FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35389

FusionGeneSummary for SORBS2_MRPS35

check button Fusion gene summary
Fusion gene informationFusion gene name: SORBS2_MRPS35
Fusion gene ID: 35389
HgeneTgene
Gene symbol

SORBS2

MRPS35

Gene ID

8470

60488

Gene namesorbin and SH3 domain containing 2mitochondrial ribosomal protein S35
SynonymsARGBP2|PRO0618HDCMD11P|MDS023|MRP-S28|MRPS28
Cytomap

4q35.1

12p11.22

Type of geneprotein-codingprotein-coding
Descriptionsorbin and SH3 domain-containing protein 2Arg binding protein 2Arg/Abl-interacting protein 2arg-binding protein 228S ribosomal protein S35, mitochondrial28S ribosomal protein S28, mitochondrialMRP-S35S28mtS35mtmitochondrial ribosomal protein S28mitochondrial small ribosomal subunit protein mS35
Modification date2018052320180523
UniProtAcc

O94875

P82673

Ensembl transtripts involved in fusion geneENST00000448662, ENST00000431808, 
ENST00000284776, ENST00000437304, 
ENST00000319471, ENST00000449407, 
ENST00000355634, ENST00000393528, 
ENST00000418609, ENST00000498125, 
ENST00000081029, ENST00000538315, 
Fusion gene scores* DoF score14 X 16 X 6=13449 X 4 X 6=216
# samples 189
** MAII scorelog2(18/1344*10)=-2.90046432644909
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/216*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SORBS2 [Title/Abstract] AND MRPS35 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-4L-AA1F-01ASORBS2chr4

186570621

-MRPS35chr12

27908114

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000448662ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000448662ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
Frame-shiftENST00000431808ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000431808ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
Frame-shiftENST00000284776ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000284776ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
In-frameENST00000437304ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000437304ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
Frame-shiftENST00000319471ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000319471ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
In-frameENST00000449407ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000449407ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
Frame-shiftENST00000355634ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000355634ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
Frame-shiftENST00000393528ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000393528ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
Frame-shiftENST00000418609ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5CDS-3UTRENST00000418609ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5UTR-3CDSENST00000498125ENST00000081029SORBS2chr4

186570621

-MRPS35chr12

27908114

+
5UTR-3UTRENST00000498125ENST00000538315SORBS2chr4

186570621

-MRPS35chr12

27908114

+

Top

FusionProtFeatures for SORBS2_MRPS35


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SORBS2

O94875

MRPS35

P82673


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-921167_1821891101Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-1023167_182275732Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-1224167_1822891201Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-1023167_182235667Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-1022167_1821891101Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-1023167_182368825Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-921167_182258662Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-1021167_182260645Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-92166_1271891101DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-102366_127275732DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-122466_1272891201DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-102366_127235667DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-102266_1271891101DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-102366_127368825DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-92166_127258662DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-102166_127260645DomainSoHo
TgeneMRPS35chr4:186570621chr12:27908114ENST00000081029+68257_321234324Coiled coilOntology_term=ECO:0000255
TgeneMRPS35chr4:186570621chr12:27908114ENST00000538315+57257_321197526Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-921640_6521891101Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-921931_9341891101Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-1023640_652275732Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-1023931_934275732Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-1224640_6522891201Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-1224931_9342891201Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-1023640_652235667Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-1023931_934235667Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-315167_182931005Compositional biasNote=Pro-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-315640_652931005Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-315931_934931005Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-1022640_6521891101Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-1022931_9341891101Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-1023640_652368825Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-1023931_934368825Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-921640_652258662Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-921931_934258662Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-1021640_652260645Compositional biasNote=His-rich
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-1021931_934260645Compositional biasNote=Poly-Pro
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-9211041_11001891101DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-921863_9221891101DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000284776-921938_9991891101DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-10231041_1100275732DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-1023863_922275732DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000319471-1023938_999275732DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-12241041_11002891201DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-1224863_9222891201DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000355634-1224938_9992891201DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-10231041_1100235667DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-1023863_922235667DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000393528-1023938_999235667DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-3151041_1100931005DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-31566_127931005DomainSoHo
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-315863_922931005DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000418609-315938_999931005DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-10221041_11001891101DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-1022863_9221891101DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000431808-1022938_9991891101DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-10231041_1100368825DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-1023863_922368825DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000437304-1023938_999368825DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-9211041_1100258662DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-921863_922258662DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000448662-921938_999258662DomainSH3 2
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-10211041_1100260645DomainSH3 3
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-1021863_922260645DomainSH3 1
HgeneSORBS2chr4:186570621chr12:27908114ENST00000449407-1021938_999260645DomainSH3 2


Top

FusionGeneSequence for SORBS2_MRPS35


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SORBS2_ENST00000448662_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_348aa
MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPMSYYQRPFSPSAYSLPASLNS
SIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKP
DDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKILKNGKKVRLK

>In-frame_SORBS2_ENST00000437304_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_458aa
MYSNEDSRQTIVYSEESNTTMSYTQKITNPLPAASSTDPAPFANINTPVLQEDYRQDSQTRRISTLKLTHNQDLGSSSPISTPQFSKSVE
VPSFLKRPRSLTPNPVPETHTASLSIQIAPLSGQDLESHKQLPELSPETAKIPLQQERQKSAVAAASQSSDCRVSQITVNGNSGGAVSPM
SYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTV
DRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLR
PRDRSSTEKILKNGKKVRLKQTWKSIYGKIAHQKEISWKRFSRXKLLRKIWKXIKKSSLVLKKLKSTKSLLLVLKMRRKMKIPFLSTKNP

>In-frame_SORBS2_ENST00000449407_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_350aa
MSVTLTSVKRVQSSPNLLAAGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPMSYY
QRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRP
KDWYKTMFKQIHMVHKPGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKILKNGKKVR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SORBS2_ENST00000448662_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_1046nt
ATGAACACAGGGCGTGATTCTCAGTCACCAGACTCAGCTTGGAGATCTTACAATGATGGCAATCAGGAGACACTGAACGGAGATGCTACA
TATTCCTCTCTTGCAGCAAAAGGTTTTAGAAGCGTTCGACCAAACCTACAAGATAAAAGATCACCAACTCAGAGCCAGATAACAGTGAAT
GGAAACTCAGGAGGTGCCGTGAGTCCCATGAGTTACTATCAGAGGCCGTTTTCCCCCTCGGCATATTCTCTCCCAGCCTCACTCAACTCC
AGCATTGTCATGCAGCACGGCACATCCCTCGATTCCACAGACACATATCCCCAGCATGCGCAGTCTCTGGATGGCACCACCAGCAGCTCT
ATCCCCCTGTACCGATCCTCAGAGGAAGAGAAGAGAGTGACAGTCATCAAAGCCCCGCATTACCCAGGGATCGGGCCCGTGGATGAATCC
GGAATCCCCACAGCAATTAGAACGACAGTCGACCGGCCCAAGGACTGGTACAAGACGATGTTTAAGCAAATTCACATGGTGCACAAGCCG
GATGATGACACAGACATGTATAATACTCCTTATACATACAATGCAGGTCTGTACAACCCACCCTACAGTGCTCAGTCACACCCTGCTGCA
AAGACCCAAACCTACAGACCTCTTTCCAAAAGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCCCAGTGCCTCCCCCA
CATGTTCCACCTCCAGTCCCGCCGCTTCGACCAAGAGATCGGTCTTCAACAGAAAAAATACTGAAGAATGGGAAAAAAGTAAGACTGAAG
CAGACATGGAAGAGTATATATGGGAAAATAGCTCATCAGAAAGAAATATCCTGGAAACGCTTCTCCAGATGAAAGCTGCTGAGAAAAATA
TGGAAATAAATAAAGAAGAGCTCCTTGGTACTAAAGAAATTGAAGAGTACAAAAAGTCTGTTGTTAGTCTTAAAAATGAGGAGGAAAATG

>In-frame_SORBS2_ENST00000437304_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_1376nt
ATGTATTCCAATGAAGATTCGAGACAGACAATTGTATATTCTGAAGAATCTAACACAACCATGTCATATACACAAAAAATCACTAATCCA
CTACCAGCAGCTTCCAGCACGGATCCTGCACCATTCGCTAACATCAACACCCCAGTTCTACAAGAGGACTACAGGCAAGATTCTCAAACT
CGGAGGATTTCTACCTTGAAACTAACCCATAACCAGGATCTAGGAAGTAGCAGCCCCATTAGTACTCCACAGTTCTCCAAATCTGTCGAA
GTACCGTCATTTCTCAAAAGGCCCCGCTCACTGACCCCTAATCCAGTGCCTGAGACACACACAGCATCTCTTTCCATTCAGATAGCTCCC
CTTTCAGGACAGGATCTTGAAAGCCACAAACAGCTACCTGAGCTTTCTCCAGAGACTGCAAAGATACCTCTTCAGCAAGAGAGACAAAAA
TCTGCAGTTGCAGCGGCCTCTCAGTCCTCAGACTGCAGAGTGAGCCAGATAACAGTGAATGGAAACTCAGGAGGTGCCGTGAGTCCCATG
AGTTACTATCAGAGGCCGTTTTCCCCCTCGGCATATTCTCTCCCAGCCTCACTCAACTCCAGCATTGTCATGCAGCACGGCACATCCCTC
GATTCCACAGACACATATCCCCAGCATGCGCAGTCTCTGGATGGCACCACCAGCAGCTCTATCCCCCTGTACCGATCCTCAGAGGAAGAG
AAGAGAGTGACAGTCATCAAAGCCCCGCATTACCCAGGGATCGGGCCCGTGGATGAATCCGGAATCCCCACAGCAATTAGAACGACAGTC
GACCGGCCCAAGGACTGGTACAAGACGATGTTTAAGCAAATTCACATGGTGCACAAGCCGGATGATGACACAGACATGTATAATACTCCT
TATACATACAATGCAGGTCTGTACAACCCACCCTACAGTGCTCAGTCACACCCTGCTGCAAAGACCCAAACCTACAGACCTCTTTCCAAA
AGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCCCAGTGCCTCCCCCACATGTTCCACCTCCAGTCCCGCCGCTTCGA
CCAAGAGATCGGTCTTCAACAGAAAAAATACTGAAGAATGGGAAAAAAGTAAGACTGAAGCAGACATGGAAGAGTATATATGGGAAAATA
GCTCATCAGAAAGAAATATCCTGGAAACGCTTCTCCAGATGAAAGCTGCTGAGAAAAATATGGAAATAAATAAAGAAGAGCTCCTTGGTA
CTAAAGAAATTGAAGAGTACAAAAAGTCTGTTGTTAGTCTTAAAAATGAGGAGGAAAATGAAAATTCCATTTCTCAGTACAAAGAATCCG

>In-frame_SORBS2_ENST00000449407_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_1052nt
ATGTCTGTTACGCTAACATCTGTGAAGAGAGTGCAAAGTTCTCCAAACCTATTGGCTGCAGGGCGTGATTCTCAGTCACCAGACTCAGCT
TGGAGATCTTACAATGATGGCAATCAGGAGACACTGAACGGAGATGCTACATATTCCTCTCTTGCAGCAAAAGGTTTTAGAAGCGTTCGA
CCAAACCTACAAGATAAAAGATCACCAACTCAGAGCCAGATAACAGTGAATGGAAACTCAGGAGGTGCCGTGAGTCCCATGAGTTACTAT
CAGAGGCCGTTTTCCCCCTCGGCATATTCTCTCCCAGCCTCACTCAACTCCAGCATTGTCATGCAGCACGGCACATCCCTCGATTCCACA
GACACATATCCCCAGCATGCGCAGTCTCTGGATGGCACCACCAGCAGCTCTATCCCCCTGTACCGATCCTCAGAGGAAGAGAAGAGAGTG
ACAGTCATCAAAGCCCCGCATTACCCAGGGATCGGGCCCGTGGATGAATCCGGAATCCCCACAGCAATTAGAACGACAGTCGACCGGCCC
AAGGACTGGTACAAGACGATGTTTAAGCAAATTCACATGGTGCACAAGCCGGGTCTGTACAACCCACCCTACAGTGCTCAGTCACACCCT
GCTGCAAAGACCCAAACCTACAGACCTCTTTCCAAAAGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCCCAGTGCCT
CCCCCACATGTTCCACCTCCAGTCCCGCCGCTTCGACCAAGAGATCGGTCTTCAACAGAAAAAATACTGAAGAATGGGAAAAAAGTAAGA
CTGAAGCAGACATGGAAGAGTATATATGGGAAAATAGCTCATCAGAAAGAAATATCCTGGAAACGCTTCTCCAGATGAAAGCTGCTGAGA
AAAATATGGAAATAAATAAAGAAGAGCTCCTTGGTACTAAAGAAATTGAAGAGTACAAAAAGTCTGTTGTTAGTCTTAAAAATGAGGAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SORBS2_ENST00000448662_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_2078nt
AAGCAGATAGGTTTCAGAGATAAAGAGTGAAACCAAAAACACCGCACACCTCATCCAAATCTGCGCTCATACTTGCAGCAAATGTTTGCT
GTCAGTTGCTTCATAATAACAGCACAGACCCCGAATTGCAGGAGGAATTGCCTGGTAGAAAACTGAAGACTTTAATAACAAACTCTCCAA
GGTGAAAATGAACACAGGGCGTGATTCTCAGTCACCAGACTCAGCTTGGAGATCTTACAATGATGGCAATCAGGAGACACTGAACGGAGA
TGCTACATATTCCTCTCTTGCAGCAAAAGGTTTTAGAAGCGTTCGACCAAACCTACAAGATAAAAGATCACCAACTCAGAGCCAGATAAC
AGTGAATGGAAACTCAGGAGGTGCCGTGAGTCCCATGAGTTACTATCAGAGGCCGTTTTCCCCCTCGGCATATTCTCTCCCAGCCTCACT
CAACTCCAGCATTGTCATGCAGCACGGCACATCCCTCGATTCCACAGACACATATCCCCAGCATGCGCAGTCTCTGGATGGCACCACCAG
CAGCTCTATCCCCCTGTACCGATCCTCAGAGGAAGAGAAGAGAGTGACAGTCATCAAAGCCCCGCATTACCCAGGGATCGGGCCCGTGGA
TGAATCCGGAATCCCCACAGCAATTAGAACGACAGTCGACCGGCCCAAGGACTGGTACAAGACGATGTTTAAGCAAATTCACATGGTGCA
CAAGCCGGATGATGACACAGACATGTATAATACTCCTTATACATACAATGCAGGTCTGTACAACCCACCCTACAGTGCTCAGTCACACCC
TGCTGCAAAGACCCAAACCTACAGACCTCTTTCCAAAAGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCCCAGTGCC
TCCCCCACATGTTCCACCTCCAGTCCCGCCGCTTCGACCAAGAGATCGGTCTTCAACAGAAAAAATACTGAAGAATGGGAAAAAAGTAAG
ACTGAAGCAGACATGGAAGAGTATATATGGGAAAATAGCTCATCAGAAAGAAATATCCTGGAAACGCTTCTCCAGATGAAAGCTGCTGAG
AAAAATATGGAAATAAATAAAGAAGAGCTCCTTGGTACTAAAGAAATTGAAGAGTACAAAAAGTCTGTTGTTAGTCTTAAAAATGAGGAG
GAAAATGAAAATTCCATTTCTCAGTACAAAGAATCCGTGAAGAGACTATTAAATGTGACATGAATTATGGAGTAGAAAAATCTGCTTGAT
TTATTAATTTTATGATATATGTGATCAGTATCTAATTTGATATAAAATTGAAAATGTTAAAAAATCATTTTTTTTCCTCAGAGTTAAAAT
TATTTCCCTCATACTAATGCTTAATGGCAATGATTACTCCAGAGTTTTTTAATTTTTACACTGGGGCAATAGACTAGGAGGTCTCTGATT
TCTTCTTGGTCTAAAGTGTTTTGATTTTATTTCTACATAATAGCTTTGGTATTCATGTATATACATGCATTTAATTGTGATTTTATCACC
TTTCCCATTTCTTTCCCCACAAGCTGGCATTTCAGTAGTTGCTTTTGAATAATGGTTTTGGTTACCTGGGAAGGCAGGCCCAGAACCCAT
TTCCTTGACTTGCAGTTCCGGGCTGTGTTCACATGACTGCTGTCTAGCTGATGCATTTTTCACATTTGTCAACTCTGGTTAGAAACAGGT
CCTCAGGAGTATTCTCTAACCTGATATTTTCTAAAAAGATATGTTGATTCAACTTTGTTTAGCATCCTACTTTCTAGATTGTGGGGCTCA
TTTTGCCAGGGCCAAGCTACCAGAAAAGTAGAAGTGGAGATTACCTGGTATGTATCTCTCTGGGTGCCCCAGTTAGAGCTGCCACAGCTC
AGGAAAAAGATGAGGCATAACGACCTTGAATGTAATTGGAGTAAGTGACAAAATAAGAACTACCCTGGGAAACCCTGCATTCAATGTAGC
TGTCAATTCAGTATTTTTAAGTACACCTGTCAGCTGTTTCTTACCACTTCGATGGTTGTGATTAATTTAAAATCAAAATAAAGGAATTAC

>In-frame_SORBS2_ENST00000437304_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_2805nt
AGCTTTCAAAAATAGCATAGTTGATGAAACTGGAAATTTAGGTGCGGGCTCTTTTAAGAAATCATTTGTCTTCAGTCTTAAGAATAGACT
GACAACAGATACTGCTACCAGAGGGCTCTCAACTATTTCTTAAGACCCCCTAGGAAATATCAGAAGAAAAGCCTCCTTCTCAATAAAGCA
TAAGTAGGACATCTCGTTTTCAGTGAATCAGACACTTGGATTGGACTTAATCTTAAACCTCTGGAGTTCAAGACCTTTTAAAAAGGGCTA
AATAAACAATCTCTACATGTAAAAGGCCACTGACTCCTACTTCCTCTGTATAGAGCAACTGTTGAACTCAGCTGCCTGTAGGGCGTGATT
CTCAGTCACCAGACTCAGCAAAAGGTTTTAGAAGCGTTCGACCAAACCTACAAGATAAAAGATCACCAACTCAGGCACCCCCTCCACCAG
AAAGAAAAGAGAGCTTTCATAGCTCTTTGATAACCAGTCACACAAAGGGTGTCATTTTAGACCAGTTAGTAACTAACACACAAATTCCCT
CCAGTACAGAGTACTTTGCTAACAAAAAACCTCTTCAGGGAACTATGTATTCCAATGAAGATTCGAGACAGACAATTGTATATTCTGAAG
AATCTAACACAACCATGTCATATACACAAAAAATCACTAATCCACTACCAGCAGCTTCCAGCACGGATCCTGCACCATTCGCTAACATCA
ACACCCCAGTTCTACAAGAGGACTACAGGCAAGATTCTCAAACTCGGAGGATTTCTACCTTGAAACTAACCCATAACCAGGATCTAGGAA
GTAGCAGCCCCATTAGTACTCCACAGTTCTCCAAATCTGTCGAAGTACCGTCATTTCTCAAAAGGCCCCGCTCACTGACCCCTAATCCAG
TGCCTGAGACACACACAGCATCTCTTTCCATTCAGATAGCTCCCCTTTCAGGACAGGATCTTGAAAGCCACAAACAGCTACCTGAGCTTT
CTCCAGAGACTGCAAAGATACCTCTTCAGCAAGAGAGACAAAAATCTGCAGTTGCAGCGGCCTCTCAGTCCTCAGACTGCAGAGTGAGCC
AGATAACAGTGAATGGAAACTCAGGAGGTGCCGTGAGTCCCATGAGTTACTATCAGAGGCCGTTTTCCCCCTCGGCATATTCTCTCCCAG
CCTCACTCAACTCCAGCATTGTCATGCAGCACGGCACATCCCTCGATTCCACAGACACATATCCCCAGCATGCGCAGTCTCTGGATGGCA
CCACCAGCAGCTCTATCCCCCTGTACCGATCCTCAGAGGAAGAGAAGAGAGTGACAGTCATCAAAGCCCCGCATTACCCAGGGATCGGGC
CCGTGGATGAATCCGGAATCCCCACAGCAATTAGAACGACAGTCGACCGGCCCAAGGACTGGTACAAGACGATGTTTAAGCAAATTCACA
TGGTGCACAAGCCGGATGATGACACAGACATGTATAATACTCCTTATACATACAATGCAGGTCTGTACAACCCACCCTACAGTGCTCAGT
CACACCCTGCTGCAAAGACCCAAACCTACAGACCTCTTTCCAAAAGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCC
CAGTGCCTCCCCCACATGTTCCACCTCCAGTCCCGCCGCTTCGACCAAGAGATCGGTCTTCAACAGAAAAAATACTGAAGAATGGGAAAA
AAGTAAGACTGAAGCAGACATGGAAGAGTATATATGGGAAAATAGCTCATCAGAAAGAAATATCCTGGAAACGCTTCTCCAGATGAAAGC
TGCTGAGAAAAATATGGAAATAAATAAAGAAGAGCTCCTTGGTACTAAAGAAATTGAAGAGTACAAAAAGTCTGTTGTTAGTCTTAAAAA
TGAGGAGGAAAATGAAAATTCCATTTCTCAGTACAAAGAATCCGTGAAGAGACTATTAAATGTGACATGAATTATGGAGTAGAAAAATCT
GCTTGATTTATTAATTTTATGATATATGTGATCAGTATCTAATTTGATATAAAATTGAAAATGTTAAAAAATCATTTTTTTTCCTCAGAG
TTAAAATTATTTCCCTCATACTAATGCTTAATGGCAATGATTACTCCAGAGTTTTTTAATTTTTACACTGGGGCAATAGACTAGGAGGTC
TCTGATTTCTTCTTGGTCTAAAGTGTTTTGATTTTATTTCTACATAATAGCTTTGGTATTCATGTATATACATGCATTTAATTGTGATTT
TATCACCTTTCCCATTTCTTTCCCCACAAGCTGGCATTTCAGTAGTTGCTTTTGAATAATGGTTTTGGTTACCTGGGAAGGCAGGCCCAG
AACCCATTTCCTTGACTTGCAGTTCCGGGCTGTGTTCACATGACTGCTGTCTAGCTGATGCATTTTTCACATTTGTCAACTCTGGTTAGA
AACAGGTCCTCAGGAGTATTCTCTAACCTGATATTTTCTAAAAAGATATGTTGATTCAACTTTGTTTAGCATCCTACTTTCTAGATTGTG
GGGCTCATTTTGCCAGGGCCAAGCTACCAGAAAAGTAGAAGTGGAGATTACCTGGTATGTATCTCTCTGGGTGCCCCAGTTAGAGCTGCC
ACAGCTCAGGAAAAAGATGAGGCATAACGACCTTGAATGTAATTGGAGTAAGTGACAAAATAAGAACTACCCTGGGAAACCCTGCATTCA
ATGTAGCTGTCAATTCAGTATTTTTAAGTACACCTGTCAGCTGTTTCTTACCACTTCGATGGTTGTGATTAATTTAAAATCAAAATAAAG

>In-frame_SORBS2_ENST00000449407_chr4_186570621_-_MRPS35_ENST00000081029_chr12_27908114_+_2690nt
GAGCTGAGAGGACCAGCCATTTTACTTATGGAAAACAGTGTGGCATATTCTGCTGAGCTTCGCCCTGGAAGAAGCCTCTTTTATACATCT
CTTCAGGGAAGAGAGAAGCAATGGGCATGTTAGTATACAATGATCACAGCCACGCAGGCCTGCAAGCTGCCTTTTGGACAGGCTGTTGAC
TGCCGTTCCAATTAGCTGATTGGAGAATGTGGAATGCAGAGTGATAATGCTGCATATCTGCTATCAGGCAGCAGCAAAGGTTTTTGTCTT
GGGAAGGCAAGCTTTCCCTGCAATATTATCTCAGCAGCTCCCTAGCTGCTTACCCTGAAAACGAGGGATCCAAACGGAGGGTGTTGCACT
CTGCTAACGCTGGTCCTGTGCGTGGCTGTGGCATATGAGCGGCAGGTCTGAAAAAGCAGGTGTGTGCTGGGACGGGCACTGGACTGGAAC
GCAGGCGGACGCTCTCGGGTTTACCTGCTTCCTGTTAACAGATTGTGGGCTCCCAGGGCATATGTCTGCACGCTGAGGCCGAGGCGGAGA
AGGGGCTTCCTGAGCGTCCCAGTACACTGACAGAGACACTTGGATTGGACTTAATCTTAAACCTCTGGAGTTCAAGACCTTTTAAAAAGG
GCTAAATAAACAATCTCTACATGTAAAAGGCCACTGACTCCTACTTCCTCTGTATAGAGCAACTGTTGAACTCAGCTGCCTGTAGGAAAA
CTGAAGACTTTAATAACAAACTCTCCAAGGTGAAAATGAACACAGCGGTGGGTGTGCTCGCAAACGTGCCGCCATGTCTGTTACGCTAAC
ATCTGTGAAGAGAGTGCAAAGTTCTCCAAACCTATTGGCTGCAGGGCGTGATTCTCAGTCACCAGACTCAGCTTGGAGATCTTACAATGA
TGGCAATCAGGAGACACTGAACGGAGATGCTACATATTCCTCTCTTGCAGCAAAAGGTTTTAGAAGCGTTCGACCAAACCTACAAGATAA
AAGATCACCAACTCAGAGCCAGATAACAGTGAATGGAAACTCAGGAGGTGCCGTGAGTCCCATGAGTTACTATCAGAGGCCGTTTTCCCC
CTCGGCATATTCTCTCCCAGCCTCACTCAACTCCAGCATTGTCATGCAGCACGGCACATCCCTCGATTCCACAGACACATATCCCCAGCA
TGCGCAGTCTCTGGATGGCACCACCAGCAGCTCTATCCCCCTGTACCGATCCTCAGAGGAAGAGAAGAGAGTGACAGTCATCAAAGCCCC
GCATTACCCAGGGATCGGGCCCGTGGATGAATCCGGAATCCCCACAGCAATTAGAACGACAGTCGACCGGCCCAAGGACTGGTACAAGAC
GATGTTTAAGCAAATTCACATGGTGCACAAGCCGGGTCTGTACAACCCACCCTACAGTGCTCAGTCACACCCTGCTGCAAAGACCCAAAC
CTACAGACCTCTTTCCAAAAGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCCCAGTGCCTCCCCCACATGTTCCACC
TCCAGTCCCGCCGCTTCGACCAAGAGATCGGTCTTCAACAGAAAAAATACTGAAGAATGGGAAAAAAGTAAGACTGAAGCAGACATGGAA
GAGTATATATGGGAAAATAGCTCATCAGAAAGAAATATCCTGGAAACGCTTCTCCAGATGAAAGCTGCTGAGAAAAATATGGAAATAAAT
AAAGAAGAGCTCCTTGGTACTAAAGAAATTGAAGAGTACAAAAAGTCTGTTGTTAGTCTTAAAAATGAGGAGGAAAATGAAAATTCCATT
TCTCAGTACAAAGAATCCGTGAAGAGACTATTAAATGTGACATGAATTATGGAGTAGAAAAATCTGCTTGATTTATTAATTTTATGATAT
ATGTGATCAGTATCTAATTTGATATAAAATTGAAAATGTTAAAAAATCATTTTTTTTCCTCAGAGTTAAAATTATTTCCCTCATACTAAT
GCTTAATGGCAATGATTACTCCAGAGTTTTTTAATTTTTACACTGGGGCAATAGACTAGGAGGTCTCTGATTTCTTCTTGGTCTAAAGTG
TTTTGATTTTATTTCTACATAATAGCTTTGGTATTCATGTATATACATGCATTTAATTGTGATTTTATCACCTTTCCCATTTCTTTCCCC
ACAAGCTGGCATTTCAGTAGTTGCTTTTGAATAATGGTTTTGGTTACCTGGGAAGGCAGGCCCAGAACCCATTTCCTTGACTTGCAGTTC
CGGGCTGTGTTCACATGACTGCTGTCTAGCTGATGCATTTTTCACATTTGTCAACTCTGGTTAGAAACAGGTCCTCAGGAGTATTCTCTA
ACCTGATATTTTCTAAAAAGATATGTTGATTCAACTTTGTTTAGCATCCTACTTTCTAGATTGTGGGGCTCATTTTGCCAGGGCCAAGCT
ACCAGAAAAGTAGAAGTGGAGATTACCTGGTATGTATCTCTCTGGGTGCCCCAGTTAGAGCTGCCACAGCTCAGGAAAAAGATGAGGCAT
AACGACCTTGAATGTAATTGGAGTAAGTGACAAAATAAGAACTACCCTGGGAAACCCTGCATTCAATGTAGCTGTCAATTCAGTATTTTT


Top

FusionGenePPI for SORBS2_MRPS35


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SORBS2YWHAE, SFN, CBL, PTK2B, FLOT1, RPL9, DLGAP4, DLGAP1, VCL, MLLT4, ABL2, ABL1, EGFR, NR1H2, SEMA6A, PALLD, ACTN1, ADAM15, WASF1, PTPN12, BAG3, AKT2, MDM2, YWHAZ, YWHAB, WAS, NCK2, SORBS2, EFS, VPS37C, SH2D4A, ATPAF2, SUZ12, CAPZA2, CLTC, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, SYNPO, MAPRE1, LIMA1, ANLN, MYO18A, FAT1MRPS35USP42, UBC, ICT1, CUL3, CAND1, MRPS5, MRPS22, MRPS18B, MRPS26, MRPL42, MRPS25, UQCRFS1P1, LAMTOR3, ILF3, EIF3C, LRPPRC, SLC1A5, RPLP1, ATP6V1C1, ABCC2, SOX2, CEP250, HAUS2, BTRC, NOL12, TRA2A, ZC3H3, TRMT10B, ZBTB38, MRPS31, DAP3, HNRNPA1, NTRK1, ATP1B1, MRPS23, MRPS2, PTCD3, MRPS7, MRPS9, EPHA2, HNRNPU, RAP1B, AURKA, PHF8, MRPL50, NANOG, POU5F1, TRUB2, C17orf89, COQ4, COQ5, DUSP11, DUSP5, MRPS34, ZBTB48, MRPS11, MRPS27, E4F1, RRS1, AURKAIP1, PDGFB, MRPS15, ZNF331, PPAN, ZNF169, ZNF2, SNRNP70, FGF8, ZNF707, ZFC3H1, RPS8, ZNF263, GLTSCR2, ZNF324B, CCDC59, RPL18, RBM42, ZC3HAV1, H2AFX, HNRNPDL, RPL6, CFAP20, COX15, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SORBS2_MRPS35


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SORBS2_MRPS35


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSORBS2C0043094Weight Gain1CTD_human