FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35504

FusionGeneSummary for SP4_GPNMB

check button Fusion gene summary
Fusion gene informationFusion gene name: SP4_GPNMB
Fusion gene ID: 35504
HgeneTgene
Gene symbol

SP4

GPNMB

Gene ID

6671

10457

Gene nameSp4 transcription factorglycoprotein nmb
SynonymsHF1B|SPR-1HGFIN|NMB|PLCA3
Cytomap

7p15.3

7p15.3

Type of geneprotein-codingprotein-coding
Descriptiontranscription factor Sp4transmembrane glycoprotein NMBglycoprotein (transmembrane) nmbglycoprotein nmb-like proteinglycoprotein nonmetastatic melanoma protein Bhematopoietic growth factor inducible neurokinin-1osteoactivintransmembrane glycoprotein HGFIN
Modification date2018052320180523
UniProtAcc

Q02446

Q14956

Ensembl transtripts involved in fusion geneENST00000222584, ENST00000258733, 
ENST00000381990, ENST00000409458, 
ENST00000539136, ENST00000453162, 
ENST00000478451, 
Fusion gene scores* DoF score1 X 2 X 1=23 X 3 X 3=27
# samples 13
** MAII scorelog2(1/2*10)=2.32192809488736log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SP4 [Title/Abstract] AND GPNMB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSP4

GO:0006357

regulation of transcription by RNA polymerase II

12560508

TgeneGPNMB

GO:0001818

negative regulation of cytokine production

19350579

TgeneGPNMB

GO:0001934

positive regulation of protein phosphorylation

22891158

TgeneGPNMB

GO:0030335

positive regulation of cell migration

20711474

TgeneGPNMB

GO:0031954

positive regulation of protein autophosphorylation

19350579

TgeneGPNMB

GO:0034103

regulation of tissue remodeling

25010402

TgeneGPNMB

GO:0042130

negative regulation of T cell proliferation

19350579

TgeneGPNMB

GO:2000134

negative regulation of G1/S transition of mitotic cell cycle

19350579


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-28-1747-01CSP4chr7

21468410

+GPNMBchr7

23313140

+
TCGALDGBMTCGA-28-1747-01CSP4chr7

21469210

+GPNMBchr7

23313140

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000222584ENST00000258733SP4chr7

21468410

+GPNMBchr7

23313140

+
Frame-shitENST00000222584ENST00000381990SP4chr7

21468410

+GPNMBchr7

23313140

+
5CDS-intronENST00000222584ENST00000409458SP4chr7

21468410

+GPNMBchr7

23313140

+
5CDS-intronENST00000222584ENST00000539136SP4chr7

21468410

+GPNMBchr7

23313140

+
5CDS-intronENST00000222584ENST00000453162SP4chr7

21468410

+GPNMBchr7

23313140

+
5CDS-3UTRENST00000222584ENST00000478451SP4chr7

21468410

+GPNMBchr7

23313140

+
In-frameENST00000222584ENST00000258733SP4chr7

21469210

+GPNMBchr7

23313140

+
In-frameENST00000222584ENST00000381990SP4chr7

21469210

+GPNMBchr7

23313140

+
5CDS-intronENST00000222584ENST00000409458SP4chr7

21469210

+GPNMBchr7

23313140

+
5CDS-intronENST00000222584ENST00000539136SP4chr7

21469210

+GPNMBchr7

23313140

+
5CDS-intronENST00000222584ENST00000453162SP4chr7

21469210

+GPNMBchr7

23313140

+
5CDS-3UTRENST00000222584ENST00000478451SP4chr7

21469210

+GPNMBchr7

23313140

+

Top

FusionProtFeatures for SP4_GPNMB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SP4

Q02446

GPNMB

Q14956

Binds to GT and GC boxes promoters elements. Probabletranscriptional activator. Could be a melanogenic enzyme. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGPNMBchr7:21469210chr7:23313140ENST00000258733+811508_572476561Topological domainCytoplasmic
TgeneGPNMBchr7:21469210chr7:23313140ENST00000381990+811508_572488573Topological domainCytoplasmic
TgeneGPNMBchr7:21469210chr7:23313140ENST00000258733+811487_507476561TransmembraneHelical
TgeneGPNMBchr7:21469210chr7:23313140ENST00000381990+811487_507488573TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+16122_130-73785Compositional biasNote=Poly-Ser
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+1612_19-73785Compositional biasNote=Poly-Ala
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+16185_188-73785Compositional biasNote=Poly-Ser
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+167_11-73785Compositional biasNote=Poly-Glu
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+16647_671-73785Zinc fingerC2H2-type 1
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+16677_701-73785Zinc fingerC2H2-type 2
HgeneSP4chr7:21469210chr7:23313140ENST00000222584+16707_729-73785Zinc fingerC2H2-type 3
TgeneGPNMBchr7:21469210chr7:23313140ENST00000258733+811320_332476561Compositional biasNote=Poly-Pro
TgeneGPNMBchr7:21469210chr7:23313140ENST00000381990+811320_332488573Compositional biasNote=Poly-Pro
TgeneGPNMBchr7:21469210chr7:23313140ENST00000258733+811240_327476561DomainPKD
TgeneGPNMBchr7:21469210chr7:23313140ENST00000381990+811240_327488573DomainPKD
TgeneGPNMBchr7:21469210chr7:23313140ENST00000258733+81164_66476561MotifCell attachment site
TgeneGPNMBchr7:21469210chr7:23313140ENST00000381990+81164_66488573MotifCell attachment site
TgeneGPNMBchr7:21469210chr7:23313140ENST00000258733+81122_486476561Topological domainExtracellular
TgeneGPNMBchr7:21469210chr7:23313140ENST00000381990+81122_486488573Topological domainExtracellular


Top

FusionGeneSequence for SP4_GPNMB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SP4_ENST00000222584_chr7_21469210_+_GPNMB_ENST00000258733_chr7_23313140_+_644aa
MSDQKKEEEEEAAAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPGENQATGQQQIIIDPSQGLVQLQNQPQQL
ELVTTQLAGNAWQLVASTPPASKENNVSQPASSSSSSSSSNNGSASPTKTKSGNSSTPGQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQ
INPTSSSSLQDLQGQIQLISAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTLPGTQAQVVTTLPINIGGVTLALPV
INNVAAGGGTGQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQTASTSASSSERTIE
ESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQPLQNVQLQAVN
PTQVLIRAPTLTPSGQISWQTVQVQNIQSLSNLQVQNAGLSQQLTITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVAN
LGAAGVQVQGVPVTITSVADPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEK

>In-frame_SP4_ENST00000222584_chr7_21469210_+_GPNMB_ENST00000381990_chr7_23313140_+_644aa
MSDQKKEEEEEAAAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPGENQATGQQQIIIDPSQGLVQLQNQPQQL
ELVTTQLAGNAWQLVASTPPASKENNVSQPASSSSSSSSSNNGSASPTKTKSGNSSTPGQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQ
INPTSSSSLQDLQGQIQLISAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTLPGTQAQVVTTLPINIGGVTLALPV
INNVAAGGGTGQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQTASTSASSSERTIE
ESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQPLQNVQLQAVN
PTQVLIRAPTLTPSGQISWQTVQVQNIQSLSNLQVQNAGLSQQLTITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVAN
LGAAGVQVQGVPVTITSVADPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SP4_ENST00000222584_chr7_21469210_+_GPNMB_ENST00000258733_chr7_23313140_+_1932nt
ATGAGCGATCAGAAGAAGGAGGAGGAGGAGGAGGCGGCAGCGGCAGCGGCGATGGCTACAGAAGGAGGGAAAACCTCTGAGCCAGAGAAT
AACAATAAAAAACCCAAAACCTCAGGCTCCCAGGACTCTCAGCCCTCTCCTCTGGCTTTACTGGCAGCTACTTGCAGCAAAATAGGGACT
CCTGGTGAAAATCAAGCAACTGGACAACAACAAATTATTATAGATCCAAGTCAAGGATTGGTGCAACTTCAAAATCAACCACAACAGCTA
GAACTGGTAACAACGCAACTTGCTGGAAACGCTTGGCAACTTGTTGCCTCCACTCCTCCTGCTTCAAAAGAGAATAACGTTTCTCAACCA
GCCTCTAGTTCGTCTAGTTCTTCCAGCAGTAATAACGGGAGTGCATCTCCTACAAAAACTAAATCAGGTAATTCTTCCACCCCTGGTCAA
TTTCAAGTCATACAAGTACAAAATCCAAGTGGTAGTGTACAGTACCAAGTAATTCCACAACTTCAGACAGTGGAAGGTCAACAAATTCAA
ATCAATCCAACTAGTAGTTCATCTCTACAGGATTTGCAGGGTCAAATTCAGCTCATTTCTGCAGGTAATAATCAAGCTATACTCACAGCT
GCTAACAGGACAGCTTCTGGGAATATTCTTGCTCAAAACCTGGCAAATCAGACAGTTCCGGTCCAAATTAGACCTGGTGTTTCAATACCA
CTGCAGTTACAGACTCTTCCTGGTACTCAGGCTCAAGTTGTAACAACCCTACCAATTAACATTGGAGGAGTGACTCTAGCTTTGCCAGTG
ATAAACAACGTGGCTGCCGGAGGAGGGACTGGGCAGGTTGGCCAGCCTGCTGCTACTGCTGATAGTGGGACTTCCAATGGGAATCAATTA
GTTTCCACACCCACCAACACCACTACTTCTGCCAGTACTATGCCAGAATCTCCCTCCTCCTCCACTACCTGCACAACCACTGCTTCAACG
TCTTTGACAAGCAGTGACACATTAGTGAGCTCAGCAGATACTGGCCAGTATGCAAGCACATCAGCCAGTAGTTCTGAACGCACCATTGAA
GAATCTCAAACACCTGCTGCTACTGAGTCTGAAGCCCAGAGCTCCAGTCAGCTTCAGCCTAATGGAATGCAGAATGCACAGGATCAATCA
AATTCTCTTCAGCAGGTGCAAATTGTAGGCCAACCTATCTTACAGCAGATCCAGATCCAACAGCCTCAGCAACAGATCATTCAGGCTATT
CCACCACAGTCGTTTCAACTCCAGTCAGGGCAGACGATTCAGACCATCCAGCAGCAGCCTTTACAGAATGTTCAACTTCAAGCAGTAAAT
CCGACTCAGGTGCTTATCAGGGCTCCAACTTTAACACCTTCAGGGCAAATCAGTTGGCAAACTGTACAGGTTCAGAATATTCAGAGTCTT
TCAAATTTGCAAGTTCAGAATGCTGGGTTATCCCAACAATTAACCATCACCCCAGTGTCTTCAAGTGGTGGCACAACTCTTGCTCAGATT
GCTCCTGTGGCTGTTGCTGGTGCCCCAATAACTTTGAATACTGCCCAGCTTGCATCAGTGCCTAACCTTCAGACAGTGAGCGTTGCCAAC
CTGGGTGCTGCAGGTGTTCAAGTGCAGGGAGTTCCCGTTACAATCACTAGTGTTGCAGACCCAGCCTCGCCTTTAAGGATGGCAAACAGT
GCCCTGATCTCCGTTGGCTGCTTGGCCATATTTGTCACTGTGATCTCCCTCTTGGTGTACAAAAAACACAAGGAATACAACCCAATAGAA
AATAGTCCTGGGAATGTGGTCAGAAGCAAAGGCCTGAGTGTCTTTCTCAACCGTGCAAAAGCCGTGTTCTTCCCGGGAAACCAGGAAAAG

>In-frame_SP4_ENST00000222584_chr7_21469210_+_GPNMB_ENST00000381990_chr7_23313140_+_1932nt
ATGAGCGATCAGAAGAAGGAGGAGGAGGAGGAGGCGGCAGCGGCAGCGGCGATGGCTACAGAAGGAGGGAAAACCTCTGAGCCAGAGAAT
AACAATAAAAAACCCAAAACCTCAGGCTCCCAGGACTCTCAGCCCTCTCCTCTGGCTTTACTGGCAGCTACTTGCAGCAAAATAGGGACT
CCTGGTGAAAATCAAGCAACTGGACAACAACAAATTATTATAGATCCAAGTCAAGGATTGGTGCAACTTCAAAATCAACCACAACAGCTA
GAACTGGTAACAACGCAACTTGCTGGAAACGCTTGGCAACTTGTTGCCTCCACTCCTCCTGCTTCAAAAGAGAATAACGTTTCTCAACCA
GCCTCTAGTTCGTCTAGTTCTTCCAGCAGTAATAACGGGAGTGCATCTCCTACAAAAACTAAATCAGGTAATTCTTCCACCCCTGGTCAA
TTTCAAGTCATACAAGTACAAAATCCAAGTGGTAGTGTACAGTACCAAGTAATTCCACAACTTCAGACAGTGGAAGGTCAACAAATTCAA
ATCAATCCAACTAGTAGTTCATCTCTACAGGATTTGCAGGGTCAAATTCAGCTCATTTCTGCAGGTAATAATCAAGCTATACTCACAGCT
GCTAACAGGACAGCTTCTGGGAATATTCTTGCTCAAAACCTGGCAAATCAGACAGTTCCGGTCCAAATTAGACCTGGTGTTTCAATACCA
CTGCAGTTACAGACTCTTCCTGGTACTCAGGCTCAAGTTGTAACAACCCTACCAATTAACATTGGAGGAGTGACTCTAGCTTTGCCAGTG
ATAAACAACGTGGCTGCCGGAGGAGGGACTGGGCAGGTTGGCCAGCCTGCTGCTACTGCTGATAGTGGGACTTCCAATGGGAATCAATTA
GTTTCCACACCCACCAACACCACTACTTCTGCCAGTACTATGCCAGAATCTCCCTCCTCCTCCACTACCTGCACAACCACTGCTTCAACG
TCTTTGACAAGCAGTGACACATTAGTGAGCTCAGCAGATACTGGCCAGTATGCAAGCACATCAGCCAGTAGTTCTGAACGCACCATTGAA
GAATCTCAAACACCTGCTGCTACTGAGTCTGAAGCCCAGAGCTCCAGTCAGCTTCAGCCTAATGGAATGCAGAATGCACAGGATCAATCA
AATTCTCTTCAGCAGGTGCAAATTGTAGGCCAACCTATCTTACAGCAGATCCAGATCCAACAGCCTCAGCAACAGATCATTCAGGCTATT
CCACCACAGTCGTTTCAACTCCAGTCAGGGCAGACGATTCAGACCATCCAGCAGCAGCCTTTACAGAATGTTCAACTTCAAGCAGTAAAT
CCGACTCAGGTGCTTATCAGGGCTCCAACTTTAACACCTTCAGGGCAAATCAGTTGGCAAACTGTACAGGTTCAGAATATTCAGAGTCTT
TCAAATTTGCAAGTTCAGAATGCTGGGTTATCCCAACAATTAACCATCACCCCAGTGTCTTCAAGTGGTGGCACAACTCTTGCTCAGATT
GCTCCTGTGGCTGTTGCTGGTGCCCCAATAACTTTGAATACTGCCCAGCTTGCATCAGTGCCTAACCTTCAGACAGTGAGCGTTGCCAAC
CTGGGTGCTGCAGGTGTTCAAGTGCAGGGAGTTCCCGTTACAATCACTAGTGTTGCAGACCCAGCCTCGCCTTTAAGGATGGCAAACAGT
GCCCTGATCTCCGTTGGCTGCTTGGCCATATTTGTCACTGTGATCTCCCTCTTGGTGTACAAAAAACACAAGGAATACAACCCAATAGAA
AATAGTCCTGGGAATGTGGTCAGAAGCAAAGGCCTGAGTGTCTTTCTCAACCGTGCAAAAGCCGTGTTCTTCCCGGGAAACCAGGAAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SP4_ENST00000222584_chr7_21469210_+_GPNMB_ENST00000258733_chr7_23313140_+_3124nt
GGCTGGGCGGGGCCGGGAAGCGGCAGTGGCGGCTACGCGCGCGGGGGTGCGCGCGGGAACGACCGGGAAACACCGCGAGGGCCGGGGTGG
GCCAGGCTGTGGGGACGACGGGCTGCGACGATGGCCGCAGCGGCGGGCGGCGGCGGGCCGGGGACAGCGGTAGGCGCCACGGGCTCGGGG
ATTGCGGCGGCAGCCGCAGGCCTAGCTGTTTATCGACGGAAGGATGGGGGCCCGGCCACCAAGTTTTGGGAGAGCCCGGAGACGGTGTCC
CAGCTGGATTCGGTGCGGGTCTGGCTGGGCAAGCACTACAAGAAGATCAGAAGAAGGAGGAGGAGGAGGAGGCGGCAGCGGCAGCGGCGA
TGGCTACAGAAGGAGGGAAAACCTCTGAGCCAGAGAATAACAATAAAAAACCCAAAACCTCAGGCTCCCAGGACTCTCAGCCCTCTCCTC
TGGCTTTACTGGCAGCTACTTGCAGCAAAATAGGGACTCCTGGTGAAAATCAAGCAACTGGACAACAACAAATTATTATAGATCCAAGTC
AAGGATTGGTGCAACTTCAAAATCAACCACAACAGCTAGAACTGGTAACAACGCAACTTGCTGGAAACGCTTGGCAACTTGTTGCCTCCA
CTCCTCCTGCTTCAAAAGAGAATAACGTTTCTCAACCAGCCTCTAGTTCGTCTAGTTCTTCCAGCAGTAATAACGGGAGTGCATCTCCTA
CAAAAACTAAATCAGGTAATTCTTCCACCCCTGGTCAATTTCAAGTCATACAAGTACAAAATCCAAGTGGTAGTGTACAGTACCAAGTAA
TTCCACAACTTCAGACAGTGGAAGGTCAACAAATTCAAATCAATCCAACTAGTAGTTCATCTCTACAGGATTTGCAGGGTCAAATTCAGC
TCATTTCTGCAGGTAATAATCAAGCTATACTCACAGCTGCTAACAGGACAGCTTCTGGGAATATTCTTGCTCAAAACCTGGCAAATCAGA
CAGTTCCGGTCCAAATTAGACCTGGTGTTTCAATACCACTGCAGTTACAGACTCTTCCTGGTACTCAGGCTCAAGTTGTAACAACCCTAC
CAATTAACATTGGAGGAGTGACTCTAGCTTTGCCAGTGATAAACAACGTGGCTGCCGGAGGAGGGACTGGGCAGGTTGGCCAGCCTGCTG
CTACTGCTGATAGTGGGACTTCCAATGGGAATCAATTAGTTTCCACACCCACCAACACCACTACTTCTGCCAGTACTATGCCAGAATCTC
CCTCCTCCTCCACTACCTGCACAACCACTGCTTCAACGTCTTTGACAAGCAGTGACACATTAGTGAGCTCAGCAGATACTGGCCAGTATG
