FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35622

FusionGeneSummary for SPECC1L_MED15

check button Fusion gene summary
Fusion gene informationFusion gene name: SPECC1L_MED15
Fusion gene ID: 35622
HgeneTgene
Gene symbol

SPECC1L

MED15

Gene ID

23384

51586

Gene namesperm antigen with calponin homology and coiled-coil domains 1 likemediator complex subunit 15
SynonymsCYTSA|GBBB2|OBLFC1ARC105|CAG7A|CTG7A|PCQAP|TIG-1|TIG1|TNRC7
Cytomap

22q11.23

22q11.21

Type of geneprotein-codingprotein-coding
Descriptioncytospin-ASPECC1-like proteincytokinesis and spindle organization Arenal carcinoma antigen NY-REN-22mediator of RNA polymerase II transcription subunit 15CTG repeat protein 7aPC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated proteinPC2 glutamine/Q-rich-associated proteinPC2-glutamine-rich-associated proteinTPA inducible ge
Modification date2018052320180523
UniProtAcc

Q69YQ0

Q96RN5

Ensembl transtripts involved in fusion geneENST00000437398, ENST00000314328, 
ENST00000541492, ENST00000416735, 
ENST00000425759, ENST00000292733, 
ENST00000542773, ENST00000263205, 
ENST00000406969, ENST00000382974, 
ENST00000541476, ENST00000478831, 
Fusion gene scores* DoF score15 X 6 X 11=99013 X 9 X 7=819
# samples 1515
** MAII scorelog2(15/990*10)=-2.72246602447109
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/819*10)=-2.44890095114513
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SPECC1L [Title/Abstract] AND MED15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSPECC1L

GO:0007155

cell adhesion

21703590


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-EB-A5KH-06ASPECC1Lchr22

24808675

+MED15chr22

20905723

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000437398ENST00000425759SPECC1Lchr22

24808675

+MED15chr22

20905723

+
In-frameENST00000437398ENST00000292733SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000437398ENST00000542773SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000437398ENST00000263205SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000437398ENST00000406969SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000437398ENST00000382974SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000437398ENST00000541476SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000437398ENST00000478831SPECC1Lchr22

24808675

+MED15chr22

20905723

+
In-frameENST00000314328ENST00000425759SPECC1Lchr22

24808675

+MED15chr22

20905723

+
In-frameENST00000314328ENST00000292733SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000314328ENST00000542773SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000314328ENST00000263205SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000314328ENST00000406969SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000314328ENST00000382974SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000314328ENST00000541476SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000314328ENST00000478831SPECC1Lchr22

24808675

+MED15chr22

20905723

+
In-frameENST00000541492ENST00000425759SPECC1Lchr22

24808675

+MED15chr22

20905723

+
In-frameENST00000541492ENST00000292733SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000541492ENST00000542773SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000541492ENST00000263205SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000541492ENST00000406969SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000541492ENST00000382974SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000541492ENST00000541476SPECC1Lchr22

24808675

+MED15chr22

20905723

+
5CDS-intronENST00000541492ENST00000478831SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-3CDSENST00000416735ENST00000425759SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-3CDSENST00000416735ENST00000292733SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-intronENST00000416735ENST00000542773SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-intronENST00000416735ENST00000263205SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-intronENST00000416735ENST00000406969SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-intronENST00000416735ENST00000382974SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-intronENST00000416735ENST00000541476SPECC1Lchr22

24808675

+MED15chr22

20905723

+
intron-intronENST00000416735ENST00000478831SPECC1Lchr22

24808675

+MED15chr22

20905723

+

Top

FusionProtFeatures for SPECC1L_MED15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SPECC1L

Q69YQ0

MED15

Q96RN5

Involved in cytokinesis and spindle organization. Mayplay a role in actin cytoskeleton organization and microtubulestabilization and hence required for proper cell adhesion andmigration. {ECO:0000269|PubMed:21703590}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000314328+1617168_28010881118Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000314328+1617394_44910881118Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000314328+1617487_80710881118Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000437398+1516168_28010881118Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000437398+1516394_44910881118Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000437398+1516487_80710881118Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000541492+1415168_28010491079Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000541492+1415394_44910491079Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000541492+1415487_80710491079Coiled coilOntology_term=ECO:0000255
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000314328+1617858_86110881118Compositional biasNote=Poly-Ala
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000437398+1516858_86110881118Compositional biasNote=Poly-Ala
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000541492+1415858_86110491079Compositional biasNote=Poly-Ala
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118161_17452789Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118178_19352789Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118205_21852789Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118226_23952789Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118243_26252789Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118266_51552789Compositional biasNote=Pro-rich
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118360_36752789Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118449_45652789Compositional biasNote=Poly-Pro
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118602_61152789Compositional biasNote=Poly-Pro
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117161_17452749Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117178_19352749Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117205_21852749Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117226_23952749Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117243_26252749Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117266_51552749Compositional biasNote=Pro-rich
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117360_36752749Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117449_45652749Compositional biasNote=Poly-Pro
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117602_61152749Compositional biasNote=Poly-Pro
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116161_17452678Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116178_19352678Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116205_21852678Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116226_23952678Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116243_26252678Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116266_51552678Compositional biasNote=Pro-rich
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116360_36752678Compositional biasNote=Poly-Gln
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116449_45652678Compositional biasNote=Poly-Pro
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116602_61152678Compositional biasNote=Poly-Pro
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+118547_56452789MotifNuclear localization signal
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+117547_56452749MotifNuclear localization signal
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+116547_56452678MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000314328+16171011_111610881118DomainCalponin-homology (CH)
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000437398+15161011_111610881118DomainCalponin-homology (CH)
HgeneSPECC1Lchr22:24808675chr22:20905723ENST00000541492+14151011_111610491079DomainCalponin-homology (CH)


Top

FusionGeneSequence for SPECC1L_MED15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SPECC1L_ENST00000437398_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_1714aa
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPA
MTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDR
LNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLC
QQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDL
AHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNY
MNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEGASPASLMAMGTTSPQLSLSSSPTASVTPTT
RSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFMLAFQAAE
SVGIKSTLDEYLSLVARLIIHFRDIHNKKSQASVSAQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQ
QQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHH
TQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQV
SQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNP
SSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPP
PPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDP
SHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACL

>In-frame_SPECC1L_ENST00000437398_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_1785aa
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPA
MTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDR
LNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLC
QQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDL
AHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNY
MNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEGASPASLMAMGTTSPQLSLSSSPTASVTPTT
RSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFMLAFQAAE
SVGIKSTLDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTS
GMAPHSMAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLH
HQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQ
PSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQVSQSSLPMLSSPSPGQQVQT
PQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLD
KLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDA
VLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKD

>In-frame_SPECC1L_ENST00000314328_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_1714aa
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPA
MTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDR
LNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLC
QQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDL
AHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNY
MNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEGASPASLMAMGTTSPQLSLSSSPTASVTPTT
RSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFMLAFQAAE
SVGIKSTLDEYLSLVARLIIHFRDIHNKKSQASVSAQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQ
QQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHH
TQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQV
SQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNP
SSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPP
PPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDP
SHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACL

>In-frame_SPECC1L_ENST00000314328_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_1785aa
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPA
MTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDR
LNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLC
QQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDL
AHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNY
MNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEGASPASLMAMGTTSPQLSLSSSPTASVTPTT
RSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFMLAFQAAE
SVGIKSTLDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTS
GMAPHSMAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLH
HQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQ
PSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQVSQSSLPMLSSPSPGQQVQT
PQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLD
KLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDA
VLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKD

>In-frame_SPECC1L_ENST00000541492_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_1675aa
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPA
MTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDR
LNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLC
QQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDL
AHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNY
MNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEGASPASLMAMGTTSPQLSLSSSPTASVTPTT
RSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQRRNFMLAFQAAESVGIKSTLDEYLSLVARLIIHFRDIHNKKSQASVSAQLQ
LQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQL
QLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQAL
PGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQ
PNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKID
KNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVP
AMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSP

>In-frame_SPECC1L_ENST00000541492_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_1746aa
MKKASRSVGSVPKVSAISKTQTAEKIKPENSSSASTGGKLVKPGTAASLSKTKSSDDLLAGMAGGVTVTNGVKGKKSTCPSAAPSASAPA
MTTVENKSKISTGTASSTKRSTSTGNKESSSTRERLRERTRLNQSKKLPSAGQGANDMALAKRSRSRTATECDVRMSKSKSDNQISDRAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKETIMAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDR
LNALGFSLEQRLDNSEKLFGYQSLSPEITPDNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLC
QQSDKLEHFSRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDL
AHTRNDANRLQDAIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNY
MNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNPAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKTLSVSRRSSEEVKRDISAQEGASPASLMAMGTTSPQLSLSSSPTASVTPTT
RSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQRRNFMLAFQAAESVGIKSTLDEYLSLVARLIIHFRDIHNKKSQASVSDPMN
ALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHSMAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQ
QAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQA
LQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMV
VQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPS
PSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDIL
TDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRK
RRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SPECC1L_ENST00000437398_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_5142nt
ATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAAC
AGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCT
GGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCC
ATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGT
TCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTG
GCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCT
TTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGT
GCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAG
TCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGG
TTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCT
GATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAA
AATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGAT
GATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAA
GTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAG
CTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGT
CAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGAT
GAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTT
GGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGC
AGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCC
AGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGA
GACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTG
GCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAA
CAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATC
TTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAA
CTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAG
GCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAG
GCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTAC
ATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACA
GTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGT
CCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCC
CTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCA
AGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGA
GCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACC
CGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGG
TGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATGGGCTGGCCTTCTGTGCCCTCCTG
CATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCATGCTGGCTTTCCAGGCAGCTGAA
AGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATTCATAACAAGAAATCT
CAAGCTTCCGTCAGTGCCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCG
GCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAG
CAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAGCAGCAA
CAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAG
GCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATGCATCAC
ACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAGACCCAG
CCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTGGTGCAG
CAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTC
AGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCC
CCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCA
CCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCC
AGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCC
CTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGAC
CCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCA
CCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAAC
CATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGG
CTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCT
TCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTG
CCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGC
ATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTC

>In-frame_SPECC1L_ENST00000437398_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_5355nt
ATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAAC
AGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCT
GGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCC
ATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGT
TCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTG
GCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCT
TTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGT
GCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAG
TCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGG
TTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCT
GATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAA
AATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGAT
GATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAA
GTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAG
CTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGT
CAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGAT
GAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTT
GGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGC
AGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCC
AGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGA
GACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTG
GCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAA
CAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATC
TTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAA
CTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAG
GCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAG
GCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTAC
ATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACA
GTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGT
CCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCC
CTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCA
AGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGA
GCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACC
CGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGG
TGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATGGGCTGGCCTTCTGTGCCCTCCTG
CATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCATGCTGGCTTTCCAGGCAGCTGAA
AGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATTCATAACAAGAAATCT
CAAGCTTCCGTCAGTGATCCTATGAATGCACTCCAGAGCCTGACTGGCGGACCTGCTGCGGGAGCCGCTGGAATTGGCATGCCTCCTCGG
GGCCCGGGACAGTCTCTGGGCGGGATGGGTAGCCTTGGTGCCATGGGACAGCCAATGTCTCTCTCAGGGCAGCCGCCTCCTGGGACCTCG
GGGATGGCCCCTCACAGCATGGCTGTCGTGTCTACGGCAACTCCACAGACCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAG
CAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGT
GCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCAT
CATCAAAATCAGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAG
GCTCTGCCCCAGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAA
CCATCACAACTCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCA
CTGAAATTTGTCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAG
GCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACC
CCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCC
CCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCC
TCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGAC
AAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGT
AAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAA
CTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCC
GTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATC
ACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGG
CTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGAC
CTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGAC
GCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAAC

>In-frame_SPECC1L_ENST00000314328_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_5142nt
ATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAAC
AGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCT
GGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCC
ATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGT
TCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTG
GCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCT
TTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGT
GCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAG
TCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGG
TTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCT
GATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAA
AATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGAT
GATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAA
GTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAG
CTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGT
CAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGAT
GAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTT
GGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGC
AGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCC
AGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGA
GACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTG
GCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAA
CAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATC
TTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAA
CTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAG
GCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAG
GCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTAC
ATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACA
GTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGT
CCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCC
CTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCA
AGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGA
GCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACC
CGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGG
TGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATGGGCTGGCCTTCTGTGCCCTCCTG
CATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCATGCTGGCTTTCCAGGCAGCTGAA
AGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATTCATAACAAGAAATCT
CAAGCTTCCGTCAGTGCCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCG
GCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAG
CAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAGCAGCAA
CAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAG
GCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATGCATCAC
ACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAGACCCAG
CCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTGGTGCAG
CAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTC
AGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCC
CCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCA
CCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCC
AGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCC
CTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGAC
CCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCA
CCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAAC
CATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGG
CTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCT
TCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTG
CCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGC
ATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTC

>In-frame_SPECC1L_ENST00000314328_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_5355nt
ATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAAC
AGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCT
GGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCC
ATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGT
TCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTG
GCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCT
TTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGT
GCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAG
TCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGG
TTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCT
GATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAA
AATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGAT
GATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAA
GTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAG
CTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGT
CAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGAT
GAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTT
GGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGC
AGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCC
AGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGA
GACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTG
GCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAA
CAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATC
TTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAA
CTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAG
GCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAG
GCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTAC
ATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACA
GTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGT
CCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCC
CTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCA
AGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGA
GCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACC
CGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGG
TGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATGGGCTGGCCTTCTGTGCCCTCCTG
CATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCATGCTGGCTTTCCAGGCAGCTGAA
AGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATTCATAACAAGAAATCT
CAAGCTTCCGTCAGTGATCCTATGAATGCACTCCAGAGCCTGACTGGCGGACCTGCTGCGGGAGCCGCTGGAATTGGCATGCCTCCTCGG
GGCCCGGGACAGTCTCTGGGCGGGATGGGTAGCCTTGGTGCCATGGGACAGCCAATGTCTCTCTCAGGGCAGCCGCCTCCTGGGACCTCG
GGGATGGCCCCTCACAGCATGGCTGTCGTGTCTACGGCAACTCCACAGACCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAG
CAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGT
GCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCAT
CATCAAAATCAGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAG
GCTCTGCCCCAGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAA
CCATCACAACTCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCA
CTGAAATTTGTCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAG
GCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACC
CCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCC
CCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCC
TCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGAC
AAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGT
AAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAA
CTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCC
GTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATC
ACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGG
CTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGAC
CTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGAC
GCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAAC

>In-frame_SPECC1L_ENST00000541492_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_5025nt
ATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAAC
AGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCT
GGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCC
ATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGT
TCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTG
GCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCT
TTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGT
GCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAG
TCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGG
TTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCT
GATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAA
AATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGAT
GATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAA
GTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAG
CTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGT
CAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGAT
GAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTT
GGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGC
AGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCC
AGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGA
GACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTG
GCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAA
CAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATC
TTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAA
CTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAG
GCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAG
GCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTAC
ATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACA
GTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGT
CCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCC
CTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCA
AGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGA
GCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACC
CGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGG
TGTCAGAAGAAAACAGAAGGCTATCAGAGAAGGAACTTCATGCTGGCTTTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGAC
GAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATTCATAACAAGAAATCTCAAGCTTCCGTCAGTGCCCAGCTGCAG
CTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAG
CAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTG
CAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCG
ATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAG
CCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTC
CCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAG
CAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCC
TCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAG
CCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACG
GCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCC
AGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGAC
AAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACC
TTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAG
CAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCA
GCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATC
CCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTC
CACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCG
CTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCG

>In-frame_SPECC1L_ENST00000541492_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_5238nt
ATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAAC
AGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCT
GGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCC
ATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGT
TCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTG
GCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCT
TTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGT
GCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAG
TCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGG
TTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCT
GATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAA
AATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGAT
GATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAA
GTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAG
CTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGT
CAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGAT
GAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTT
GGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGC
AGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCC
AGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGA
GACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTG
GCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAA
CAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATC
TTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAA
CTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAG
GCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAG
GCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTAC
ATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACA
GTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGT
CCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCC
CTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCA
AGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGA
GCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACC
CGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGG
TGTCAGAAGAAAACAGAAGGCTATCAGAGAAGGAACTTCATGCTGGCTTTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGAC
GAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATTCATAACAAGAAATCTCAAGCTTCCGTCAGTGATCCTATGAAT
GCACTCCAGAGCCTGACTGGCGGACCTGCTGCGGGAGCCGCTGGAATTGGCATGCCTCCTCGGGGCCCGGGACAGTCTCTGGGCGGGATG
GGTAGCCTTGGTGCCATGGGACAGCCAATGTCTCTCTCAGGGCAGCCGCCTCCTGGGACCTCGGGGATGGCCCCTCACAGCATGGCTGTC
GTGTCTACGGCAACTCCACAGACCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAG
CAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTA
GTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAG
CAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCT
TTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATG
CATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAG
ACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTG
GTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTC
CAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAG
CCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGC
CCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTG
AACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATC
GAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTG
ACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACT
CCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTC
TTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAG
CGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTG
GACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTC
AGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCAC
CGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SPECC1L_ENST00000437398_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_6272nt
GGCCAAGGGCGGGGCCCGCGAGGGAGGCCGGGCGGCCCGGCAAGCGGCGCTGCGGGGTAGGCTGCTTTCCTGAGGCCGGACTCAACGGGT
CTCGGCTGAGCCACCGGGTGAGCTCACCGCCCAGCCCAAACCAGGAGATTGCGAGGGAGCGATGCGGTGCAGCGCGATTTGCTTGTAAAT
GCATCACGAAGAGGCAGCCCAGAATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAG
CAGAAAAAATTAAACCTGAAAACAGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCA
AGAGCAGTGATGACCTTTTAGCTGGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAG
CACCTTCAGCATCTGCCCCTGCCATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTT
CTACAGGTAATAAAGAATCCAGTTCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTC
AGGGAGCTAATGACATGGCATTGGCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACA
ATCAGATCAGTGACAGAGCTGCTTTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGA
GAAATGAACTGCGAGACATGCGTGCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGG
CTCACCAGCCGACTGATGTGGAGTCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATG
AAAACAGAATGTTAAAGGACAGGTTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGT
CCCTGAGCCCAGAAATCACCCCTGATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGG
AGGATCTCTTGAGTCAGGATGAAAATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCT
ACCAGCCCCTCACATCGAGCGATGATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGG
GGAGCAGCGGGAATGCCAGTGAAGTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGG
AACTCCAGGCAACCCTGCAAGAGCTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGG
TTATTCTGATGGAGTCTTTATGTCAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGC
ATCACATTTCTTATGTCATAGATGAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCC
GTTTTGAACGGGAGCAGCTTCTTGGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAA
TGATAGGGGCACTCAAAGAACGCAGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAG
AGGAATACAAAGCCACAGTGGCCAGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGC
TGTATTCTATCCATAACTCTGGAGACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGG
CTAGTAGCTTGCAGGAAGATCTGGCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAG
CCTTCCAAGAAGAAGCTAAGAAACAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAA
GGAGTGACATGAAAGAAACCATCTTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTG
ATCTAGAGAATACAGTTAAAAAACTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAAT
CTGCGGAATGGCGGCAGTTTCAGGCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTG
ATCTAAAGCGCCGGTTACATGAGGCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGG
AGCGAGGCCGGGTATACAATTACATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGA
CTTCCTCAGAGCCAACTCCTACAGTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTC
CTCGAACGCCCCTGAGCCCAAGTCCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCT
CAACATCCAAACCCCTGACAGCCCTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAG
CCAGCCGGCCTGCTTCCCTGCCAAGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAAC
GGGACATTTCTGCACAGGAGGGAGCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAA
CGGCATCTGTGACTCCCACCACCCGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAA
AGAGGAACGCCTTGCTGAAGTGGTGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATG
GGCTGGCCTTCTGTGCCCTCCTGCATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCA
TGCTGGCTTTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTC
GAGACATTCATAACAAGAAATCTCAAGCTTCCGTCAGTGCCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGC
AGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGC
AGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATC
AGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCC
AGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAAC
TCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTG
TCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGA
TGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGA
TGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCA
GTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGAC
CTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGC
AGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGA
GCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATG
ACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCA
ACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAG
TGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCA
AGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTG
TGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCT
TCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCC
AGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGCAGGGATGGCCCGCAGCCTCATCGGGGCCAAGGACACACGCCTCCT
GTCAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTAGGTTAGCTTTCCTGCTTTTATCTTCTGCCTTGGGGACCTGCCAAA
CGAAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCGGGTTGCTTGGGGGGCGTTGGCCGACTTCTTAGAGAAGGCCCTCCA
TGTGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTCACCGTGGCCTGTCCACGGTCCAGGTCCATCTCAGCAGCGTGAGGG
TGCACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCACCCCTACTCGTTCCTATAGAACACAGAGGACATAGGAAACCCTTAA
AACACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATGCTGCTTTGGGCAGGTGGAGCACCCCCCGAGGAAGCCTGCAAGTCC
AGGGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCTGCTGGCTCCCCGCCACCAGCTGGGCCTCAGCCCTCACGGCATTCC
TGCTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATCCTGCTGCCGGCACCCCTGTGCCGCTGGCATGAGGGCCGTGTCCCC
ACTGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAGAGCACCACACACTGAGCACCCAGAGACAGCGGGCCTGGCAGCGGG
CCGGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGGGCACCGGCCAGCACCCTCTGGTGAGAAGAGGTCCCCCCTTTTTAT

