAGGGTCCGAGCCCTGTGGGCTCTGCGGATGCACGCCCTCCTCCCGGGCCTCCGCCTCAGTCTGCAGAATTTC
TGCCGAGTGGCACCGAGAACACCATCCATCTAAGGACGAACAAAAGAACCAGGAGGGCGGGACCCCCCTCTTCCTCTCCTGGGTTGGGGG
CTGGGGCCCTGAGTGCCCAGCCATCCTTGTTCGTGTTTGAACACTCTCCTGGCCACGTGGGGAAGCGGGAACACGGGGTGTCTGCGCATG
TTTCCTCCTCCTAGCTCCATCACTGCGCACACAGCTGCCTGCCTCGCCAGATGCAGGGGGGCGGGCAGCCCTCCCTGGCTGCCAGGAGGC
TCTGCATGCCCACAGTCCTGCCCTGCCTGTCCCCTCAACCCGGCAGTGCCTGTAGCACCGAGGAGCAAAGGGGGTGGATGGGGGGCTTGG
AGAAGGGCGGAGCCCACCAGCCTGGCATCCATGTTGACATCTTCTGACTGTCCCCTGCTTGGCTGGAGCCAGGCCCTTCCCTAGAGTTTC


Top

FusionGenePPI for SPEN_PLEKHM2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SPENNCOR2, PPARD, HDAC1, SRA1, RBPJ, NCOR1, CTBP1, RBBP8, RUNX1T1, RUNX1, SIRT7, UBE2E2, UBE2L6, ATXN1, NOTCH2, BPGM, TTN, PRDX3, PCBP3, NUP54, PIR, SCYL2, SOX2, HRSP12, SERTAD1, CUL7, OBSL1, EED, BMI1, CCNC, WRAP73, MED23, SRPK2, CLK1, DYNLT1, BCLAF1, FERMT3, USP37, DPPA4, EGFR, TRIML2, CAMKV, PIP4K2A, NR3C1PLEKHM2CBR1, POLR2F, OFD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3152130_24642933665MSX2
HgeneSPENchr1:16203173chr1:16060292ENST00000375759+3152709_28702933665RBPSUH
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+18201_3109741020KIF5B
TgenePLEKHM2chr1:16203173chr1:16060292ENST00000375799+1820762_8859741020sifA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SPEN_PLEKHM2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SPEN_PLEKHM2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource