FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 353

FusionGeneSummary for ACAP2_XXYLT1

check button Fusion gene summary
Fusion gene informationFusion gene name: ACAP2_XXYLT1
Fusion gene ID: 353
HgeneTgene
Gene symbol

ACAP2

XXYLT1

Gene ID

23527

152002

Gene nameArfGAP with coiled-coil, ankyrin repeat and PH domains 2xyloside xylosyltransferase 1
SynonymsCENTB2|CNT-B2C3orf21
Cytomap

3q29

3q29

Type of geneprotein-codingprotein-coding
Descriptionarf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2Arf GAP with coiled coil, ANK repeat and PH domains 2centaurin-beta-2xyloside xylosyltransferase 1UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase
Modification date2018052320180519
UniProtAcc

Q15057

Q8NBI6

Ensembl transtripts involved in fusion geneENST00000326793, ENST00000472860, 
ENST00000310380, ENST00000437101, 
ENST00000429994, ENST00000355729, 
ENST00000460582, ENST00000356740, 
Fusion gene scores* DoF score9 X 7 X 10=6303 X 4 X 6=72
# samples 137
** MAII scorelog2(13/630*10)=-2.27684020535882
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/72*10)=-0.0406419844973459
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ACAP2 [Title/Abstract] AND XXYLT1 [Title/Abstract] AND fusion [Title/Abstract]

A novel proximal 3q29 chromosome microdeletion in a Chinese patient with Chiari malformation type II and Sprengel’s deformity (pmid: 29410707)
Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneXXYLT1

GO:0016266

O-glycan processing

8982869|22117070


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-BT-A0YX-01AACAP2chr3

195053757

-XXYLT1chr3

194877310

-
TCGALDBLCATCGA-BT-A20J-01AACAP2chr3

195063200

-XXYLT1chr3

194947585

-
TCGALDBRCATCGA-E9-A1QZ-01AACAP2chr3

195101738

-XXYLT1chr3

194790840

-
TCGALDESCATCGA-IG-A97H-01AACAP2chr3

195163524

-XXYLT1chr3

194790840

-
TCGALDLUSCTCGA-22-5479-01AACAP2chr3

195101738

-XXYLT1chr3

194790840

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000326793ENST00000310380ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
Frame-shitENST00000326793ENST00000437101ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
Frame-shitENST00000326793ENST00000429994ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
Frame-shitENST00000326793ENST00000355729ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
5CDS-intronENST00000326793ENST00000460582ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
5CDS-intronENST00000326793ENST00000356740ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
intron-3CDSENST00000472860ENST00000310380ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
intron-3CDSENST00000472860ENST00000437101ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
intron-3CDSENST00000472860ENST00000429994ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
intron-3CDSENST00000472860ENST00000355729ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
intron-intronENST00000472860ENST00000460582ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
intron-intronENST00000472860ENST00000356740ACAP2chr3

195053757

-XXYLT1chr3

194877310

-
In-frameENST00000326793ENST00000310380ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
5CDS-intronENST00000326793ENST00000437101ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
5CDS-intronENST00000326793ENST00000429994ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
5CDS-intronENST00000326793ENST00000355729ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
5CDS-intronENST00000326793ENST00000460582ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
5CDS-intronENST00000326793ENST00000356740ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
intron-3CDSENST00000472860ENST00000310380ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
intron-intronENST00000472860ENST00000437101ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
intron-intronENST00000472860ENST00000429994ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
intron-intronENST00000472860ENST00000355729ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
intron-intronENST00000472860ENST00000460582ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
intron-intronENST00000472860ENST00000356740ACAP2chr3

195063200

-XXYLT1chr3

194947585

-
In-frameENST00000326793ENST00000310380ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
Frame-shitENST00000326793ENST00000437101ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
In-frameENST00000326793ENST00000429994ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
Frame-shitENST00000326793ENST00000355729ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
5CDS-5UTRENST00000326793ENST00000460582ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
5CDS-5UTRENST00000326793ENST00000356740ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000310380ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000437101ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000429994ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000355729ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
intron-5UTRENST00000472860ENST00000460582ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
intron-5UTRENST00000472860ENST00000356740ACAP2chr3

