FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3526

FusionGeneSummary for ATP9B_ATRX

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP9B_ATRX
Fusion gene ID: 3526
HgeneTgene
Gene symbol

ATP9B

ATRX

Gene ID

374868

546

Gene nameATPase phospholipid transporting 9B (putative)ATRX, chromatin remodeler
SynonymsATPASEP|ATPIIB|HUSSY-20|NEO1L|hMMR1JMS|MRX52|RAD54|RAD54L|XH2|XNP|ZNF-HX
Cytomap

18q23

Xq21.1

Type of geneprotein-codingprotein-coding
Descriptionprobable phospholipid-transporting ATPase IIBATPase type IV, phospholipid transporting (P-type)ATPase, class II, type 9Bmacrophage MHC receptor 1transcriptional regulator ATRXATP-dependent helicase ATRXX-linked helicase IIX-linked nuclear proteinalpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae)
Modification date2018052320180519
UniProtAcc

O43861

P46100

Ensembl transtripts involved in fusion geneENST00000426216, ENST00000307671, 
ENST00000586722, ENST00000591464, 
ENST00000458297, ENST00000543761, 
ENST00000373344, ENST00000395603, 
ENST00000480283, ENST00000373341, 
Fusion gene scores* DoF score4 X 4 X 2=321 X 1 X 1=1
# samples 31
** MAII scorelog2(3/32*10)=-0.0931094043914815
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: ATP9B [Title/Abstract] AND ATRX [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneATRX

GO:0006334

nucleosome assembly

20651253

TgeneATRX

GO:0006338

chromatin remodeling

20651253


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1L0-01AATP9Bchr18

76856649

+ATRXchrX

76909690

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000426216ENST00000373344ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000426216ENST00000395603ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-5UTRENST00000426216ENST00000480283ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-intronENST00000426216ENST00000373341ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000307671ENST00000373344ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000307671ENST00000395603ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-5UTRENST00000307671ENST00000480283ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-intronENST00000307671ENST00000373341ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000586722ENST00000373344ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000586722ENST00000395603ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-5UTRENST00000586722ENST00000480283ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-intronENST00000586722ENST00000373341ATP9Bchr18

76856649

+ATRXchrX

76909690

-
3UTR-3CDSENST00000591464ENST00000373344ATP9Bchr18

76856649

+ATRXchrX

76909690

-
3UTR-3CDSENST00000591464ENST00000395603ATP9Bchr18

76856649

+ATRXchrX

76909690

-
3UTR-5UTRENST00000591464ENST00000480283ATP9Bchr18

76856649

+ATRXchrX

76909690

-
3UTR-intronENST00000591464ENST00000373341ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000458297ENST00000373344ATP9Bchr18

76856649

+ATRXchrX

76909690

-
In-frameENST00000458297ENST00000395603ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-5UTRENST00000458297ENST00000480283ATP9Bchr18

76856649

+ATRXchrX

76909690

-
5CDS-intronENST00000458297ENST00000373341ATP9Bchr18

76856649

+ATRXchrX

76909690

-
intron-3CDSENST00000543761ENST00000373344ATP9Bchr18

76856649

+ATRXchrX

76909690

-
intron-3CDSENST00000543761ENST00000395603ATP9Bchr18

76856649

+ATRXchrX

76909690

-
intron-5UTRENST00000543761ENST00000480283ATP9Bchr18

76856649

+ATRXchrX

76909690

-
intron-intronENST00000543761ENST00000373341ATP9Bchr18

76856649

+ATRXchrX

76909690

-

Top

FusionProtFeatures for ATP9B_ATRX


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP9B

O43861

ATRX

P46100


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351443_146614042493Compositional biasNote=Poly-Glu
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351499_150214042493Compositional biasNote=Poly-Glu
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351929_193914042493Compositional biasNote=Poly-Lys
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351941_194814042493Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12352222_222514042493Compositional biasNote=Poly-Lys
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12352262_226514042493Compositional biasNote=Poly-Glu
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12352420_242514042493Compositional biasNote=Poly-Gln
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341443_146613662455Compositional biasNote=Poly-Glu
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341499_150213662455Compositional biasNote=Poly-Glu
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341929_193913662455Compositional biasNote=Poly-Lys
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341941_194813662455Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11342222_222513662455Compositional biasNote=Poly-Lys
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11342262_226513662455Compositional biasNote=Poly-Glu
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11342420_242513662455Compositional biasNote=Poly-Gln
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351581_176814042493DomainHelicase ATP-binding
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12352025_220514042493DomainHelicase C-terminal
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341581_176813662455DomainHelicase ATP-binding
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11342025_220513662455DomainHelicase C-terminal
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351719_172214042493MotifNote=DEGH box
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341719_172213662455MotifNote=DEGH box
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351594_160114042493Nucleotide bindingATP
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341594_160113662455Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291032_1038971137Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291062_1067971137Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291089_1105971137Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291131_1147971137Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229169_173971137Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229197_380971137Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291_146971137Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229402_409971137Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229432_930971137Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229952_963971137Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229983_1012971137Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301032_1038971148Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301062_1067971148Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301089_1105971148Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301131_1147971148Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230169_173971148Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230197_380971148Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301_146971148Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230402_409971148Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230432_930971148Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230952_963971148Topological domainExtracellular
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230983_1012971148Topological domainCytoplasmic
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291013_1031971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291039_1061971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291068_1088971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+2291106_1130971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229147_168971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229174_196971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229381_401971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229410_431971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229931_951971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000307671+229964_982971137TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301013_1031971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301039_1061971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301068_1088971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+2301106_1130971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230147_168971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230174_196971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230381_401971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230410_431971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230931_951971148TransmembraneHelical
HgeneATP9Bchr18:76856649chrX:76909690ENST00000426216+230964_982971148TransmembraneHelical
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351151_115614042493Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351166_116914042493Compositional biasNote=Poly-Lys
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351202_120614042493Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351259_126614042493Compositional biasNote=Poly-Asp
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-1235745_75014042493Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341151_115613662455Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341166_116913662455Compositional biasNote=Poly-Lys
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341202_120613662455Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341259_126613662455Compositional biasNote=Poly-Asp
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-1134745_75013662455Compositional biasNote=Poly-Ser
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-1235159_29614042493DomainADD
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-1134159_29613662455DomainADD
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-1235581_59414042493MotifNote=PxVxL motif
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-1134581_59413662455MotifNote=PxVxL motif
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-1235170_20614042493Zinc fingerGATA-type%3B atypical
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-1235217_27214042493Zinc fingerPHD-type%3B atypical
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-1134170_20613662455Zinc fingerGATA-type%3B atypical
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-1134217_27213662455Zinc fingerPHD-type%3B atypical


Top

FusionGeneSequence for ATP9B_ATRX


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP9B_ENST00000426216_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_1186aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDD
KLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCE
SVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSY
MLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIE
THCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTEMLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLT
QYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEIL
RMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLRNIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQGTMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTEL
TTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNL
PPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRR
EAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMTQPVAGGMQPPPLQRAPP

>In-frame_ATP9B_ENST00000426216_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_1186aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDD
KLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCE
SVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSY
MLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIE
THCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTEMLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLT
QYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEIL
RMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLRNIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQGTMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTEL
TTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNL
PPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRR
EAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMTQPVAGGMQPPPLQRAPP

>In-frame_ATP9B_ENST00000307671_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_1186aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDD
KLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCE
SVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSY
MLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIE
THCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTEMLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLT
QYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEIL
RMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLRNIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQGTMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTEL
TTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNL
PPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRR
EAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMTQPVAGGMQPPPLQRAPP

>In-frame_ATP9B_ENST00000307671_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_1186aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDD
KLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCE
SVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSY
MLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIE
THCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTEMLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLT
QYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEIL
RMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLRNIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQGTMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTEL
TTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNL
PPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRR
EAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMTQPVAGGMQPPPLQRAPP

>In-frame_ATP9B_ENST00000586722_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_1186aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDD
KLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCE
SVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSY
MLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIE
THCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTEMLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLT
QYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEIL
RMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLRNIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQGTMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTEL
TTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNL
PPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRR
EAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMTQPVAGGMQPPPLQRAPP

>In-frame_ATP9B_ENST00000586722_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_1186aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDD
KLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCE
SVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSY
MLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIE
THCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTEMLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLT
QYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEIL
RMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLRNIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQGTMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTEL
TTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNL
PPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRR
EAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMTQPVAGGMQPPPLQRAPP

>In-frame_ATP9B_ENST00000458297_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_1134aa
MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEK
EEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVL
DEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLN
TALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCD
EGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIETHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTE
MLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLTQYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENK
GTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKAT
SSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLR
NIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQG
TMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTELTTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLD
HKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNLPPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQP
LEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMP

>In-frame_ATP9B_ENST00000458297_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_1134aa
MPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTRSAKKAELEENQRSTKQKKKRRRIKVQEDSSSENKSNSEEEEEEK
EEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVL
DEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLN
TALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGTEMTRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCD
EGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIETHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILTE
MLAGCVQRKDTTALTKFLPPKHETVLAVRMTSIQCKLTQYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENK
GTFDEDSMDEFIASDSDETSMSLSSDDTTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKAT
SSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLITKGEGKWLR
NIDTYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSTDIQSIFRVTRFGQTKPVTVTRFLAQG
TMEDKITDRQVTKQSLSFRVVDQQQVERHFTMNELTELTTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLD
HKEEEELTEEERKAAWAETEAEKKGLTMRFNIPTGTNLPPVSFNSQTPTIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQP
LEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTTQQATLGHLMMP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP9B_ENST00000426216_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_3558nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGACGT
ATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAGGAG
GAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGATGAT
AAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAATTG
AGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAAGAA
CCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGTGAG
TCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGTTTT
CTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAATGAA
TTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGCTAC
ATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAGAGT
CGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAATGAA
GCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATTGAG
TATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAATGGT
CAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAGAGG
AAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTCTAT
CAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTTCAG
ATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGTATG
GATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAGGGG
AAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGTGAA
GGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGCCCA
GCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATTCTT
CGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTAGCT
AGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTAGAT
GGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCTACT
AAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAGAGT
ATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTATGAT
CGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAACTT
TATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATACTT
GCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTGACT
GAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAATTTA
CCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGACCTC
ATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCTGTA
TGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGAAGA
GAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAGCAG
TACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATGAAT
CCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCACCC

>In-frame_ATP9B_ENST00000426216_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_3558nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGACGT
ATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAGGAG
GAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGATGAT
AAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAATTG
AGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAAGAA
CCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGTGAG
TCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGTTTT
CTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAATGAA
TTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGCTAC
ATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAGAGT
CGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAATGAA
GCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATTGAG
TATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAATGGT
CAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAGAGG
AAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTCTAT
CAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTTCAG
ATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGTATG
GATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAGGGG
AAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGTGAA
GGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGCCCA
GCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATTCTT
CGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTAGCT
AGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTAGAT
GGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCTACT
AAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAGAGT
ATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTATGAT
CGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAACTT
TATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATACTT
GCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTGACT
GAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAATTTA
CCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGACCTC
ATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCTGTA
TGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGAAGA
GAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAGCAG
TACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATGAAT
CCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCACCC

>In-frame_ATP9B_ENST00000307671_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_3558nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGACGT
ATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAGGAG
GAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGATGAT
AAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAATTG
AGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAAGAA
CCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGTGAG
TCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGTTTT
CTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAATGAA
TTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGCTAC
ATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAGAGT
CGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAATGAA
GCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATTGAG
TATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAATGGT
CAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAGAGG
AAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTCTAT
CAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTTCAG
ATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGTATG
GATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAGGGG
AAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGTGAA
GGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGCCCA
GCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATTCTT
CGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTAGCT
AGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTAGAT
GGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCTACT
AAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAGAGT
ATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTATGAT
CGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAACTT
TATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATACTT
GCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTGACT
GAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAATTTA
CCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGACCTC
ATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCTGTA
TGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGAAGA
GAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAGCAG
TACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATGAAT
CCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCACCC

>In-frame_ATP9B_ENST00000307671_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_3558nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGACGT
ATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAGGAG
GAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGATGAT
AAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAATTG
AGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAAGAA
CCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGTGAG
TCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGTTTT
CTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAATGAA
TTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGCTAC
ATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAGAGT
CGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAATGAA
GCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATTGAG
TATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAATGGT
CAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAGAGG
AAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTCTAT
CAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTTCAG
ATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGTATG
GATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAGGGG
AAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGTGAA
GGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGCCCA
GCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATTCTT
CGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTAGCT
AGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTAGAT
GGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCTACT
AAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAGAGT
ATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTATGAT
CGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAACTT
TATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATACTT
GCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTGACT
GAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAATTTA
CCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGACCTC
ATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCTGTA
TGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGAAGA
GAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAGCAG
TACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATGAAT
CCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCACCC

>In-frame_ATP9B_ENST00000586722_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_3558nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGACGT
ATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAGGAG
GAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGATGAT
AAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAATTG
AGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAAGAA
CCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGTGAG
TCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGTTTT
CTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAATGAA
TTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGCTAC
ATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAGAGT
CGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAATGAA
GCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATTGAG
TATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAATGGT
CAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAGAGG
AAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTCTAT
CAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTTCAG
ATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGTATG
GATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAGGGG
AAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGTGAA
GGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGCCCA
GCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATTCTT
CGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTAGCT
AGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTAGAT
GGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCTACT
AAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAGAGT
ATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTATGAT
CGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAACTT
TATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATACTT
GCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTGACT
GAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAATTTA
CCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGACCTC
ATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCTGTA
TGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGAAGA
GAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAGCAG
TACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATGAAT
CCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCACCC

>In-frame_ATP9B_ENST00000586722_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_3558nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGACGT
ATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAGGAG
GAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGATGAT
AAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAATTG
AGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAAGAA
CCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGTGAG
TCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGTTTT
CTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAATGAA
TTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGCTAC
ATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAGAGT
CGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAATGAA
GCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATTGAG
TATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAATGGT
CAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAGAGG
AAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTCTAT
CAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTTCAG
ATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGTATG
GATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAGGGG
AAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGTGAA
GGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGCCCA
GCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATTCTT
CGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTAGCT
AGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTAGAT
GGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCTACT
AAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAGAGT
ATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTATGAT
CGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAACTT
TATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATACTT
GCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTGACT
GAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAATTTA
CCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGACCTC
ATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCTGTA
TGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGAAGA
GAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAGCAG
TACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATGAAT
CCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCACCC

>In-frame_ATP9B_ENST00000458297_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_3402nt
ATGCCACTAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGA
GGACTGGAGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTAT
AAACAGAAAAAGAAAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAA
GAAGAGGAGGAGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAA
ATTCGGAAGATTCTTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAG
AGGGAGCGTGAGCGAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTA
GATGAAGATGAAGAAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAG
TTTATGTGGGATTGCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGT
AAGACTTTACAGGTGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAAT
ACTGCTTTGAATTGGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTG
AAACGTCCTCAGGAGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTT
GCTCAAGGAAGGAATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGAT
GAAGGCCATATTCTAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACA
CCACTTCAAAATAACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGA
TTTATAAATCCAATTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAG
ATGTTAGCTGGATGTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATG
ACTTCTATTCAGTGCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGT
GCAAAGCTTTTCCAAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAG
GGTTATTTTGATGAAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAA
AAGAAGAAAAAAGGGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAAT
TCAAGATCTCGGGGAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACT
TCTTCTTCTAATCCAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAA
ATGGTACTTCTCTTTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTG
ATTGAAGATTTTCTTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGA
AACATTGACTATTACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGA
GGACGATTATTTATCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGG
AATCCATCTTATGACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGA
ACCATGGAAGATAAGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTT
ACTATGAATGAGCTTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCC
ATGCTGCCAAAGGATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGAC
CACAAAGAAGAAGAAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTC
AACATACCAACTGGGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATG
AGTAATCAACAGCTGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCT
CTTGAGGATATAATTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGC
CAGGAGCTTGATGTTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTT
ATGAACAGAAGGCTCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCA
AAGCCCCCAAATTTGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCA

>In-frame_ATP9B_ENST00000458297_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_3402nt
ATGCCACTAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGA
GGACTGGAGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTAT
AAACAGAAAAAGAAAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAA
GAAGAGGAGGAGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAA
ATTCGGAAGATTCTTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAG
AGGGAGCGTGAGCGAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTA
GATGAAGATGAAGAAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAG
TTTATGTGGGATTGCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGT
AAGACTTTACAGGTGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAAT
ACTGCTTTGAATTGGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTG
AAACGTCCTCAGGAGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTT
GCTCAAGGAAGGAATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGAT
GAAGGCCATATTCTAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACA
CCACTTCAAAATAACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGA
TTTATAAATCCAATTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAG
ATGTTAGCTGGATGTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATG
ACTTCTATTCAGTGCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGT
GCAAAGCTTTTCCAAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAG
GGTTATTTTGATGAAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAA
AAGAAGAAAAAAGGGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAAT
TCAAGATCTCGGGGAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACT
TCTTCTTCTAATCCAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAA
ATGGTACTTCTCTTTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTG
ATTGAAGATTTTCTTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGA
AACATTGACTATTACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGA
GGACGATTATTTATCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGG
AATCCATCTTATGACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGA
ACCATGGAAGATAAGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTT
ACTATGAATGAGCTTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCC
ATGCTGCCAAAGGATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGAC
CACAAAGAAGAAGAAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTC
AACATACCAACTGGGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATG
AGTAATCAACAGCTGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCT
CTTGAGGATATAATTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGC
CAGGAGCTTGATGTTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTT
ATGAACAGAAGGCTCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCA
AAGCCCCCAAATTTGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP9B_ENST00000426216_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_7048nt
AAAGGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCT
ACTACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCAC
TAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGG
AGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGA
AAAAGAAAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGG
AGGAGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGA
AGATTCTTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGC
GTGAGCGAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAG
ATGAAGAAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGT
GGGATTGCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTT
TACAGGTGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTT
TGAATTGGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTC
CTCAGGAGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAG
GAAGGAATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCC
ATATTCTAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTC
AAAATAACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAA
ATCCAATTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAG
CTGGATGTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTA
TTCAGTGCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGC
TTTTCCAAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATT
TTGATGAAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGA
AAAAAGGGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGAT
CTCGGGGAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTT
CTAATCCAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTAC
TTCTCTTTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAG
ATTTTCTTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTG
ACTATTACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGAT
TATTTATCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCAT
CTTATGACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGG
AAGATAAGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGA
ATGAGCTTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGC
CAAAGGATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAG
AAGAAGAAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATAC
CAACTGGGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATC
AACAGCTGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGG
ATATAATTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGC
TTGATGTTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACA
GAAGGCTCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCC
CAAATTTGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCAT
TACAGCGTGCACCACCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATT
GTTAAAATCATAGAAAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCC
AATCTTCCATATTAGTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTC
TTACACACGCTGAGTACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTC
TAAATTTTTATGCCTGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTA
CATATAAAAACACACAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATT
GAAATGGTTTTAATGTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTAT
CTTTGACACAGAATTGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAG
CCTTAAGTATAGCCTAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTAC
TGGTAAAATTTCAGGGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGT
GCCAGTGCTAATGCTTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTT
GTGGTTGTTAGGTTCACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTT
AACAATTCCCAGTACTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCA
TGTTCTTTTACCCCAGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATC
AAAATTAATTCATCCAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATG
ACCTATAAATTTATTCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAG
AACCATTTTTGAGATGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTT
TGGGCTTTGCTTTAGGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCAT
TTTTATCTTGGAAGAACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCT
CCCCCACTTTCCCATGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTG
GGGCAGGTGTGTATTTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCA
GTTGGTATTTCTACAAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACAT
AGATGTGAAAATTTTAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGA
AATCAGAGTTTGAAATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACA
TCAAGCTTTAACAAATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAAT
AGTTGCAATGGATTAAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTAT
TTCTTTGGGTGTAAAGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAG
CTTTGGCTGCTGAAATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTG
TAGAAAAGATGTCACTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGA
CAATATACTATCTGTGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAAT
GTGTTGTGCTCTTTATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATA
ATGGTGGTTCTTTTGCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGG
GAGATCTCTCATCTCAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCAT
TTCCTGTTTCCCAACAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAG
CTTCCTTATTACCTGGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGA
TCGATATTTATGTGCCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAG
GCTATAGAGACTTATTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTA
TTTCACCAGACTCAGTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTC
AAGTCTATAATCTGAGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGG

>In-frame_ATP9B_ENST00000426216_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_7026nt
AAAGGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCT
ACTACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCAC
TAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGG
AGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGA
AAAAGAAAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGG
AGGAGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGA
AGATTCTTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGC
GTGAGCGAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAG
ATGAAGAAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGT
GGGATTGCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTT
TACAGGTGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTT
TGAATTGGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTC
CTCAGGAGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAG
GAAGGAATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCC
ATATTCTAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTC
AAAATAACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAA
ATCCAATTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAG
CTGGATGTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTA
TTCAGTGCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGC
TTTTCCAAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATT
TTGATGAAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGA
AAAAAGGGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGAT
CTCGGGGAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTT
CTAATCCAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTAC
TTCTCTTTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAG
ATTTTCTTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTG
ACTATTACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGAT
TATTTATCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCAT
CTTATGACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGG
AAGATAAGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGA
ATGAGCTTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGC
CAAAGGATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAG
AAGAAGAAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATAC
CAACTGGGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATC
AACAGCTGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGG
ATATAATTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGC
TTGATGTTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACA
GAAGGCTCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCC
CAAATTTGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCAT
TACAGCGTGCACCACCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATT
GTTAAAATCATAGAAAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCC
AATCTTCCATATTAGTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTC
TTACACACGCTGAGTACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTC
TAAATTTTTATGCCTGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTA
CATATAAAAACACACAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATT
GAAATGGTTTTAATGTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTAT
CTTTGACACAGAATTGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAG
CCTTAAGTATAGCCTAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTAC
TGGTAAAATTTCAGGGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGT
GCCAGTGCTAATGCTTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTT
GTGGTTGTTAGGTTCACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTT
AACAATTCCCAGTACTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCA
TGTTCTTTTACCCCAGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATC
AAAATTAATTCATCCAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATG
ACCTATAAATTTATTCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAG
AACCATTTTTGAGATGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTT
TGGGCTTTGCTTTAGGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCAT
TTTTATCTTGGAAGAACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCT
CCCCCACTTTCCCATGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTG
GGGCAGGTGTGTATTTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCA
GTTGGTATTTCTACAAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACAT
AGATGTGAAAATTTTAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGA
AATCAGAGTTTGAAATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACA
TCAAGCTTTAACAAATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAAT
AGTTGCAATGGATTAAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTAT
TTCTTTGGGTGTAAAGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAG
CTTTGGCTGCTGAAATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTG
TAGAAAAGATGTCACTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGA
CAATATACTATCTGTGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAAT
GTGTTGTGCTCTTTATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATA
ATGGTGGTTCTTTTGCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGG
GAGATCTCTCATCTCAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCAT
TTCCTGTTTCCCAACAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAG
CTTCCTTATTACCTGGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGA
TCGATATTTATGTGCCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAG
GCTATAGAGACTTATTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTA
TTTCACCAGACTCAGTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTC
AAGTCTATAATCTGAGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGG

>In-frame_ATP9B_ENST00000307671_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_7045nt
GGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACT
ACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAA
TGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGT
GGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAA
AGAAAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGG
AGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGA
TTCTTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTG
AGCGAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATG
AAGAAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGG
ATTGCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTAC
AGGTGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGA
ATTGGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTC
AGGAGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAA
GGAATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATA
TTCTAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAA
ATAACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATC
CAATTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTG
GATGTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTC
AGTGCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTT
TCCAAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTG
ATGAAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAA
AAGGGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTC
GGGGAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTA
ATCCAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTC
TCTTTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATT
TTCTTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACT
ATTACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTAT
TTATCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTT
ATGACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAG
ATAAGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATG
AGCTTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAA
AGGATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAG
AAGAAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAA
CTGGGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAAC
AGCTGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATA
TAATTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTG
ATGTTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAA
GGCTCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAA
ATTTGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTAC
AGCGTGCACCACCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATTGTT
AAAATCATAGAAAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCCAAT
CTTCCATATTAGTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTCTTA
CACACGCTGAGTACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTCTAA
ATTTTTATGCCTGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTACAT
ATAAAAACACACAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATTGAA
ATGGTTTTAATGTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTATCTT
TGACACAGAATTGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAGCCT
TAAGTATAGCCTAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTACTGG
TAAAATTTCAGGGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGTGCC
AGTGCTAATGCTTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTTGTG
GTTGTTAGGTTCACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTTAAC
AATTCCCAGTACTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCATGT
TCTTTTACCCCAGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATCAAA
ATTAATTCATCCAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATGACC
TATAAATTTATTCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAGAAC
CATTTTTGAGATGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTTTGG
GCTTTGCTTTAGGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCATTTT
TATCTTGGAAGAACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCTCCC
CCACTTTCCCATGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTGGGG
CAGGTGTGTATTTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCAGTT
GGTATTTCTACAAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACATAGA
TGTGAAAATTTTAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGAAAT
CAGAGTTTGAAATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACATCA
AGCTTTAACAAATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAATAGT
TGCAATGGATTAAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTATTTC
TTTGGGTGTAAAGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAGCTT
TGGCTGCTGAAATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTGTAG
AAAAGATGTCACTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGACAA
TATACTATCTGTGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAATGTG
TTGTGCTCTTTATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATAATG
GTGGTTCTTTTGCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGGGAG
ATCTCTCATCTCAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCATTTC
CTGTTTCCCAACAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAGCTT
CCTTATTACCTGGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGATCG
ATATTTATGTGCCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAGGCT
ATAGAGACTTATTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTATTT
CACCAGACTCAGTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTCAAG
TCTATAATCTGAGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGGGTG

>In-frame_ATP9B_ENST00000307671_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_7023nt
GGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACT
ACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAA
TGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGT
GGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAA
AGAAAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGG
AGGAAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGA
TTCTTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTG
AGCGAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATG
AAGAAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGG
ATTGCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTAC
AGGTGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGA
ATTGGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTC
AGGAGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAA
GGAATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATA
TTCTAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAA
ATAACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATC
CAATTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTG
GATGTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTC
AGTGCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTT
TCCAAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTG
ATGAAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAA
AAGGGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTC
GGGGAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTA
ATCCAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTC
TCTTTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATT
TTCTTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACT
ATTACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTAT
TTATCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTT
ATGACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAG
ATAAGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATG
AGCTTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAA
AGGATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAG
AAGAAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAA
CTGGGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAAC
AGCTGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATA
TAATTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTG
ATGTTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAA
GGCTCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAA
ATTTGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTAC
AGCGTGCACCACCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATTGTT
AAAATCATAGAAAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCCAAT
CTTCCATATTAGTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTCTTA
CACACGCTGAGTACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTCTAA
ATTTTTATGCCTGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTACAT
ATAAAAACACACAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATTGAA
ATGGTTTTAATGTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTATCTT
TGACACAGAATTGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAGCCT
TAAGTATAGCCTAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTACTGG
TAAAATTTCAGGGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGTGCC
AGTGCTAATGCTTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTTGTG
GTTGTTAGGTTCACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTTAAC
AATTCCCAGTACTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCATGT
TCTTTTACCCCAGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATCAAA
ATTAATTCATCCAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATGACC
TATAAATTTATTCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAGAAC
CATTTTTGAGATGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTTTGG
GCTTTGCTTTAGGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCATTTT
TATCTTGGAAGAACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCTCCC
CCACTTTCCCATGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTGGGG
CAGGTGTGTATTTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCAGTT
GGTATTTCTACAAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACATAGA
TGTGAAAATTTTAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGAAAT
CAGAGTTTGAAATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACATCA
AGCTTTAACAAATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAATAGT
TGCAATGGATTAAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTATTTC
TTTGGGTGTAAAGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAGCTT
TGGCTGCTGAAATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTGTAG
AAAAGATGTCACTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGACAA
TATACTATCTGTGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAATGTG
TTGTGCTCTTTATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATAATG
GTGGTTCTTTTGCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGGGAG
ATCTCTCATCTCAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCATTTC
CTGTTTCCCAACAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAGCTT
CCTTATTACCTGGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGATCG
ATATTTATGTGCCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAGGCT
ATAGAGACTTATTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTATTT
CACCAGACTCAGTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTCAAG
TCTATAATCTGAGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGGGTG

>In-frame_ATP9B_ENST00000586722_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_7034nt
AACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCG
GGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAA
GAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGT
GATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGA
CGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAG
GAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGAT
GATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAA
TTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAA
GAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGT
GAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGT
TTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAAT
GAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGC
TACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAG
AGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAAT
GAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATT
GAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAAT
GGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAG
AGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTC
TATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTT
CAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGT
ATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAG
GGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGT
GAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGC
CCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATT
CTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTA
GCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTA
GATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCT
ACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAG
AGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTAT
GATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAA
CTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATA
CTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTG
ACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAAT
TTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGAC
CTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCT
GTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGA
AGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAG
CAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATG
AATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCA
CCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATTGTTAAAATCATAGA
AAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCCAATCTTCCATATTA
GTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTCTTACACACGCTGAG
TACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTCTAAATTTTTATGCC
TGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTACATATAAAAACACA
CAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATTGAAATGGTTTTAAT
GTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTATCTTTGACACAGAAT
TGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAGCCTTAAGTATAGCC
TAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTACTGGTAAAATTTCAG
GGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGTGCCAGTGCTAATGC
TTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTTGTGGTTGTTAGGTT
CACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTTAACAATTCCCAGTA
CTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCATGTTCTTTTACCCC
AGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATCAAAATTAATTCATC
CAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATGACCTATAAATTTAT
TCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAGAACCATTTTTGAGA
TGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTTTGGGCTTTGCTTTA
GGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCATTTTTATCTTGGAAG
AACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCTCCCCCACTTTCCCA
TGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTGGGGCAGGTGTGTAT
TTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCAGTTGGTATTTCTAC
AAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACATAGATGTGAAAATTT
TAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGAAATCAGAGTTTGAA
ATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACATCAAGCTTTAACAA
ATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAATAGTTGCAATGGATT
AAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTATTTCTTTGGGTGTAA
AGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAGCTTTGGCTGCTGAA
ATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTGTAGAAAAGATGTCA
CTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGACAATATACTATCTG
TGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAATGTGTTGTGCTCTTT
ATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATAATGGTGGTTCTTTT
GCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGGGAGATCTCTCATCT
CAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCATTTCCTGTTTCCCAA
CAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAGCTTCCTTATTACCT
GGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGATCGATATTTATGTG
CCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAGGCTATAGAGACTTA
TTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTATTTCACCAGACTCA
GTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTCAAGTCTATAATCTG
AGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGGGTGAATAAAGTTTT

>In-frame_ATP9B_ENST00000586722_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_7012nt
AACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCG
GGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAA
GAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGT
GATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGAAAAGGCGA
CGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGGAAGAGGAG
GAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTCTTAAAGAT
GATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGCGAGAAAAA
TTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAGAAACCAAA
GAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATTGCTGCTGT
GAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGGTGGTAAGT
TTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATTGGATGAAT
GAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGGAGAGAAGC
TACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGAATGTGAAG
AGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTCTAAAAAAT
GAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATAACCTAATT
GAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAATTCAAAAT
GGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGATGTGTTCAG
AGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGTGCAAGCTC
TATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCCAAGATTTT
CAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATGAAGACAGT
ATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAGGGAAAAAG
GGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGGGAGGTGGT
GAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATCCAAGCAGC
CCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCTTTGAAATT
CTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTCTTGAATTA
GCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATTACCGTTTA
GATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTATCATTTCT
ACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATGACATCCAG
AGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATAAGATTTAT
GATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGCTTACTGAA
CTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGGATACCATA
CTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAGAAGAGTTG
ACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTGGGACCAAT
TTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGCTGGAGGAC
CTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAATTTCAGCT
GTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATGTTAAACGA
AGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGCTCCAGCAG
CAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATTTGATCATG
AATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGCGTGCACCA
CCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATTGTTAAAATCATAGA
AAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCCAATCTTCCATATTA
GTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTCTTACACACGCTGAG
TACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTCTAAATTTTTATGCC
TGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTACATATAAAAACACA
CAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATTGAAATGGTTTTAAT
GTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTATCTTTGACACAGAAT
TGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAGCCTTAAGTATAGCC
TAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTACTGGTAAAATTTCAG
GGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGTGCCAGTGCTAATGC
TTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTTGTGGTTGTTAGGTT
CACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTTAACAATTCCCAGTA
CTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCATGTTCTTTTACCCC
AGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATCAAAATTAATTCATC
CAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATGACCTATAAATTTAT
TCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAGAACCATTTTTGAGA
TGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTTTGGGCTTTGCTTTA
GGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCATTTTTATCTTGGAAG
AACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCTCCCCCACTTTCCCA
TGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTGGGGCAGGTGTGTAT
TTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCAGTTGGTATTTCTAC
AAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACATAGATGTGAAAATTT
TAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGAAATCAGAGTTTGAA
ATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACATCAAGCTTTAACAA
ATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAATAGTTGCAATGGATT
AAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTATTTCTTTGGGTGTAA
AGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAGCTTTGGCTGCTGAA
ATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTGTAGAAAAGATGTCA
CTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGACAATATACTATCTG
TGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAATGTGTTGTGCTCTTT
ATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATAATGGTGGTTCTTTT
GCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGGGAGATCTCTCATCT
CAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCATTTCCTGTTTCCCAA
CAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAGCTTCCTTATTACCT
GGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGATCGATATTTATGTG
CCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAGGCTATAGAGACTTA
TTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTATTTCACCAGACTCA
GTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTCAAGTCTATAATCTG

>In-frame_ATP9B_ENST00000458297_chr18_76856649_+_ATRX_ENST00000373344_chrX_76909690_-_6952nt
GCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGA
TGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGT
TTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGA
AAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGG
AAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTC
TTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGC
GAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAG
AAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATT
GCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGG
TGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATT
GGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGG
AGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGA
ATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTC
TAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATA
ACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAA
TTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGAT
GTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGT
GCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCC
AAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATG
AAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAG
GGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGG
GAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATC
CAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCT
TTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTC
TTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATT
ACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTA
TCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATG
ACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATA
AGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGC
TTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGG
ATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAG
AAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTG
GGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGC
TGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAA
TTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATG
TTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGC
TCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATT
TGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGC
GTGCACCACCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATTGTTAAA
ATCATAGAAAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCCAATCTT
CCATATTAGTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTCTTACAC
ACGCTGAGTACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTCTAAATT
TTTATGCCTGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTACATATA
AAAACACACAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATTGAAATG
GTTTTAATGTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTATCTTTGA
CACAGAATTGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAGCCTTAA
GTATAGCCTAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTACTGGTAA
AATTTCAGGGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGTGCCAGT
GCTAATGCTTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTTGTGGTT
GTTAGGTTCACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTTAACAAT
TCCCAGTACTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCATGTTCT
TTTACCCCAGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATCAAAATT
AATTCATCCAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATGACCTAT
AAATTTATTCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAGAACCAT
TTTTGAGATGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTTTGGGCT
TTGCTTTAGGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCATTTTTAT
CTTGGAAGAACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCTCCCCCA
CTTTCCCATGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTGGGGCAG
GTGTGTATTTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCAGTTGGT
ATTTCTACAAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACATAGATGT
GAAAATTTTAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGAAATCAG
AGTTTGAAATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACATCAAGC
TTTAACAAATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAATAGTTGC
AATGGATTAAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTATTTCTTT
GGGTGTAAAGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAGCTTTGG
CTGCTGAAATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTGTAGAAA
AGATGTCACTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGACAATAT
ACTATCTGTGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAATGTGTTG
TGCTCTTTATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATAATGGTG
GTTCTTTTGCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGGGAGATC
TCTCATCTCAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCATTTCCTG
TTTCCCAACAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAGCTTCCT
TATTACCTGGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGATCGATA
TTTATGTGCCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAGGCTATA
GAGACTTATTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTATTTCAC
CAGACTCAGTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTCAAGTCT
ATAATCTGAGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGGGTGAAT

>In-frame_ATP9B_ENST00000458297_chr18_76856649_+_ATRX_ENST00000395603_chrX_76909690_-_6930nt
GCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGA
TGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGT
TTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGGTCTGCAAAGAAAGCAGAGTTGGAAGAAAATCAGCGGAGCTATAAACAGAAAAAGA
AAAGGCGACGTATTAAGGTTCAAGAAGATTCATCCAGTGAAAACAAGAGTAATTCTGAGGAAGAAGAGGAGGAAAAAGAAGAGGAGGAGG
AAGAGGAGGAGGAGGAGGAAGAGGAGGAGGAAGATGAAAATGATGATTCCAAGTCTCCTGGAAAAGGCAGAAAGAAAATTCGGAAGATTC
TTAAAGATGATAAACTGAGAACAGAAACACAAAATGCTCTTAAGGAAGAGGAAGAGAGACGAAAACGTATTGCTGAGAGGGAGCGTGAGC
GAGAAAAATTGAGAGAGGTGATAGAAATTGAAGATGCTTCACCCACCAAGTGTCCAATAACAACCAAGTTGGTTTTAGATGAAGATGAAG
AAACCAAAGAACCTTTAGTGCAGGTTCATAGAAATATGGTTATCAAATTGAAACCCCATCAAGTAGATGGTGTTCAGTTTATGTGGGATT
GCTGCTGTGAGTCTGTGAAAAAAACAAAGAAATCTCCAGGTTCAGGATGCATTCTTGCCCACTGTATGGGCCTTGGTAAGACTTTACAGG
TGGTAAGTTTTCTTCATACAGTTCTTTTGTGTGACAAACTGGATTTCAGCACGGCGTTAGTGGTTTGTCCTCTTAATACTGCTTTGAATT
GGATGAATGAATTTGAGAAGTGGCAAGAGGGATTAAAAGATGATGAGAAGCTTGAGGTTTCTGAATTAGCAACTGTGAAACGTCCTCAGG
AGAGAAGCTACATGCTGCAGAGGTGGCAAGAAGATGGTGGTGTTATGATCATAGGCTATGAGATGTATAGAAATCTTGCTCAAGGAAGGA
ATGTGAAGAGTCGGAAACTTAAAGAAATATTTAACAAAGCTTTGGTTGATCCAGGCCCTGATTTTGTTGTTTGTGATGAAGGCCATATTC
TAAAAAATGAAGCATCTGCTGTTTCTAAAGCTATGAATTCTATACGATCAAGGAGGAGGATTATTTTAACAGGAACACCACTTCAAAATA
ACCTAATTGAGTATCATTGTATGGTTAATTTTATCAAGGAAAATTTACTTGGATCCATTAAGGAGTTCAGGAATAGATTTATAAATCCAA
TTCAAAATGGTCAGTGTGCAGATTCTACCATGGTAGATGTCAGAGTGATGAAAAAACGTGCTCACATTCTCTATGAGATGTTAGCTGGAT
GTGTTCAGAGGAAAGATTATACAGCATTAACAAAATTCTTGCCTCCAAAACACGAATATGTGTTAGCTGTGAGAATGACTTCTATTCAGT
GCAAGCTCTATCAGTACTACTTAGATCACTTAACAGGTGTGGGCAATAATAGTGAAGGTGGAAGAGGAAAGGCAGGTGCAAAGCTTTTCC
AAGATTTTCAGATGTTAAGTAGAATATGGACTCATCCTTGGTGTTTGCAGCTAGACTACATTAGCAAAGAAAATAAGGGTTATTTTGATG
AAGACAGTATGGATGAATTTATAGCCTCAGATTCTGATGAAACCTCCATGAGTTTAAGCTCCGATGATTATACAAAAAAGAAGAAAAAAG
GGAAAAAGGGGAAAAAAGATAGTAGCTCAAGTGGAAGTGGCAGTGACAATGATGTTGAAGTGATTAAGGTCTGGAATTCAAGATCTCGGG
GAGGTGGTGAAGGAAATGTGGATGAAACAGGAAACAATCCTTCTGTTTCTTTAAAACTGGAAGAAAGTAAAGCTACTTCTTCTTCTAATC
CAAGCAGCCCAGCTCCAGACTGGTACAAAGATTTTGTTACAGATGCTGATGCTGAGGTTTTAGAGCATTCTGGGAAAATGGTACTTCTCT
TTGAAATTCTTCGAATGGCAGAGGAAATTGGGGATAAAGTCCTTGTTTTCAGCCAGTCCCTCATATCTCTGGACTTGATTGAAGATTTTC
TTGAATTAGCTAGTAGGGAGAAGACAGAAGATAAAGATAAACCCCTTATTTATAAAGGTGAGGGGAAGTGGCTTCGAAACATTGACTATT
ACCGTTTAGATGGTTCCACTACTGCACAGTCAAGGAAGAAGTGGGCTGAAGAATTTAATGATGAAACTAATGTGAGAGGACGATTATTTA
TCATTTCTACTAAAGCAGGATCTCTAGGAATTAATCTGGTAGCTGCTAATCGAGTAATTATATTCGACGCTTCTTGGAATCCATCTTATG
ACATCCAGAGTATATTCAGAGTTTATCGCTTTGGACAAACTAAGCCTGTTTATGTATATAGGTTCTTAGCTCAGGGAACCATGGAAGATA
AGATTTATGATCGGCAAGTAACTAAGCAGTCACTGTCTTTTCGAGTTGTTGATCAGCAGCAGGTGGAGCGTCATTTTACTATGAATGAGC
TTACTGAACTTTATACTTTTGAGCCAGACTTATTAGATGACCCTAATTCAGAAAAGAAGAAGAAGAGGGATACTCCCATGCTGCCAAAGG
ATACCATACTTGCAGAGCTCCTTCAGATACATAAAGAACACATTGTAGGATACCATGAACATGATTCTCTTTTGGACCACAAAGAAGAAG
AAGAGTTGACTGAAGAAGAAAGAAAAGCAGCTTGGGCTGAGTATGAAGCAGAGAAGAAGGGACTGACCATGCGTTTCAACATACCAACTG
GGACCAATTTACCCCCTGTCAGTTTCAACTCTCAAACTCCTTATATTCCTTTCAATTTGGGAGCCCTGTCAGCAATGAGTAATCAACAGC
TGGAGGACCTCATTAATCAAGGAAGAGAAAAAGTTGTAGAAGCAACAAACAGTGTGACAGCAGTGAGGATTCAACCTCTTGAGGATATAA
TTTCAGCTGTATGGAAGGAGAACATGAATCTCTCAGAGGCCCAAGTACAGGCGTTAGCATTAAGTAGACAAGCCAGCCAGGAGCTTGATG
TTAAACGAAGAGAAGCAATCTACAATGATGTATTGACAAAACAACAGATGTTAATCAGCTGTGTTCAGCGAATACTTATGAACAGAAGGC
TCCAGCAGCAGTACAATCAGCAGCAACAGCAACAAATGACTTATCAACAAGCAACACTGGGTCACCTCATGATGCCAAAGCCCCCAAATT
TGATCATGAATCCTTCTAACTACCAGCAGATTGATATGAGAGGAATGTATCAGCCAGTGGCTGGTGGTATGCAGCCACCACCATTACAGC
GTGCACCACCCCCAATGAGAAGCAAAAATCCAGGACCTTCCCAAGGGAAATCAATGTGATTTTGCACTAAAAGCTTAATGGATTGTTAAA
ATCATAGAAAGATCTTTTATTTTTTTAGGAATCAATGACTTAACAGAACTCAACTGTATAAATAGTTTGGTCCCCTTAAATGCCAATCTT
CCATATTAGTTTTACTTTTTTTTTTTTTAAATAGGGCATACCATTTCTTCCTGACATTTGTCAGTGATGTTGCCTAGAATCTTCTTACAC
ACGCTGAGTACAGAAGATATTTCAAATTGTTTTCAGTGAAAACAAGTCCTTCCATAATAGTAACAACTCCACAGATTTCCTCTCTAAATT
TTTATGCCTGCTTTTAGCAACCATAAAATTGTCATAAAATTAATAAATTTAGGAAAGAATAAAGATTTATATATTCATTCTTTACATATA
AAAACACACAGCTGAGTTCTTAGAGTTGATTCCTCAAGTTATGAAATACTTTTGTACTTAATCCATTTCTTGATTAAAGTGATTGAAATG
GTTTTAATGTTCTTTTGACTGAAGTCTGAAACTGGGCTCCTGCTTTATTGTCTCTGTGACTGAAAGTTAGAAACTGAGGGTTATCTTTGA
CACAGAATTGTGTGCAATATTCTTAAATACTACTGCTCTAAAAGTTGGAGAAGTCTTGCAGTTATCTTAGCATTGTATAAACAGCCTTAA
GTATAGCCTAAGAAGAGAATTCCTTTTTCTTCTTTAGTCCTTCTGCCATTTTTTATTTTCAGTTATATGTGCTGAAATAATTACTGGTAA
AATTTCAGGGTTGTGGATTATCTTCCACACATGAATTTTCTCTCTCCTGGCACGAATATAAAGCACATCTCTTAACTGCATGGTGCCAGT
GCTAATGCTTCATCCTGTTGCTGGCAGTGGGATGTGGACTTAGAAAATCAAGTTCTAGCATTTTAGTAGGTTAACACTGAAGTTGTGGTT
GTTAGGTTCACACCCTGTTTTATAAACAACATCAAAATGGCAGAACCATTGCTGACTTTAGGTTCACATGAGGAATGTACTTTTAACAAT
TCCCAGTACTATCAGTATTGTGAAATAATTCCTCTGAAAGATAAGAATCACTGGCTTCTATGCGCTTCTTTTCTCTCATCATCATGTTCT
TTTACCCCAGTTTCCTTACATTTTTTTAAATTGTTTCAGAGTTTGTTTTTTTTTTAGTTTAGATTGTGAGGCAATTATTAAATCAAAATT
AATTCATCCAATACCCCTTTACTAGAAGTTTTACTAGAAAATGTATTACATTTTATTTTTTCTTAATCCAGTTCTGCAAAAATGACCTAT
AAATTTATTCATGTACAATTTTGGTTACTTGAATTGTTAAAGAAAACATTGTTTTTGACTATGGGAGTCAACTCAACATGGCAGAACCAT
TTTTGAGATGATGATACAACAGGTAGTGAAACAGCTTAAGAATTCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAAACTGGGTTTGGGCT
TTGCTTTAGGTATCACTGGATTAGAATGAGTTTAACATTAGCTAAAACTGCTTTGAGTTGTTTGGATGATTAAGAGATTGCCATTTTTAT
CTTGGAAGAACTAGTGGTAAAACATCCAAGAGCACTAGGATTGTGATACAGAATTTGTGAGGTTTGGTGGATCCACGCCCCTCTCCCCCA
CTTTCCCATGATGAAATATCACTAATAAATCCTGTATATTTAGATATTATGCTAGCCATGTAATCAGATTTATTTAATTGGGTGGGGCAG
GTGTGTATTTACTTTAGAAAAAATGAAAAAGACAAGATTTATGAGAAATATTTGAAGGCAGTACACTCTGGCCAACTGTTACCAGTTGGT
ATTTCTACAAGTTCAGAATATTTTAAACCTGATTTACTAGACCTGGGAATTTTCAACATGGTCTAATTATTTACTCAAAGACATAGATGT
GAAAATTTTAGGCAACCTTCTAAATCTTTTTCACCATGGATGAAACTATAACTTAAAGAATAATACTTAGAAGGGTTAATTGGAAATCAG
AGTTTGAAATAAAACTTGGACCACTTTGTATACACTCTTCTCACTTGACATTTTAGCTATATAATATGTACTTTGAGTATAACATCAAGC
TTTAACAAATATTTAAAGACAAAAAAATCACGTCAGTAAAATACTAAAAGGCTCATTTTTATATTTGTTTTAGATGTTTTAAATAGTTGC
AATGGATTAAAAATGATGATTTAAAATGTTGCTTGTAATACAGTTTTGCCTGCTAAATTCTCCACATTTTGTAACCTGTTTTATTTCTTT
GGGTGTAAAGCGTTTTTGCTTAGTATTGTGATATTGTATATGTTTTGTCCCAGTTGTATAGTAATGTTTCAGTCCATCATCCAGCTTTGG
CTGCTGAAATCATACAGCTGTGAAGACTTGCCTTTGTTTCTGTTAGACTGCTTTTCAGTTCTGTATTGAGTATCTTAAGTACTGTAGAAA
AGATGTCACTTCTTCCTTTAAGGCTGTTTTGTAATATATATAAGGACTGGAATTGTGTTTTTAAAGAAAAGCATTCAAGTATGACAATAT
ACTATCTGTGTTTTCACCATTCAAAGTGCTGTTTAGTAGTTGAAACTTAAACTATTTAATGTCATTTAATAAAGTGACCAAAATGTGTTG
TGCTCTTTATTGTATTTTCACAGCTTTGAAAATCTGTGCACATACTGTTTCATAGAAAATGTATAGCTTTTGTTGTCCTATATAATGGTG
GTTCTTTTGCACATTTAGTTATTTAATATTGAGAGGTCACGAAGTTTGGTTATTGAATCTGTTATATACTAAATTCTGTAAAGGGAGATC
TCTCATCTCAAAAAGAATTTACATACCAGGAAGTCCATGTGTGTTTGTGTTAGTTTTGGATGTCTTTGTGTAATCCAGCCCCATTTCCTG
TTTCCCAACAGCTGTAACACTCATTTTAAGTCAAGCAGGGCTACCAACCCACACTTGATAGAAAAGCTGCTTACCATTCAGAAGCTTCCT
TATTACCTGGCCTCCAAATGAGCTGAATATTTTGTAGCCTTCCCTTAGCTATGTTCATTTTCCCTCCATTATCATAAAATCAGATCGATA
TTTATGTGCCCCAAACAAAACTTTAAGAGCAGTTACATTCTGTCCCAGTAGCCCTTGTTTCCTTTGAGAGTAGCATGTTGTGAGGCTATA
GAGACTTATTCTACCAGTAAAACAGGTCAATCCTTTTACATGTTTATTATACTAAAAATTATGTTCAGGGTATTTACTACTTTATTTCAC
CAGACTCAGTCTCAAGTGACTTGGCTATCTCCAAATCAGATCTACCCTTAGAGAATAAACATTTTTCTACCGTTATTTTTTTTCAAGTCT
ATAATCTGAGCCAGTCCCAAAGGAGTGATCAAGTTTCAGAAATGCTTTCATCTTCACAACATTTTATATATACTATTATATGGGGTGAAT


Top

FusionGenePPI for ATP9B_ATRX


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP9BATRXEIF4A2, EZH2, CCSER2, KIAA1377, LUC7L2, PTN, PTPN4, RAD51, SMC1A, CBX5, H3F3A, H3F3B, DAXX, HDAC4, HIST1H3A, WRN, CALM1, SVIL, ZBED1, HIST2H3C, BLM, NEK1, ZNF512B, PRKDC, RAD50, XRCC5, MRE11A, XRCC6, SUPT16H, NBN, SSRP1, HIST1H4J, HIST2H2BE, RPA1, TP53, HIST1H1C, RAD9A, HIST1H2BL, HIST1H2AB, RAD1, PML, NSD1, SUMO2, TMPO, CNOT1, LRRK2, H2AFY, SNW1, ZNF274, TRIM28, SETDB1, BMI1, AURKA, HIST1H4A, WDR1, EAF1, DDX20, NAF1, EIF2AK1, AP3B1, POLD1, RBM14, MFAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12352010_228014042493MECP2
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11342010_228013662455MECP2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneATRXchr18:76856649chrX:76909690ENST00000373344-12351189_132614042493DAXX
TgeneATRXchr18:76856649chrX:76909690ENST00000395603-11341189_132613662455DAXX


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP9B_ATRX


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP9B_ATRX


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATP9BC0236736Cocaine-Related Disorders1CTD_human
TgeneATRXC1845055ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED11CTD_human;ORPHANET;UNIPROT
TgeneATRXC0796003Juberg-Marsidi syndrome5CTD_human;ORPHANET;UNIPROT
TgeneATRXC0017638Glioma2CTD_human
TgeneATRXC0027819Neuroblastoma2CTD_human
TgeneATRXC0010417Cryptorchidism1CTD_human;HPO
TgeneATRXC0010606Adenoid Cystic Carcinoma1CTD_human
TgeneATRXC0018273Growth Disorders1CTD_human
TgeneATRXC0030297Pancreatic Neoplasm1CTD_human
TgeneATRXC0030846Penile Diseases1CTD_human
TgeneATRXC0039978Thoracic Diseases1CTD_human
TgeneATRXC0206754Neuroendocrine Tumors1CTD_human
TgeneATRXC0376634Craniofacial Abnormalities1CTD_human
TgeneATRXC1136249Mental Retardation, X-Linked1CTD_human
TgeneATRXC3463824MYELODYSPLASTIC SYNDROME1CTD_human;HPO