>In-frame_SPECC1L_ENST00000437398_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_6486nt
GGCCAAGGGCGGGGCCCGCGAGGGAGGCCGGGCGGCCCGGCAAGCGGCGCTGCGGGGTAGGCTGCTTTCCTGAGGCCGGACTCAACGGGT
CTCGGCTGAGCCACCGGGTGAGCTCACCGCCCAGCCCAAACCAGGAGATTGCGAGGGAGCGATGCGGTGCAGCGCGATTTGCTTGTAAAT
GCATCACGAAGAGGCAGCCCAGAATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAG
CAGAAAAAATTAAACCTGAAAACAGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCA
AGAGCAGTGATGACCTTTTAGCTGGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAG
CACCTTCAGCATCTGCCCCTGCCATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTT
CTACAGGTAATAAAGAATCCAGTTCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTC
AGGGAGCTAATGACATGGCATTGGCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACA
ATCAGATCAGTGACAGAGCTGCTTTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGA
GAAATGAACTGCGAGACATGCGTGCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGG
CTCACCAGCCGACTGATGTGGAGTCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATG
AAAACAGAATGTTAAAGGACAGGTTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGT
CCCTGAGCCCAGAAATCACCCCTGATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGG
AGGATCTCTTGAGTCAGGATGAAAATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCT
ACCAGCCCCTCACATCGAGCGATGATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGG
GGAGCAGCGGGAATGCCAGTGAAGTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGG
AACTCCAGGCAACCCTGCAAGAGCTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGG
TTATTCTGATGGAGTCTTTATGTCAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGC
ATCACATTTCTTATGTCATAGATGAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCC
GTTTTGAACGGGAGCAGCTTCTTGGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAA
TGATAGGGGCACTCAAAGAACGCAGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAG
AGGAATACAAAGCCACAGTGGCCAGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGC
TGTATTCTATCCATAACTCTGGAGACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGG
CTAGTAGCTTGCAGGAAGATCTGGCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAG
CCTTCCAAGAAGAAGCTAAGAAACAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAA
GGAGTGACATGAAAGAAACCATCTTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTG
ATCTAGAGAATACAGTTAAAAAACTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAAT
CTGCGGAATGGCGGCAGTTTCAGGCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTG
ATCTAAAGCGCCGGTTACATGAGGCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGG
AGCGAGGCCGGGTATACAATTACATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGA
CTTCCTCAGAGCCAACTCCTACAGTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTC
CTCGAACGCCCCTGAGCCCAAGTCCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCT
CAACATCCAAACCCCTGACAGCCCTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAG
CCAGCCGGCCTGCTTCCCTGCCAAGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAAC
GGGACATTTCTGCACAGGAGGGAGCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAA
CGGCATCTGTGACTCCCACCACCCGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAA
AGAGGAACGCCTTGCTGAAGTGGTGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATG
GGCTGGCCTTCTGTGCCCTCCTGCATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCA
TGCTGGCTTTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTC
GAGACATTCATAACAAGAAATCTCAAGCTTCCGTCAGTGATCCTATGAATGCACTCCAGAGCCTGACTGGCGGACCTGCTGCGGGAGCCG
CTGGAATTGGCATGCCTCCTCGGGGCCCGGGACAGTCTCTGGGCGGGATGGGTAGCCTTGGTGCCATGGGACAGCCAATGTCTCTCTCAG
GGCAGCCGCCTCCTGGGACCTCGGGGATGGCCCCTCACAGCATGGCTGTCGTGTCTACGGCAACTCCACAGACCCAGCTGCAGCTCCAGC
AGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGC
AGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGC
AGCAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCC
AACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGC
AGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGC
AGCCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGAC
AAATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGC
AGACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGT
CACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACT
CCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGA
CCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGG
CTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACG
AAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAA
AGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACC
TATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGA
CCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTG
TGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGA
TCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGA
TAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGC
ACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGCAGGGATGGCCCG
CAGCCTCATCGGGGCCAAGGACACACGCCTCCTGTCAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTAGGTTAGCTTTCC
TGCTTTTATCTTCTGCCTTGGGGACCTGCCAAACGAAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCGGGTTGCTTGGGG
GGCGTTGGCCGACTTCTTAGAGAAGGCCCTCCATGTGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTCACCGTGGCCTGT
CCACGGTCCAGGTCCATCTCAGCAGCGTGAGGGTGCACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCACCCCTACTCGTTC
CTATAGAACACAGAGGACATAGGAAACCCTTAAAACACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATGCTGCTTTGGGCA
GGTGGAGCACCCCCCGAGGAAGCCTGCAAGTCCAGGGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCTGCTGGCTCCCCG
CCACCAGCTGGGCCTCAGCCCTCACGGCATTCCTGCTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATCCTGCTGCCGGCA
CCCCTGTGCCGCTGGCATGAGGGCCGTGTCCCCACTGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAGAGCACCACACAC
TGAGCACCCAGAGACAGCGGGCCTGGCAGCGGGCCGGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGGGCACCGGCCAGC
ACCCTCTGGTGAGAAGAGGTCCCCCCTTTTTATGTGCACTACCCCACCATCTGTGATTATAATAAATTTATTATTCCTGTGTTTGTCAGT

>In-frame_SPECC1L_ENST00000314328_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_6354nt
GGAGGCCGGGCGGCCCGGCAAGCGGCGCTGCGGGGTAGGCTGCTTTCCTGAGGCCGGACTCAACGGGTCTCGGCTGAGCCACCGGGTGAG
CTCACCGCCCAGCCCAAACCAGGAGATTGCGAGGGAGCGATGCGGTGCAGCGCGTGTTCTTGGGGAAGATCCCGACTAAGCCATTTTCCA
GTGGCACCTCTTCCATCATGAGTTCCTGAGGCAGTCCGATGGGGCTACTTTATTCCAGAACAATCACAATTTGCTTGTAAATGCATCACG
AAGAGGCAGCCCAGAATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAA
ATTAAACCTGAAAACAGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGT
GATGACCTTTTAGCTGGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCA
GCATCTGCCCCTGCCATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGT
AATAAAGAATCCAGTTCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCT
AATGACATGGCATTGGCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATC
AGTGACAGAGCTGCTTTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAA
CTGCGAGACATGCGTGCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAG
CCGACTGATGTGGAGTCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGA
ATGTTAAAGGACAGGTTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGC
CCAGAAATCACCCCTGATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTC
TTGAGTCAGGATGAAAATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCC
CTCACATCGAGCGATGATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGC
GGGAATGCCAGTGAAGTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAG
GCAACCCTGCAAGAGCTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTG
ATGGAGTCTTTATGTCAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATT
TCTTATGTCATAGATGAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAA
CGGGAGCAGCTTCTTGGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGG
GCACTCAAAGAACGCAGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATAC
AAAGCCACAGTGGCCAGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCT
ATCCATAACTCTGGAGACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGC
TTGCAGGAAGATCTGGCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAA
GAAGAAGCTAAGAAACAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGAC
ATGAAAGAAACCATCTTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAG
AATACAGTTAAAAAACTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAA
TGGCGGCAGTTTCAGGCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAG
CGCCGGTTACATGAGGCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGC
CGGGTATACAATTACATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCA
GAGCCAACTCCTACAGTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACG
CCCCTGAGCCCAAGTCCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCC
AAACCCCTGACAGCCCTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGG
CCTGCTTCCCTGCCAAGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATT
TCTGCACAGGAGGGAGCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCT
GTGACTCCCACCACCCGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAAC
GCCTTGCTGAAGTGGTGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATGGGCTGGCC
TTCTGTGCCCTCCTGCATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCATGCTGGCT
TTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATT
CATAACAAGAAATCTCAAGCTTCCGTCAGTGCCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAG
CAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTC
CAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAG
ATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTG
CAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCA
CAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCT
CCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCT
CCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCT
CCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTC
CTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAAC
ACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCG
AAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTG
GACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCG
GTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGC
TCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGC
ACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTG
GTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCA
CTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAG
TCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTC
CACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGCAGGGATGGCCCGCAGCCTCATCGGGGCCAAGGACACACGCCTCCTGTCAGACA
CTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTAGGTTAGCTTTCCTGCTTTTATCTTCTGCCTTGGGGACCTGCCAAACGAAATCC
CACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCGGGTTGCTTGGGGGGCGTTGGCCGACTTCTTAGAGAAGGCCCTCCATGTGACTT
CCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTCACCGTGGCCTGTCCACGGTCCAGGTCCATCTCAGCAGCGTGAGGGTGCACTCA
GGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCACCCCTACTCGTTCCTATAGAACACAGAGGACATAGGAAACCCTTAAAACACACA
TGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATGCTGCTTTGGGCAGGTGGAGCACCCCCCGAGGAAGCCTGCAAGTCCAGGGCACA
GGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCTGCTGGCTCCCCGCCACCAGCTGGGCCTCAGCCCTCACGGCATTCCTGCTGAGC
ACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATCCTGCTGCCGGCACCCCTGTGCCGCTGGCATGAGGGCCGTGTCCCCACTGTGAA
GGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAGAGCACCACACACTGAGCACCCAGAGACAGCGGGCCTGGCAGCGGGCCGGGCCA
TGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGGGCACCGGCCAGCACCCTCTGGTGAGAAGAGGTCCCCCCTTTTTATGTGCACTA

>In-frame_SPECC1L_ENST00000314328_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_6568nt
GGAGGCCGGGCGGCCCGGCAAGCGGCGCTGCGGGGTAGGCTGCTTTCCTGAGGCCGGACTCAACGGGTCTCGGCTGAGCCACCGGGTGAG
CTCACCGCCCAGCCCAAACCAGGAGATTGCGAGGGAGCGATGCGGTGCAGCGCGTGTTCTTGGGGAAGATCCCGACTAAGCCATTTTCCA
GTGGCACCTCTTCCATCATGAGTTCCTGAGGCAGTCCGATGGGGCTACTTTATTCCAGAACAATCACAATTTGCTTGTAAATGCATCACG
AAGAGGCAGCCCAGAATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTGTCTGCAATAAGTAAAACGCAAACAGCAGAAAAA
ATTAAACCTGAAAACAGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGAACAGCAGCATCATTGTCAAAGACCAAGAGCAGT
GATGACCTTTTAGCTGGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGAAAGAAAAGCACCTGCCCATCTGCAGCACCTTCA
GCATCTGCCCCTGCCATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACAGCTTCTTCAACCAAGCGGAGCACTTCTACAGGT
AATAAAGAATCCAGTTCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAGAGCAAAAAACTACCTTCTGCAGGTCAGGGAGCT
AATGACATGGCATTGGCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTTCGTATGAGCAAGTCTAAGTCAGACAATCAGATC
AGTGACAGAGCTGCTTTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACCAAAGACGTAGAAATTTTACATTTGAGAAATGAA
CTGCGAGACATGCGTGCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAAAAATCTGAGAAGGAAACTATTATGGCTCACCAG
CCGACTGATGTGGAGTCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGTGAAGAACTCAACCAGCTGAAAAATGAAAACAGA
ATGTTAAAGGACAGGTTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAATTCTGAAAAACTGTTTGGCTATCAGTCCCTGAGC
CCAGAAATCACCCCTGATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTGGAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTC
TTGAGTCAGGATGAAAATACACTAATGGACCATCAGCACAGTAACTCCATGGACAATTTAGACAGTGAGTGCAGTGAGGTCTACCAGCCC
CTCACATCGAGCGATGATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATCCCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGC
GGGAATGCCAGTGAAGTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAAGAGAACCAACACAGTACAAGTGAGGAACTCCAG
GCAACCCTGCAAGAGCTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAAAACGAAAGGCTTGGAGAAGAGAAGGTTATTCTG
ATGGAGTCTTTATGTCAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAATACTTCCGCTCTCTTCTAGATGAGCATCACATT
TCTTATGTCATAGATGAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGTTACATGGACCTCGCTGAGAATGCCCGTTTTGAA
CGGGAGCAGCTTCTTGGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAACAAGACAATAAGGAAGCTCAAGAAATGATAGGG
GCACTCAAAGAACGCAGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGAAAAGCAGCCTTGGCAGCCACGTTAGAGGAATAC
AAAGCCACAGTGGCCAGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAGAATGAAAAGCAGAAAGTGGCAGAGCTGTATTCT
ATCCATAACTCTGGAGACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTGGACAAAGAAAAAGCAGAGACTTTGGCTAGTAGC
TTGCAGGAAGATCTGGCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATTGCTAAGGTAGAGGATGAATACCGAGCCTTCCAA
GAAGAAGCTAAGAAACAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCAGACCTGGATGAAAAAGAAACAGAAAGGAGTGAC
ATGAAAGAAACCATCTTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAACTTCATGACAACCTCATTATTTCTGATCTAGAG
AATACAGTTAAAAAACTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACACTCCACAGAAGACTTCGGGAAGAATCTGCGGAA
TGGCGGCAGTTTCAGGCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAATCTGAAGCCCAAGAGGAGATTGGTGATCTAAAG
CGCCGGTTACATGAGGCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAAATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGC
CGGGTATACAATTACATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGAATGGGACTGAGTAGAAGGTCCTCGACTTCCTCA
GAGCCAACTCCTACAGTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTACCAAACCCTGCTGCAGCTGCAATTCCTCGAACG
CCCCTGAGCCCAAGTCCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAGAGACATTCCATAAGTGGACCAATCTCAACATCC
AAACCCCTGACAGCCCTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAAGAGCATCTGTTAAGAACATCTTCAGCCAGCCGG
CCTGCTTCCCTGCCAAGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCTCGACGAAGTAGTGAAGAAGTGAAACGGGACATT
TCTGCACAGGAGGGAGCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCACAGCTTTCCCTGTCCTCTTCTCCAACGGCATCT
GTGACTCCCACCACCCGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCATTGGCCAGAGAATATGGAGGATCAAAGAGGAAC
GCCTTGCTGAAGTGGTGTCAGAAGAAAACAGAAGGCTATCAGAATATTGACATTACAAACTTCAGCAGCAGCTGGAATGATGGGCTGGCC
TTCTGTGCCCTCCTGCATACATATCTCCCTGCCCACATTCCATATCAAGAACTGAACAGCCAGGATAAGAGAAGGAACTTCATGCTGGCT
TTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGAGACATT
CATAACAAGAAATCTCAAGCTTCCGTCAGTGATCCTATGAATGCACTCCAGAGCCTGACTGGCGGACCTGCTGCGGGAGCCGCTGGAATT
GGCATGCCTCCTCGGGGCCCGGGACAGTCTCTGGGCGGGATGGGTAGCCTTGGTGCCATGGGACAGCCAATGTCTCTCTCAGGGCAGCCG
CCTCCTGGGACCTCGGGGATGGCCCCTCACAGCATGGCTGTCGTGTCTACGGCAACTCCACAGACCCAGCTGCAGCTCCAGCAGGTGGCG
CTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTC
CAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCAT
CTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAG
CAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAG
CCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCA
GTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTG
TATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCA
GTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGC
CAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTC
AGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAG
AACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAG
CAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGA
AAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAG
ATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAG
CCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATT
CACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAG
GGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAG
CTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGG
CAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTC
ACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGCAGGGATGGCCCGCAGCCTCA
TCGGGGCCAAGGACACACGCCTCCTGTCAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTAGGTTAGCTTTCCTGCTTTTA
TCTTCTGCCTTGGGGACCTGCCAAACGAAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCGGGTTGCTTGGGGGGCGTTGG
CCGACTTCTTAGAGAAGGCCCTCCATGTGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTCACCGTGGCCTGTCCACGGTC
CAGGTCCATCTCAGCAGCGTGAGGGTGCACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCACCCCTACTCGTTCCTATAGAA
CACAGAGGACATAGGAAACCCTTAAAACACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATGCTGCTTTGGGCAGGTGGAGC
ACCCCCCGAGGAAGCCTGCAAGTCCAGGGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCTGCTGGCTCCCCGCCACCAGC
TGGGCCTCAGCCCTCACGGCATTCCTGCTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATCCTGCTGCCGGCACCCCTGTG
CCGCTGGCATGAGGGCCGTGTCCCCACTGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAGAGCACCACACACTGAGCACC
CAGAGACAGCGGGCCTGGCAGCGGGCCGGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGGGCACCGGCCAGCACCCTCTG

>In-frame_SPECC1L_ENST00000541492_chr22_24808675_+_MED15_ENST00000425759_chr22_20905723_+_6090nt
TTTCCTGAGGCCGGACTCAACGGGTCTCGGCTGAGCCACCGGGTGAGCTCACCGCCCAGCCCAAACCAGGAGATTGCGAGGGAGCGATGC
GGTGCAGCGCGATTTGCTTGTAAATGCATCACGAAGAGGCAGCCCAGAATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTG
TCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAACAGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGA
ACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCTGGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGA
AAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCCATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACA
GCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGTTCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAG
AGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTGGCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTT
CGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCTTTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACC
AAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGTGCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAA
AAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAGTCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGT
GAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGGTTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAAT
TCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCTGATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTG
GAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAAAATACACTAATGGACCATCAGCACAGTAACTCCATGGACAAT
TTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGATGATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATC
CCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAAGTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAA
GAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAGCTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAA
AACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGTCAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAA
TACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGATGAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGT
TACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTTGGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAA
CAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGCAGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGA
AAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCCAGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAG
AATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGAGACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTG
GACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTGGCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATT
GCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAACAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCA
GACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATCTTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAA
CTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAACTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACA
CTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAGGCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAA
TCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAGGCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAA
ATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTACATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGA
ATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACAGTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTA
CCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGTCCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAG
AGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCCCTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAA
GAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCAAGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCT
CGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGAGCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCA
CAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACCCGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCA
TTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGGTGTCAGAAGAAAACAGAAGGCTATCAGAGAAGGAACTTCATG
CTGGCTTTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGA
GACATTCATAACAAGAAATCTCAAGCTTCCGTCAGTGCCCAGCTGCAGCTCCAGCAGGTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAG
TTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAG
CAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAGCAGCATCTAATTAAATTGCATCATCAAAATCAG
CAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAACAACAGCAACAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAGCCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAG
CAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAGCCTCCAGTTGCTCAGAACCAACCATCACAACTC
CCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAAATGTTGTATACCCAACCACCACTGAAATTTGTC
CGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAGACAGCAGTACAGACAGCTCAGGCTGCCCAGATG
GTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCACCGGGCCAGCAGGTGCAGACCCCGCAGTCGATG
CCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCCAACGTCAGCTCTGGCCCTGCCCCATCTCCCAGT
AGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACCCCACAGAACTTCAGTGTCCCCTCACCTGGACCT
TTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCTGAGGAGCAGCAGTACCTGGACAAGCTGAAGCAG
CTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAAGACAGAAAAAAGGACCTGAGTAAGATGAAGAGC
CTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAGTGTGAGATCGCCCTGGAGAAACTCAAGAATGAC
ATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTATGCCAGCCGCTCCTGGATGCCGTCCTGGCCAAC
ATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACCGCCATTCACGGCCCACCCATCACGGCCCCAGTG
GTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTGCTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAG
TTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATCTGCAAGCTGGATGACAAGGACCTCCCAAGTGTG
CCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATAGACCGGCAGTGGCAGTACGACGCCAACCCCTTC
CTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCACTCGGTCACCGCCTTGCTCAACACCTGGGCCCAG
AGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGCAGGGATGGCCCGCAGCCTCATCGGGGCCAAGGACACACGCCTCCTGT
CAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTAGGTTAGCTTTCCTGCTTTTATCTTCTGCCTTGGGGACCTGCCAAACG
AAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCGGGTTGCTTGGGGGGCGTTGGCCGACTTCTTAGAGAAGGCCCTCCATG
TGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTCACCGTGGCCTGTCCACGGTCCAGGTCCATCTCAGCAGCGTGAGGGTG
CACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCACCCCTACTCGTTCCTATAGAACACAGAGGACATAGGAAACCCTTAAAA
CACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATGCTGCTTTGGGCAGGTGGAGCACCCCCCGAGGAAGCCTGCAAGTCCAG
GGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCTGCTGGCTCCCCGCCACCAGCTGGGCCTCAGCCCTCACGGCATTCCTG
CTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATCCTGCTGCCGGCACCCCTGTGCCGCTGGCATGAGGGCCGTGTCCCCAC
TGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAGAGCACCACACACTGAGCACCCAGAGACAGCGGGCCTGGCAGCGGGCC
GGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGGGCACCGGCCAGCACCCTCTGGTGAGAAGAGGTCCCCCCTTTTTATGT

>In-frame_SPECC1L_ENST00000541492_chr22_24808675_+_MED15_ENST00000292733_chr22_20905723_+_6304nt
TTTCCTGAGGCCGGACTCAACGGGTCTCGGCTGAGCCACCGGGTGAGCTCACCGCCCAGCCCAAACCAGGAGATTGCGAGGGAGCGATGC
GGTGCAGCGCGATTTGCTTGTAAATGCATCACGAAGAGGCAGCCCAGAATGAAGAAAGCAAGCAGGAGTGTTGGCTCAGTGCCTAAAGTG
TCTGCAATAAGTAAAACGCAAACAGCAGAAAAAATTAAACCTGAAAACAGCTCTTCAGCATCTACGGGAGGCAAACTTGTAAAACCTGGA
ACAGCAGCATCATTGTCAAAGACCAAGAGCAGTGATGACCTTTTAGCTGGAATGGCCGGAGGGGTAACGGTGACTAATGGTGTTAAAGGA
AAGAAAAGCACCTGCCCATCTGCAGCACCTTCAGCATCTGCCCCTGCCATGACCACCGTGGAGAACAAATCCAAGATTAGCACAGGCACA
GCTTCTTCAACCAAGCGGAGCACTTCTACAGGTAATAAAGAATCCAGTTCTACTAGAGAAAGATTACGTGAACGTACCCGATTAAACCAG
AGCAAAAAACTACCTTCTGCAGGTCAGGGAGCTAATGACATGGCATTGGCCAAACGTTCCCGCAGTCGAACTGCTACAGAATGTGACGTT
CGTATGAGCAAGTCTAAGTCAGACAATCAGATCAGTGACAGAGCTGCTTTGGAGGCCAAAGTGAAGGATCTTCTCACGCTGGCAAAAACC
AAAGACGTAGAAATTTTACATTTGAGAAATGAACTGCGAGACATGCGTGCCCAGCTGGGCATTAATGAGGATCATTCTGAGGGTGATGAA
AAATCTGAGAAGGAAACTATTATGGCTCACCAGCCGACTGATGTGGAGTCCACTTTATTGCAGTTGCAGGAACAGAATACTGCCATCCGT
GAAGAACTCAACCAGCTGAAAAATGAAAACAGAATGTTAAAGGACAGGTTGAATGCATTGGGCTTTTCCCTAGAGCAGAGGTTAGACAAT
TCTGAAAAACTGTTTGGCTATCAGTCCCTGAGCCCAGAAATCACCCCTGATAACCAGAGCGATGGAGGAGGAACTCTGACTTCTTCAGTG
GAAGGCTCTGCCCCTGGCTCAGTGGAGGATCTCTTGAGTCAGGATGAAAATACACTAATGGACCATCAGCACAGTAACTCCATGGACAAT
TTAGACAGTGAGTGCAGTGAGGTCTACCAGCCCCTCACATCGAGCGATGATGCGCTGGATGCACCATCCTCCTCAGAGTCGGAAGGCATC
CCCAGCATAGAGCGCTCCCGGAAGGGGAGCAGCGGGAATGCCAGTGAAGTGTCCGTGGCTTGCCTGACTGAACGGATACACCAGATGGAA
GAGAACCAACACAGTACAAGTGAGGAACTCCAGGCAACCCTGCAAGAGCTAGCTGATTTACAGCAGATTACCCAGGAACTGAATAGTGAA
AACGAAAGGCTTGGAGAAGAGAAGGTTATTCTGATGGAGTCTTTATGTCAGCAGAGCGATAAGTTGGAACACTTTAGTCGACAGATTGAA
TACTTCCGCTCTCTTCTAGATGAGCATCACATTTCTTATGTCATAGATGAAGATGTAAAAAGTGGGCGCTATATGGAATTAGAGCAACGT
TACATGGACCTCGCTGAGAATGCCCGTTTTGAACGGGAGCAGCTTCTTGGTGTCCAGCAGCATTTAAGCAATACTTTGAAAATGGCAGAA
CAAGACAATAAGGAAGCTCAAGAAATGATAGGGGCACTCAAAGAACGCAGTCACCATATGGAGCGAATTATTGAGTCTGAGCAGAAAGGA
AAAGCAGCCTTGGCAGCCACGTTAGAGGAATACAAAGCCACAGTGGCCAGTGACCAGATAGAGATGAATCGCCTGAAGGCTCAGCTGGAG
AATGAAAAGCAGAAAGTGGCAGAGCTGTATTCTATCCATAACTCTGGAGACAAATCTGATATTCAGGACCTCCTGGAGAGTGTCAGGCTG
GACAAAGAAAAAGCAGAGACTTTGGCTAGTAGCTTGCAGGAAGATCTGGCTCATACCCGAAATGATGCCAATCGATTACAGGATGCCATT
GCTAAGGTAGAGGATGAATACCGAGCCTTCCAAGAAGAAGCTAAGAAACAAATTGAAGATTTGAATATGACGTTAGAAAAATTAAGATCA
GACCTGGATGAAAAAGAAACAGAAAGGAGTGACATGAAAGAAACCATCTTTGAACTTGAAGATGAAGTAGAACAACATCGTGCTGTGAAA
CTTCATGACAACCTCATTATTTCTGATCTAGAGAATACAGTTAAAAAACTCCAGGACCAAAAGCACGACATGGAAAGAGAAATAAAGACA
CTCCACAGAAGACTTCGGGAAGAATCTGCGGAATGGCGGCAGTTTCAGGCTGATCTCCAGACTGCAGTAGTCATTGCAAATGACATTAAA
TCTGAAGCCCAAGAGGAGATTGGTGATCTAAAGCGCCGGTTACATGAGGCTCAAGAAAAAAATGAGAAACTCACAAAAGAATTGGAGGAA
ATAAAGTCACGCAAGCAAGAGGAGGAGCGAGGCCGGGTATACAATTACATGAATGCCGTTGAGAGAGATTTGGCAGCCTTAAGGCAGGGA
ATGGGACTGAGTAGAAGGTCCTCGACTTCCTCAGAGCCAACTCCTACAGTAAAAACCCTCATCAAGTCCTTTGACAGTGCATCTCAAGTA
CCAAACCCTGCTGCAGCTGCAATTCCTCGAACGCCCCTGAGCCCAAGTCCTATGAAAACCCCTCCTGCAGCAGCTGTGTCCCCTATGCAG
AGACATTCCATAAGTGGACCAATCTCAACATCCAAACCCCTGACAGCCCTGTCAGATAAGAGACCAAACTATGGGGAAATCCCTGTTCAA
GAGCATCTGTTAAGAACATCTTCAGCCAGCCGGCCTGCTTCCCTGCCAAGAGTGCCTGCGATGGAAAGTGCCAAGACCCTCTCAGTGTCT
CGACGAAGTAGTGAAGAAGTGAAACGGGACATTTCTGCACAGGAGGGAGCGTCGCCAGCCTCTCTGATGGCTATGGGAACCACGTCTCCA
CAGCTTTCCCTGTCCTCTTCTCCAACGGCATCTGTGACTCCCACCACCCGAAGCCGAATAAGAGAAGAAAGGAAAGACCCTCTCTCAGCA
TTGGCCAGAGAATATGGAGGATCAAAGAGGAACGCCTTGCTGAAGTGGTGTCAGAAGAAAACAGAAGGCTATCAGAGAAGGAACTTCATG
CTGGCTTTCCAGGCAGCTGAAAGTGTCGGCATCAAATCCACACTGGACGAATACCTTTCTCTCGTGGCCAGGCTCATTATCCATTTTCGA
GACATTCATAACAAGAAATCTCAAGCTTCCGTCAGTGATCCTATGAATGCACTCCAGAGCCTGACTGGCGGACCTGCTGCGGGAGCCGCT
GGAATTGGCATGCCTCCTCGGGGCCCGGGACAGTCTCTGGGCGGGATGGGTAGCCTTGGTGCCATGGGACAGCCAATGTCTCTCTCAGGG
CAGCCGCCTCCTGGGACCTCGGGGATGGCCCCTCACAGCATGGCTGTCGTGTCTACGGCAACTCCACAGACCCAGCTGCAGCTCCAGCAG
GTGGCGCTGCAGCAGCAGCAGCAACAGCAGCAGTTCCAGCAGCAGCAGCAGGCGGCGCTACAGCAGCAGCAGCAGCAGCAGCAACAGCAG
CAGTTCCAGGCTCAGCAGAGTGCCATGCAGCAGCAGTTCCAAGCAGTAGTGCAGCAGCAGCAGCAGCTCCAGCAGCAGCAGCAGCAGCAG
CAGCATCTAATTAAATTGCATCATCAAAATCAGCAACAGATACAGCAGCAGCAACAGCAGCTGCAGCGAATAGCACAGCTGCAGCTCCAA
CAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTTTGCAGGCCCAGCCACCAATTCAGCAGCCACCGATGCAGCAG
CCACAGCCTCCGCCCTCCCAGGCTCTGCCCCAGCAGCTGCAGCAGATGCATCACACACAGCACCACCAGCCGCCACCACAGCCCCAGCAG
CCTCCAGTTGCTCAGAACCAACCATCACAACTCCCGCCACAGTCGCAGACCCAGCCTTTGGTGTCACAGGCGCAAGCTCTCCCTGGACAA
ATGTTGTATACCCAACCACCACTGAAATTTGTCCGAGCTCCGATGGTGGTGCAGCAGCCCCCAGTGCAGCCCCAGGTGCAGCAGCAGCAG
ACAGCAGTACAGACAGCTCAGGCTGCCCAGATGGTGGCTCCCGGAGTCCAGGTCAGCCAGAGCAGCCTCCCCATGCTGTCCTCGCCGTCA
CCGGGCCAGCAGGTGCAGACCCCGCAGTCGATGCCCCCTCCCCCCCAGCCGTCCCCGCAGCCCGGCCAGCCCAGCTCACAGCCCAACTCC
AACGTCAGCTCTGGCCCTGCCCCATCTCCCAGTAGCTTCCTGCCCAGCCCCTCACCGCAGCCCTCCCAGAGCCCAGTGACGGCGCGGACC
CCACAGAACTTCAGTGTCCCCTCACCTGGACCTTTAAACACACCTGTGAACCCCAGCTCTGTCATGAGCCCAGCTGGCTCCAGCCAGGCT
GAGGAGCAGCAGTACCTGGACAAGCTGAAGCAGCTGTCGAAGTACATCGAGCCCCTGCGCCGCATGATCAACAAGATCGACAAGAACGAA
GACAGAAAAAAGGACCTGAGTAAGATGAAGAGCCTTCTGGACATTCTGACAGACCCCTCGAAGCGGTGTCCCCTGAAGACCTTGCAAAAG
TGTGAGATCGCCCTGGAGAAACTCAAGAATGACATGGCGGTGCCCACTCCCCCACCGCCCCCGGTGCCACCGACCAAACAGCAGTACCTA
TGCCAGCCGCTCCTGGATGCCGTCCTGGCCAACATCCGCTCACCTGTCTTCAACCATTCCCTGTACCGCACATTCGTTCCAGCCATGACC
GCCATTCACGGCCCACCCATCACGGCCCCAGTGGTGTGCACCCGGAAGCGCAGGCTTGAGGATGATGAGCGGCAGAGCATCCCCAGTGTG
CTCCAGGGTGAGGTGGCCAGGCTGGACCCCAAGTTCCTGGTAAACCTGGACCCTTCTCACTGCAGCAACAATGGCACTGTCCACCTGATC
TGCAAGCTGGATGACAAGGACCTCCCAAGTGTGCCACCACTGGAGCTCAGTGTGCCCGCTGACTATCCTGCCCAAAGCCCGCTGTGGATA
GACCGGCAGTGGCAGTACGACGCCAACCCCTTCCTCCAGTCGGTGCACCGCTGCATGACCTCCAGGCTGCTGCAGCTCCCGGACAAGCAC
TCGGTCACCGCCTTGCTCAACACCTGGGCCCAGAGCGTCCACCAGGCCTGCCTCTCAGCCGCCTAGCCAAGACTGCAGGGATGGCCCGCA
GCCTCATCGGGGCCAAGGACACACGCCTCCTGTCAGACACTTCTAGGTGTTGGCTTCCTTAGAGAGCCTGGGGTTAGGTTAGCTTTCCTG
CTTTTATCTTCTGCCTTGGGGACCTGCCAAACGAAATCCCACACCTGTACAGAACTGGGATAGGCGCAGTGGAGCGGGTTGCTTGGGGGG
CGTTGGCCGACTTCTTAGAGAAGGCCCTCCATGTGACTTCCTCCCAGGAGCCAGATGCGATCCTCAGGCTGCTCTCACCGTGGCCTGTCC
ACGGTCCAGGTCCATCTCAGCAGCGTGAGGGTGCACTCAGGGTGTTGTTAGAGCGTCTCGTGTGTGCTAGACGCACCCCTACTCGTTCCT
ATAGAACACAGAGGACATAGGAAACCCTTAAAACACACATGGGATTCTCTGGTCACAGTTTTGGGTTCAGGCTATGCTGCTTTGGGCAGG
TGGAGCACCCCCCGAGGAAGCCTGCAAGTCCAGGGCACAGGCTGCCTTTTGGAGGGAGGGCTGGCCCATAGGTGCTGCTGGCTCCCCGCC
ACCAGCTGGGCCTCAGCCCTCACGGCATTCCTGCTGAGCACCGTGGGGCACCCAGGGAGCAGGGGCGTCAGGGATCCTGCTGCCGGCACC
CCTGTGCCGCTGGCATGAGGGCCGTGTCCCCACTGTGAAGGATGAAGAGCAAGGCCCTCAGGACCCGTGTCCTCAGAGCACCACACACTG
AGCACCCAGAGACAGCGGGCCTGGCAGCGGGCCGGGCCATGCAGGGAGCGCCTCCCTATGTTGCCTGCCACTCTGGGCACCGGCCAGCAC
CCTCTGGTGAGAAGAGGTCCCCCCTTTTTATGTGCACTACCCCACCATCTGTGATTATAATAAATTTATTATTCCTGTGTTTGTCAGTTG


Top

FusionGenePPI for SPECC1L_MED15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SPECC1LAPC, UBE2I, GLIS2, FBXO25, KIAA0368, UBC, PAN2, CCDC8, LUZP4, SLC25A41, ZNF219, KCTD17, FSD1, NFKBIA, LRFN4, RCN1, OBFC1, AP2M1, CHRNA9, SLC30A6, SPC25, HERC2, CAPZA2, CDK2, DBN1, MYH9, PPP1CB, IQGAP1, PDLIM7, SYNPO, ANLN, MYO5C, MYO19, MYO18A, C10orf2, LPXN, VAV1, ATMIN, ZNF785, G2E3, DUSP22, FEZ1, CCNJ, FSCN2, RPL15, G3BP1MED15MLLT6, PLSCR1, FHL3, MED10, MED9, MED29, MED19, MED28, MED26, MED25, MED6, ATP5C1, MED1, TRIM11, SMAD1, SMAD2, SMAD3, TRRAP, RELA, SREBF1, MED12, MED18, ZC3H13, TRIP4, QKI, TADA2A, CDK8, MED13, MED14, MED23, MED16, MED17, MED7, CTDP1, ATXN1, IGBP1, UBAP2L, SEC24C, CHEK1, NCOA6, FBXW7, EPAS1, CDK19, CCNC, NR1I3, ALDH8A1, TCL1B, HIF1A, MED11, MED20, MED24, MED27, MED4, MED8, EWSR1, MYO1C, POLR2F, POLR2G, CTDSPL2, MED21, UBE2N, TP73


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneMED15chr22:24808675chr22:20905723ENST00000263205+1189_7352789SREBF1
TgeneMED15chr22:24808675chr22:20905723ENST00000292733+1179_7352749SREBF1
TgeneMED15chr22:24808675chr22:20905723ENST00000382974+1169_7352678SREBF1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SPECC1L_MED15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SPECC1L_MED15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSPECC1LC1801950Opitz-G syndrome, type 21ORPHANET;UNIPROT
HgeneSPECC1LC1838348Oculomaxillofacial dysostosis1ORPHANET;UNIPROT
TgeneMED15C0036341Schizophrenia2PSYGENET
TgeneMED15C0036337Schizoaffective Disorder1PSYGENET