195101738

-XXYLT1chr3

194790840

-
In-frameENST00000326793ENST00000310380ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
Frame-shitENST00000326793ENST00000437101ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
In-frameENST00000326793ENST00000429994ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
Frame-shitENST00000326793ENST00000355729ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
5CDS-5UTRENST00000326793ENST00000460582ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
5CDS-5UTRENST00000326793ENST00000356740ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000310380ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000437101ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000429994ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
intron-3CDSENST00000472860ENST00000355729ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
intron-5UTRENST00000472860ENST00000460582ACAP2chr3

195163524

-XXYLT1chr3

194790840

-
intron-5UTRENST00000472860ENST00000356740ACAP2chr3

195163524

-XXYLT1chr3

194790840

-

Top

FusionProtFeatures for ACAP2_XXYLT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACAP2

Q15057

XXYLT1

Q8NBI6

GTPase-activating protein (GAP) for ADP ribosylationfactor 6 (ARF6). {ECO:0000269|PubMed:11062263}. Alpha-1,3-xylosyltransferase, which elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats inthe extracellular domain of target proteins by catalyzing theaddition of the second xylose (PubMed:22117070, PubMed:8982869).Known targets include Notch proteins and coagulation factors, suchas F9 (PubMed:22117070, PubMed:8982869).{ECO:0000269|PubMed:22117070, ECO:0000269|PubMed:8982869}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000355729-03104_1060191RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000356740-02104_1060188RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000437101-05104_106-154191RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000355729-13104_10658191RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000356740-02104_10655188RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000437101-35104_10658191RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000355729-13104_10658191RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000356740-02104_10655188RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000437101-35104_10658191RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000355729-031_230191Topological domainCytoplasmic
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000355729-0345_3930191Topological domainLumenal
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000356740-021_230188Topological domainCytoplasmic
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000356740-0245_3930188Topological domainLumenal
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000437101-051_23-154191Topological domainCytoplasmic
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000437101-0545_393-154191Topological domainLumenal
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000355729-0324_440191TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000356740-0224_440188TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000437101-0524_44-154191TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-6231_226176779DomainNote=BAR
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-623266_361176779DomainPH
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-623399_520176779DomainArf-GAP
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-4231_22695779DomainNote=BAR
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-423266_36195779DomainPH
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-423399_52095779DomainArf-GAP
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-1231_22617779DomainNote=BAR
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-123266_36117779DomainPH
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-123399_52017779DomainArf-GAP
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-623640_669176779RepeatNote=ANK 1
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-623673_702176779RepeatNote=ANK 2
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-623706_735176779RepeatNote=ANK 3
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-423640_66995779RepeatNote=ANK 1
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-423673_70295779RepeatNote=ANK 2
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-423706_73595779RepeatNote=ANK 3
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-123640_66917779RepeatNote=ANK 1
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-123673_70217779RepeatNote=ANK 2
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-123706_73517779RepeatNote=ANK 3
HgeneACAP2chr3:195063200chr3:194947585ENST00000326793-623414_437176779Zinc fingerC4-type
HgeneACAP2chr3:195101738chr3:194790840ENST00000326793-423414_43795779Zinc fingerC4-type
HgeneACAP2chr3:195163524chr3:194790840ENST00000326793-123414_43717779Zinc fingerC4-type
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000310380-04104_106168394RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000310380-24104_106261394RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000310380-24104_106261394RegionUDP-alpha-D-xylose binding
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000310380-041_23168394Topological domainCytoplasmic
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000310380-0445_393168394Topological domainLumenal
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000310380-241_23261394Topological domainCytoplasmic
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000310380-2445_393261394Topological domainLumenal
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000355729-131_2358191Topological domainCytoplasmic
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000355729-1345_39358191Topological domainLumenal
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000356740-021_2355188Topological domainCytoplasmic
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000356740-0245_39355188Topological domainLumenal
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000437101-351_2358191Topological domainCytoplasmic
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000437101-3545_39358191Topological domainLumenal
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000310380-241_23261394Topological domainCytoplasmic
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000310380-2445_393261394Topological domainLumenal
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000355729-131_2358191Topological domainCytoplasmic
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000355729-1345_39358191Topological domainLumenal
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000356740-021_2355188Topological domainCytoplasmic
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000356740-0245_39355188Topological domainLumenal
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000437101-351_2358191Topological domainCytoplasmic
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000437101-3545_39358191Topological domainLumenal
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000310380-0424_44168394TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000310380-2424_44261394TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000355729-1324_4458191TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000356740-0224_4455188TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000437101-3524_4458191TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000310380-2424_44261394TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000355729-1324_4458191TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000356740-0224_4455188TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000437101-3524_4458191TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for ACAP2_XXYLT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACAP2_ENST00000326793_chr3_195063200_-_XXYLT1_ENST00000310380_chr3_194947585_-_402aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQTSSNDAVVETSLTKFSDSLQEM
INFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDTVLQVIFH
DVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYR
HTFWQFRHENPQTRVGGPPPEGLPGFNSGVMLLNLEAMRQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFFTMIGMEHPKLFHVLDCTW

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000310380_chr3_194790840_-_227aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQTSSNDAVVETSLTKFSDSLQEM
INFHTAHILAVPP_EPPDPGWGPAPRGAAGLQQRGDVAEPGGHAPVPALQPPAGAGAGAAAGRQVPLPRPPRGPGLLHHDRHGAPQALPC

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000429994_chr3_194790840_-_227aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQTSSNDAVVETSLTKFSDSLQEM
INFHTAHILAVPP_EPPDPGWGPAPRGAAGLQQRGDVAEPGGHAPVPALQPPAGAGAGAAAGRQVPLPRPPRGPGLLHHDRHGAPQALPC

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_XXYLT1_ENST00000310380_chr3_194790840_-_150aa
MKMTVDFEECLKDSPRFRHTFWQFRHENPQTRVGGPPPEGLPGFNSGVMLLNLEAMRQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFF

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_XXYLT1_ENST00000429994_chr3_194790840_-_150aa
MKMTVDFEECLKDSPRFRHTFWQFRHENPQTRVGGPPPEGLPGFNSGVMLLNLEAMRQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFF

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000310380_chr3_194790840_-_227aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQTSSNDAVVETSLTKFSDSLQEM
INFHTAHILAVPP_EPPDPGWGPAPRGAAGLQQRGDVAEPGGHAPVPALQPPAGAGAGAAAGRQVPLPRPPRGPGLLHHDRHGAPQALPC

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000429994_chr3_194790840_-_227aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQTSSNDAVVETSLTKFSDSLQEM
INFHTAHILAVPP_EPPDPGWGPAPRGAAGLQQRGDVAEPGGHAPVPALQPPAGAGAGAAAGRQVPLPRPPRGPGLLHHDRHGAPQALPC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACAP2_ENST00000326793_chr3_195063200_-_XXYLT1_ENST00000310380_chr3_194947585_-_1206nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAA
TTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATTGCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATG
AATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGATGCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATG
ATAAATTTTCACACAATCCTGTTTGACCAAACTCAGAGATCAATTAAGGCACAGCTTCAGAACTTTGTTAAAGAAGATCTTAGAAAATTC
AAAGATGCCAAGAAGCAATTCGAAAAAGTCAGTGAAGAAAAAGAAAATGCGTTAGTAAAAAATGCCCAAGTACAAAGAAACAAACAACAT
GAAGTTGAAGAAGCCACCAACATTCTGACAGCAACAAGAAAATGTTTCCGACACATAGCCCTCGATTATGTGCTTCAGGTCATCTTCCAC
GATGTTGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGAC
TCCATCTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAG
ACCAACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGG
CACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTG
ATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTAC
CACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGG
AACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTAC

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000310380_chr3_194790840_-_682nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAA
TTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATTGCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATG
AATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGATGCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATG
ATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGG
CTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCA
GCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGT
GCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGG

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000429994_chr3_194790840_-_682nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAA
TTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATTGCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATG
AATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGATGCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATG
ATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGG
CTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCA
GCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGT
GCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGG

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_XXYLT1_ENST00000310380_chr3_194790840_-_450nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAG
ACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCG
CTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTC
ACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGC
TACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCATCCCGGAGGACTAG

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_XXYLT1_ENST00000429994_chr3_194790840_-_450nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAG
ACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCG
CTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTC
ACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGC
TACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCATCCCGGAGGACTAG

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000310380_chr3_194790840_-_682nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAA
TTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATTGCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATG
AATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGATGCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATG
ATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGG
CTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCA
GCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGT
GCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGG

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000429994_chr3_194790840_-_682nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAA
TTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATTGCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATG
AATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGATGCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATG
ATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGG
CTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCA
GCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGT
GCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACAP2_ENST00000326793_chr3_195063200_-_XXYLT1_ENST00000310380_chr3_194947585_-_2873nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAATTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATT
GCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATGAATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGAT
GCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATGATAAATTTTCACACAATCCTGTTTGACCAAACTCAGAGA
TCAATTAAGGCACAGCTTCAGAACTTTGTTAAAGAAGATCTTAGAAAATTCAAAGATGCCAAGAAGCAATTCGAAAAAGTCAGTGAAGAA
AAAGAAAATGCGTTAGTAAAAAATGCCCAAGTACAAAGAAACAAACAACATGAAGTTGAAGAAGCCACCAACATTCTGACAGCAACAAGA
AAATGTTTCCGACACATAGCCCTCGATTATGTGCTTCAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAGCTCTTCCCCATCGTG
GAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCCATGCATCAGATCATG
CCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTC
CTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACC
CGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTC
TACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACC
ATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTAC
AGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCATCCCGGAGGACTAGGCG
CTCCCCGTGCCTTGCCCCCGGGGCCTCCAGATCTGGGGGAAGGACAGGGTTCCTTGGGACAGACCCAAGGGCAGTGTCTGACCCGCTAGA
GAGACACCGCAGGGAAGTCCTGTGATTAAGGTGCTGAGACCTCCTGCCGGGCAGGTCACTGTGCTGAGGCCACCCGCCAAGGACTGGCCT
GTGCACTGCTGGTGCTTGGGACCTTATTCCTCCAGGGAGCAGGCGACACAAAGGACACGCATGTCCAGTGGGCTGGGAAGCAAGCACTTG
AAGAGAAGGAAGGGGAGAAAGGGTCCCCCTTGCTGTCTGCCTCTGAGGAATGGAAATCCTTTAGACCCGGCCTTTTTTGGACCAATATAA
ATTTAATTTAAATTGACAGCCTTCCATTTTTCGAGAAAGTACAAACAGAACTGCTTTAGCACCCATCGAGCCCCAAACGGGTAAGGTAAG
CCAAGGTTTTAATGACCAGCCCAGTATCTAAGCTTCCAAACGAATGCCAGCCCATCACATACTCACCCTGGGAGGCTGCTGCACGCGCAT
TCTCCTGATGCTCACGTCACTTGGTGTAGGTTTCAGGATCGCCTCTTTGAGGAAGGACTTCAGGACCAACTGGGGCCTGCATAAGAAAAC
TTATCTCATTATTAGAGTACTCACAGCTTGTATCTCCCAGCTACATCCTAGAACCCCATTGTCCTTTATTCCACCAAACCAGCTCCAGGT
GACCAGACTCTACTCAGAAAGCAAATTCGTCATCAAAGAACAGAGACTGGCCACCACAAGGACATGCAGGAGAACTGTCGGGACCAGGAA
GACTCATTCCAAAAAGCCCAGGCCGGGCACAGTCGTCAAGCCTGTAATCCCAACACTTTGGGAGACCGAGGTGGGGGTATCGATTGAGCC
TCGGAGGTCGAGATCAGCCTGGGAAACACAGGGAGGCCCCCATCGCTACAAAATATTTTAAAAATTAGCCAGGTGTGGTGGCTTGTGCTT
GTTGTCCCGGCTACTTGGGAGGCTGAAGTGGGAGGGTGGCTTGAGTCCAGGAGTTCACTGCACTGAGCTGTGATCACACCACTGCACTCC
AGCCTGGACGACAGAGTGAGACGTCCATCTCAAAAAAAAAAAAAAAACCAAAAAGGAACCCAGCAATTCCCAAGTGTGACCATGTGGGCT
TGGAAGACATGTCACTCATGGGCTAGTAAGCATTCTAGTTTCTTTGTTTAAAAAATCCCCTTATCATACCACGTTAGACCGTAGACCTTA
GCAGAAATTAAAGCGTCATTTCTTTTGATGGGGCCTCCTGTACGTAGGCTGCAGACGTGAAAGCCCCAGGGGTCCATTTGTATCAATTTT