CAAGCACATCAGCCAGTAGTTCTGAACGCACCATTGAAGAATCTCAAACACCTGCTGCTACTGAGTCTGAAGCCCAGAGCTCCAGTCAGC
TTCAGCCTAATGGAATGCAGAATGCACAGGATCAATCAAATTCTCTTCAGCAGGTGCAAATTGTAGGCCAACCTATCTTACAGCAGATCC
AGATCCAACAGCCTCAGCAACAGATCATTCAGGCTATTCCACCACAGTCGTTTCAACTCCAGTCAGGGCAGACGATTCAGACCATCCAGC
AGCAGCCTTTACAGAATGTTCAACTTCAAGCAGTAAATCCGACTCAGGTGCTTATCAGGGCTCCAACTTTAACACCTTCAGGGCAAATCA
GTTGGCAAACTGTACAGGTTCAGAATATTCAGAGTCTTTCAAATTTGCAAGTTCAGAATGCTGGGTTATCCCAACAATTAACCATCACCC
CAGTGTCTTCAAGTGGTGGCACAACTCTTGCTCAGATTGCTCCTGTGGCTGTTGCTGGTGCCCCAATAACTTTGAATACTGCCCAGCTTG
CATCAGTGCCTAACCTTCAGACAGTGAGCGTTGCCAACCTGGGTGCTGCAGGTGTTCAAGTGCAGGGAGTTCCCGTTACAATCACTAGTG
TTGCAGACCCAGCCTCGCCTTTAAGGATGGCAAACAGTGCCCTGATCTCCGTTGGCTGCTTGGCCATATTTGTCACTGTGATCTCCCTCT
TGGTGTACAAAAAACACAAGGAATACAACCCAATAGAAAATAGTCCTGGGAATGTGGTCAGAAGCAAAGGCCTGAGTGTCTTTCTCAACC
GTGCAAAAGCCGTGTTCTTCCCGGGAAACCAGGAAAAGGATCCGCTACTCAAAAACCAAGAATTTAAAGGAGTTTCTTAAATTTCGACCT
TGTTTCTGAAGCTCACTTTTCAGTGCCATTGATGTGAGATGTGCTGGAGTGGCTATTAACCTTTTTTTCCTAAAGATTATTGTTAAATAG
ATATTGTGGTTTGGGGAAGTTGAATTTTTTATAGGTTAAATGTCATTTTAGAGATGGGGAGAGGGATTATACTGCAGGCAGCTTCAGCCA
TGTTGTGAAACTGATAAAAGCAACTTAGCAAGGCTTCTTTTCATTATTTTTTATGTTTCACTTATAAAGTCTTAGGTAACTAGTAGGATA
GAAACACTGTGTCCCGAGAGTAAGGAGAGAAGCTACTATTGATTAGAGCCTAACCCAGGTTAACTGCAAGAAGAGGCGGGATACTTTCAG
CTTTCCATGTAACTGTATGCATAAAGCCAATGTAGTCCAGTTTCTAAGATCATGTTCCAAGCTAACTGAATCCCACTTCAATACACACTC
ATGAACTCCTGATGGAACAATAACAGGCCCAAGCCTGTGGTATGATGTGCACACTTGCTAGACTCAGAAAAAATACTACTCTCATAAATG
GGTGGGAGTATTTTGGTGACAACCTACTTTGCTTGGCTGAGTGAAGGAATGATATTCATATATTCATTTATTCCATGGACATTTAGTTAG
TGCTTTTTATATACCAGGCATGATGCTGAGTGACACTCTTGTGTATATTTCCAAATTTTTGTACAGTCGCTGCACATATTTGAAATCATA
TATTAAGACTTTCCAAAGATGAGGTCCCTGGTTTTTCATGGCAACTTGATCAGTAAGGATTTCACCTCTGTTTGTAACTAAAACCATCTA

>In-frame_SP4_ENST00000222584_chr7_21469210_+_GPNMB_ENST00000381990_chr7_23313140_+_3123nt
GGCTGGGCGGGGCCGGGAAGCGGCAGTGGCGGCTACGCGCGCGGGGGTGCGCGCGGGAACGACCGGGAAACACCGCGAGGGCCGGGGTGG
GCCAGGCTGTGGGGACGACGGGCTGCGACGATGGCCGCAGCGGCGGGCGGCGGCGGGCCGGGGACAGCGGTAGGCGCCACGGGCTCGGGG
ATTGCGGCGGCAGCCGCAGGCCTAGCTGTTTATCGACGGAAGGATGGGGGCCCGGCCACCAAGTTTTGGGAGAGCCCGGAGACGGTGTCC
CAGCTGGATTCGGTGCGGGTCTGGCTGGGCAAGCACTACAAGAAGATCAGAAGAAGGAGGAGGAGGAGGAGGCGGCAGCGGCAGCGGCGA
TGGCTACAGAAGGAGGGAAAACCTCTGAGCCAGAGAATAACAATAAAAAACCCAAAACCTCAGGCTCCCAGGACTCTCAGCCCTCTCCTC
TGGCTTTACTGGCAGCTACTTGCAGCAAAATAGGGACTCCTGGTGAAAATCAAGCAACTGGACAACAACAAATTATTATAGATCCAAGTC
AAGGATTGGTGCAACTTCAAAATCAACCACAACAGCTAGAACTGGTAACAACGCAACTTGCTGGAAACGCTTGGCAACTTGTTGCCTCCA
CTCCTCCTGCTTCAAAAGAGAATAACGTTTCTCAACCAGCCTCTAGTTCGTCTAGTTCTTCCAGCAGTAATAACGGGAGTGCATCTCCTA
CAAAAACTAAATCAGGTAATTCTTCCACCCCTGGTCAATTTCAAGTCATACAAGTACAAAATCCAAGTGGTAGTGTACAGTACCAAGTAA
TTCCACAACTTCAGACAGTGGAAGGTCAACAAATTCAAATCAATCCAACTAGTAGTTCATCTCTACAGGATTTGCAGGGTCAAATTCAGC
TCATTTCTGCAGGTAATAATCAAGCTATACTCACAGCTGCTAACAGGACAGCTTCTGGGAATATTCTTGCTCAAAACCTGGCAAATCAGA
CAGTTCCGGTCCAAATTAGACCTGGTGTTTCAATACCACTGCAGTTACAGACTCTTCCTGGTACTCAGGCTCAAGTTGTAACAACCCTAC
CAATTAACATTGGAGGAGTGACTCTAGCTTTGCCAGTGATAAACAACGTGGCTGCCGGAGGAGGGACTGGGCAGGTTGGCCAGCCTGCTG
CTACTGCTGATAGTGGGACTTCCAATGGGAATCAATTAGTTTCCACACCCACCAACACCACTACTTCTGCCAGTACTATGCCAGAATCTC
CCTCCTCCTCCACTACCTGCACAACCACTGCTTCAACGTCTTTGACAAGCAGTGACACATTAGTGAGCTCAGCAGATACTGGCCAGTATG
CAAGCACATCAGCCAGTAGTTCTGAACGCACCATTGAAGAATCTCAAACACCTGCTGCTACTGAGTCTGAAGCCCAGAGCTCCAGTCAGC
TTCAGCCTAATGGAATGCAGAATGCACAGGATCAATCAAATTCTCTTCAGCAGGTGCAAATTGTAGGCCAACCTATCTTACAGCAGATCC
AGATCCAACAGCCTCAGCAACAGATCATTCAGGCTATTCCACCACAGTCGTTTCAACTCCAGTCAGGGCAGACGATTCAGACCATCCAGC
AGCAGCCTTTACAGAATGTTCAACTTCAAGCAGTAAATCCGACTCAGGTGCTTATCAGGGCTCCAACTTTAACACCTTCAGGGCAAATCA
GTTGGCAAACTGTACAGGTTCAGAATATTCAGAGTCTTTCAAATTTGCAAGTTCAGAATGCTGGGTTATCCCAACAATTAACCATCACCC
CAGTGTCTTCAAGTGGTGGCACAACTCTTGCTCAGATTGCTCCTGTGGCTGTTGCTGGTGCCCCAATAACTTTGAATACTGCCCAGCTTG
CATCAGTGCCTAACCTTCAGACAGTGAGCGTTGCCAACCTGGGTGCTGCAGGTGTTCAAGTGCAGGGAGTTCCCGTTACAATCACTAGTG
TTGCAGACCCAGCCTCGCCTTTAAGGATGGCAAACAGTGCCCTGATCTCCGTTGGCTGCTTGGCCATATTTGTCACTGTGATCTCCCTCT
TGGTGTACAAAAAACACAAGGAATACAACCCAATAGAAAATAGTCCTGGGAATGTGGTCAGAAGCAAAGGCCTGAGTGTCTTTCTCAACC
GTGCAAAAGCCGTGTTCTTCCCGGGAAACCAGGAAAAGGATCCGCTACTCAAAAACCAAGAATTTAAAGGAGTTTCTTAAATTTCGACCT
TGTTTCTGAAGCTCACTTTTCAGTGCCATTGATGTGAGATGTGCTGGAGTGGCTATTAACCTTTTTTTCCTAAAGATTATTGTTAAATAG
ATATTGTGGTTTGGGGAAGTTGAATTTTTTATAGGTTAAATGTCATTTTAGAGATGGGGAGAGGGATTATACTGCAGGCAGCTTCAGCCA
TGTTGTGAAACTGATAAAAGCAACTTAGCAAGGCTTCTTTTCATTATTTTTTATGTTTCACTTATAAAGTCTTAGGTAACTAGTAGGATA
GAAACACTGTGTCCCGAGAGTAAGGAGAGAAGCTACTATTGATTAGAGCCTAACCCAGGTTAACTGCAAGAAGAGGCGGGATACTTTCAG
CTTTCCATGTAACTGTATGCATAAAGCCAATGTAGTCCAGTTTCTAAGATCATGTTCCAAGCTAACTGAATCCCACTTCAATACACACTC
ATGAACTCCTGATGGAACAATAACAGGCCCAAGCCTGTGGTATGATGTGCACACTTGCTAGACTCAGAAAAAATACTACTCTCATAAATG
GGTGGGAGTATTTTGGTGACAACCTACTTTGCTTGGCTGAGTGAAGGAATGATATTCATATATTCATTTATTCCATGGACATTTAGTTAG
TGCTTTTTATATACCAGGCATGATGCTGAGTGACACTCTTGTGTATATTTCCAAATTTTTGTACAGTCGCTGCACATATTTGAAATCATA
TATTAAGACTTTCCAAAGATGAGGTCCCTGGTTTTTCATGGCAACTTGATCAGTAAGGATTTCACCTCTGTTTGTAACTAAAACCATCTA


Top

FusionGenePPI for SP4_GPNMB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SP4SP1, SP3, E2F1, NKX3-1, CRX, FOXP2, COL8A1, NRF1, POU2F1, ADAM15, SERF2, LMO3, CIB3, PRR20A, ATXN7L1, TRY2P, VRK3, PTPRA, HIRAGPNMBITSN2, SMAD4, IL31RA, TFEB, FBXL4, LINC01139, EGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SP4_GPNMB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SP4_GPNMB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSP4C0005586Bipolar Disorder2CTD_human;PSYGENET
HgeneSP4C0036341Schizophrenia1CTD_human
TgeneGPNMBC0009404Colorectal Neoplasms2CTD_human
TgeneGPNMBC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneGPNMBC0162557Liver Failure, Acute1CTD_human
TgeneGPNMBC1458155Mammary Neoplasms1CTD_human
TgeneGPNMBC2609414Acute kidney injury1CTD_human