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000310380_chr3_194790840_-_2349nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAATTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATT
GCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATGAATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGAT
GCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATGATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCA
TGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCAT
GCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGA
CCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTG
GAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCAT
CCCGGAGGACTAGGCGCTCCCCGTGCCTTGCCCCCGGGGCCTCCAGATCTGGGGGAAGGACAGGGTTCCTTGGGACAGACCCAAGGGCAG
TGTCTGACCCGCTAGAGAGACACCGCAGGGAAGTCCTGTGATTAAGGTGCTGAGACCTCCTGCCGGGCAGGTCACTGTGCTGAGGCCACC
CGCCAAGGACTGGCCTGTGCACTGCTGGTGCTTGGGACCTTATTCCTCCAGGGAGCAGGCGACACAAAGGACACGCATGTCCAGTGGGCT
GGGAAGCAAGCACTTGAAGAGAAGGAAGGGGAGAAAGGGTCCCCCTTGCTGTCTGCCTCTGAGGAATGGAAATCCTTTAGACCCGGCCTT
TTTTGGACCAATATAAATTTAATTTAAATTGACAGCCTTCCATTTTTCGAGAAAGTACAAACAGAACTGCTTTAGCACCCATCGAGCCCC
AAACGGGTAAGGTAAGCCAAGGTTTTAATGACCAGCCCAGTATCTAAGCTTCCAAACGAATGCCAGCCCATCACATACTCACCCTGGGAG
GCTGCTGCACGCGCATTCTCCTGATGCTCACGTCACTTGGTGTAGGTTTCAGGATCGCCTCTTTGAGGAAGGACTTCAGGACCAACTGGG
GCCTGCATAAGAAAACTTATCTCATTATTAGAGTACTCACAGCTTGTATCTCCCAGCTACATCCTAGAACCCCATTGTCCTTTATTCCAC
CAAACCAGCTCCAGGTGACCAGACTCTACTCAGAAAGCAAATTCGTCATCAAAGAACAGAGACTGGCCACCACAAGGACATGCAGGAGAA
CTGTCGGGACCAGGAAGACTCATTCCAAAAAGCCCAGGCCGGGCACAGTCGTCAAGCCTGTAATCCCAACACTTTGGGAGACCGAGGTGG
GGGTATCGATTGAGCCTCGGAGGTCGAGATCAGCCTGGGAAACACAGGGAGGCCCCCATCGCTACAAAATATTTTAAAAATTAGCCAGGT
GTGGTGGCTTGTGCTTGTTGTCCCGGCTACTTGGGAGGCTGAAGTGGGAGGGTGGCTTGAGTCCAGGAGTTCACTGCACTGAGCTGTGAT
CACACCACTGCACTCCAGCCTGGACGACAGAGTGAGACGTCCATCTCAAAAAAAAAAAAAAAACCAAAAAGGAACCCAGCAATTCCCAAG
TGTGACCATGTGGGCTTGGAAGACATGTCACTCATGGGCTAGTAAGCATTCTAGTTTCTTTGTTTAAAAAATCCCCTTATCATACCACGT
TAGACCGTAGACCTTAGCAGAAATTAAAGCGTCATTTCTTTTGATGGGGCCTCCTGTACGTAGGCTGCAGACGTGAAAGCCCCAGGGGTC
CATTTGTATCAATTTTCATCTTGTTTTGTTTTGATTTCATTTACGTTTTTCTTTTTCCCATGAGTGAGGATAGCCAATAAATCATCTTTG

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000429994_chr3_194790840_-_951nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAATTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATT
GCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATGAATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGAT
GCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATGATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCA
TGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCAT
GCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGA
CCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTG
GAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCAT

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_XXYLT1_ENST00000310380_chr3_194790840_-_2117nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGC
TTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAG
CTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTG
CTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGC
CACGTCAAGATCTACCACGGGAACTGCAACACTCCCATCCCGGAGGACTAGGCGCTCCCCGTGCCTTGCCCCCGGGGCCTCCAGATCTGG
GGGAAGGACAGGGTTCCTTGGGACAGACCCAAGGGCAGTGTCTGACCCGCTAGAGAGACACCGCAGGGAAGTCCTGTGATTAAGGTGCTG
AGACCTCCTGCCGGGCAGGTCACTGTGCTGAGGCCACCCGCCAAGGACTGGCCTGTGCACTGCTGGTGCTTGGGACCTTATTCCTCCAGG
GAGCAGGCGACACAAAGGACACGCATGTCCAGTGGGCTGGGAAGCAAGCACTTGAAGAGAAGGAAGGGGAGAAAGGGTCCCCCTTGCTGT
CTGCCTCTGAGGAATGGAAATCCTTTAGACCCGGCCTTTTTTGGACCAATATAAATTTAATTTAAATTGACAGCCTTCCATTTTTCGAGA
AAGTACAAACAGAACTGCTTTAGCACCCATCGAGCCCCAAACGGGTAAGGTAAGCCAAGGTTTTAATGACCAGCCCAGTATCTAAGCTTC
CAAACGAATGCCAGCCCATCACATACTCACCCTGGGAGGCTGCTGCACGCGCATTCTCCTGATGCTCACGTCACTTGGTGTAGGTTTCAG
GATCGCCTCTTTGAGGAAGGACTTCAGGACCAACTGGGGCCTGCATAAGAAAACTTATCTCATTATTAGAGTACTCACAGCTTGTATCTC
CCAGCTACATCCTAGAACCCCATTGTCCTTTATTCCACCAAACCAGCTCCAGGTGACCAGACTCTACTCAGAAAGCAAATTCGTCATCAA
AGAACAGAGACTGGCCACCACAAGGACATGCAGGAGAACTGTCGGGACCAGGAAGACTCATTCCAAAAAGCCCAGGCCGGGCACAGTCGT
CAAGCCTGTAATCCCAACACTTTGGGAGACCGAGGTGGGGGTATCGATTGAGCCTCGGAGGTCGAGATCAGCCTGGGAAACACAGGGAGG
CCCCCATCGCTACAAAATATTTTAAAAATTAGCCAGGTGTGGTGGCTTGTGCTTGTTGTCCCGGCTACTTGGGAGGCTGAAGTGGGAGGG
TGGCTTGAGTCCAGGAGTTCACTGCACTGAGCTGTGATCACACCACTGCACTCCAGCCTGGACGACAGAGTGAGACGTCCATCTCAAAAA
AAAAAAAAAAACCAAAAAGGAACCCAGCAATTCCCAAGTGTGACCATGTGGGCTTGGAAGACATGTCACTCATGGGCTAGTAAGCATTCT
AGTTTCTTTGTTTAAAAAATCCCCTTATCATACCACGTTAGACCGTAGACCTTAGCAGAAATTAAAGCGTCATTTCTTTTGATGGGGCCT
CCTGTACGTAGGCTGCAGACGTGAAAGCCCCAGGGGTCCATTTGTATCAATTTTCATCTTGTTTTGTTTTGATTTCATTTACGTTTTTCT

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_XXYLT1_ENST00000429994_chr3_194790840_-_719nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGCACACATTCTGGCAGTTCCGCCATGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGC
TTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAG
CTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGACCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTG
CTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGC

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000310380_chr3_194790840_-_2349nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAATTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATT
GCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATGAATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGAT
GCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATGATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCA
TGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCAT
GCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGA
CCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTG
GAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCAT
CCCGGAGGACTAGGCGCTCCCCGTGCCTTGCCCCCGGGGCCTCCAGATCTGGGGGAAGGACAGGGTTCCTTGGGACAGACCCAAGGGCAG
TGTCTGACCCGCTAGAGAGACACCGCAGGGAAGTCCTGTGATTAAGGTGCTGAGACCTCCTGCCGGGCAGGTCACTGTGCTGAGGCCACC
CGCCAAGGACTGGCCTGTGCACTGCTGGTGCTTGGGACCTTATTCCTCCAGGGAGCAGGCGACACAAAGGACACGCATGTCCAGTGGGCT
GGGAAGCAAGCACTTGAAGAGAAGGAAGGGGAGAAAGGGTCCCCCTTGCTGTCTGCCTCTGAGGAATGGAAATCCTTTAGACCCGGCCTT
TTTTGGACCAATATAAATTTAATTTAAATTGACAGCCTTCCATTTTTCGAGAAAGTACAAACAGAACTGCTTTAGCACCCATCGAGCCCC
AAACGGGTAAGGTAAGCCAAGGTTTTAATGACCAGCCCAGTATCTAAGCTTCCAAACGAATGCCAGCCCATCACATACTCACCCTGGGAG
GCTGCTGCACGCGCATTCTCCTGATGCTCACGTCACTTGGTGTAGGTTTCAGGATCGCCTCTTTGAGGAAGGACTTCAGGACCAACTGGG
GCCTGCATAAGAAAACTTATCTCATTATTAGAGTACTCACAGCTTGTATCTCCCAGCTACATCCTAGAACCCCATTGTCCTTTATTCCAC
CAAACCAGCTCCAGGTGACCAGACTCTACTCAGAAAGCAAATTCGTCATCAAAGAACAGAGACTGGCCACCACAAGGACATGCAGGAGAA
CTGTCGGGACCAGGAAGACTCATTCCAAAAAGCCCAGGCCGGGCACAGTCGTCAAGCCTGTAATCCCAACACTTTGGGAGACCGAGGTGG
GGGTATCGATTGAGCCTCGGAGGTCGAGATCAGCCTGGGAAACACAGGGAGGCCCCCATCGCTACAAAATATTTTAAAAATTAGCCAGGT
GTGGTGGCTTGTGCTTGTTGTCCCGGCTACTTGGGAGGCTGAAGTGGGAGGGTGGCTTGAGTCCAGGAGTTCACTGCACTGAGCTGTGAT
CACACCACTGCACTCCAGCCTGGACGACAGAGTGAGACGTCCATCTCAAAAAAAAAAAAAAAACCAAAAAGGAACCCAGCAATTCCCAAG
TGTGACCATGTGGGCTTGGAAGACATGTCACTCATGGGCTAGTAAGCATTCTAGTTTCTTTGTTTAAAAAATCCCCTTATCATACCACGT
TAGACCGTAGACCTTAGCAGAAATTAAAGCGTCATTTCTTTTGATGGGGCCTCCTGTACGTAGGCTGCAGACGTGAAAGCCCCAGGGGTC
CATTTGTATCAATTTTCATCTTGTTTTGTTTTGATTTCATTTACGTTTTTCTTTTTCCCATGAGTGAGGATAGCCAATAAATCATCTTTG

>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_XXYLT1_ENST00000429994_chr3_194790840_-_951nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAATTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATT
GCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATGAATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGAT
GCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATGATAAATTTTCACACAGCACACATTCTGGCAGTTCCGCCA
TGAGAACCCCCAGACCCGGGTTGGGGGCCCGCCCCCCGAGGGGCTGCCGGGCTTCAACAGCGGGGTGATGTTGCTGAACCTGGAGGCCAT
GCGCCAGTCCCCGCTCTACAGCCGCCTGCTGGAGCCGGCGCAGGTGCAGCAGCTGGCCGACAAGTACCACTTCCGCGGCCACCTCGGGGA
CCAGGACTTCTTCACCATGATCGGCATGGAGCACCCCAAGCTCTTCCATGTGCTGGACTGTACCTGGAACCGGCAGCTGTGCACCTGGTG
GAGGGACCATGGCTACAGTGACGTCTTCGAGGCCTATTTCAGGTGTGAGGGCCACGTCAAGATCTACCACGGGAACTGCAACACTCCCAT


Top

FusionGenePPI for ACAP2_XXYLT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACAP2SMURF1, HSPB1, RAB11FIP3, MED4, PDK3, SOAT1, NDUFS1, NDUFA9, PIGS, MBOAT7, EHBP1, GDI1, GPAA1, CYLDXXYLT1ELAVL1, CUL4A, SHMT2, MOV10, NXF1, FAM63B, SCN3B, IZUMO1, HAUS7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000310380-04263_266168394target proteins
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000355729-03263_2660191target proteins
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000356740-02263_2660188target proteins
TgeneXXYLT1chr3:195063200chr3:194947585ENST00000437101-05263_266-154191target proteins
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000310380-24263_266261394target proteins
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000355729-13263_26658191target proteins
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000356740-02263_26655188target proteins
TgeneXXYLT1chr3:195101738chr3:194790840ENST00000437101-35263_26658191target proteins
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000310380-24263_266261394target proteins
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000355729-13263_26658191target proteins
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000356740-02263_26655188target proteins
TgeneXXYLT1chr3:195163524chr3:194790840ENST00000437101-35263_26658191target proteins


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACAP2_XXYLT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ACAP2_XXYLT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource