FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35238

FusionGeneSummary for SNUPN_ZNF233

check button Fusion gene summary
Fusion gene informationFusion gene name: SNUPN_ZNF233
Fusion gene ID: 35238
HgeneTgene
Gene symbol

SNUPN

ZNF233

Gene ID

10073

353355

Gene namesnurportin 1zinc finger protein 233
SynonymsKPNBL|RNUT1|Snurportin1-
Cytomap

15q24.2

19q13.31

Type of geneprotein-codingprotein-coding
Descriptionsnurportin-1RNA U transporter 1zinc finger protein 233
Modification date2018051920180523
UniProtAcc

O95149

A6NK53

Ensembl transtripts involved in fusion geneENST00000567134, ENST00000308588, 
ENST00000564644, ENST00000371091, 
ENST00000564675, 
ENST00000334152, 
ENST00000592581, ENST00000391958, 
ENST00000589522, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 2 X 2=12
# samples 23
** MAII scorelog2(2/8*10)=1.32192809488736log2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SNUPN [Title/Abstract] AND ZNF233 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-18-3414-01ASNUPNchr15

75909749

-ZNF233chr19

44768467

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000567134ENST00000334152SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000567134ENST00000592581SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000567134ENST00000391958SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000567134ENST00000589522SNUPNchr15

75909749

-ZNF233chr19

44768467

+
Frame-shiftENST00000308588ENST00000334152SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000308588ENST00000592581SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000308588ENST00000391958SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000308588ENST00000589522SNUPNchr15

75909749

-ZNF233chr19

44768467

+
In-frameENST00000564644ENST00000334152SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000564644ENST00000592581SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000564644ENST00000391958SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000564644ENST00000589522SNUPNchr15

75909749

-ZNF233chr19

44768467

+
Frame-shiftENST00000371091ENST00000334152SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000371091ENST00000592581SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000371091ENST00000391958SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000371091ENST00000589522SNUPNchr15

75909749

-ZNF233chr19

44768467

+
Frame-shiftENST00000564675ENST00000334152SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000564675ENST00000592581SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000564675ENST00000391958SNUPNchr15

75909749

-ZNF233chr19

44768467

+
5CDS-5UTRENST00000564675ENST00000589522SNUPNchr15

75909749

-ZNF233chr19

44768467

+

Top

FusionProtFeatures for SNUPN_ZNF233


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SNUPN

O95149

ZNF233

A6NK53

Functions as an U snRNP-specific nuclear import adapter.Involved in the trimethylguanosine (m3G)-cap-dependent nuclearimport of U snRNPs. Binds specifically to the terminal m3G-cap UsnRNAs. {ECO:0000269|PubMed:10209022, ECO:0000269|PubMed:15920472,ECO:0000269|PubMed:16030253, ECO:0000269|PubMed:9670026}. May be involved in transcriptional regulation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNUPNchr15:75909749chr19:44768467ENST00000308588-3911_73101361DomainIBB
HgeneSNUPNchr15:75909749chr19:44768467ENST00000564644-41011_73101361DomainIBB
HgeneSNUPNchr15:75909749chr19:44768467ENST00000564675-3911_73101361DomainIBB
HgeneSNUPNchr15:75909749chr19:44768467ENST00000567134-41011_73101361DomainIBB
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+058_79-16671DomainKRAB
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05258_280-16671Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05311_336-16671Zinc fingerC2H2-type 2%3B degenerate
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05342_364-16671Zinc fingerC2H2-type 3%3B degenerate
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05370_392-16671Zinc fingerC2H2-type 4%3B degenerate
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05398_420-16671Zinc fingerC2H2-type 5%3B degenerate
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05452_474-16671Zinc fingerC2H2-type 6
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05480_502-16671Zinc fingerC2H2-type 7
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05508_530-16671Zinc fingerC2H2-type 8
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05536_558-16671Zinc fingerC2H2-type 9
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05564_586-16671Zinc fingerC2H2-type 10
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05592_614-16671Zinc fingerC2H2-type 11
TgeneZNF233chr15:75909749chr19:44768467ENST00000391958+05620_642-16671Zinc fingerC2H2-type 12

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNUPNchr15:75909749chr19:44768467ENST00000308588-39208_328101361RegionNecessary for binding to the m3G-cap structure
HgeneSNUPNchr15:75909749chr19:44768467ENST00000564644-410208_328101361RegionNecessary for binding to the m3G-cap structure
HgeneSNUPNchr15:75909749chr19:44768467ENST00000564675-39208_328101361RegionNecessary for binding to the m3G-cap structure
HgeneSNUPNchr15:75909749chr19:44768467ENST00000567134-410208_328101361RegionNecessary for binding to the m3G-cap structure


Top

FusionGeneSequence for SNUPN_ZNF233


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SNUPN_ENST00000567134_chr15_75909749_-_ZNF233_ENST00000334152_chr19_44768467_+_666aa
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENKKDDEEMDIDT
VKKLPKHYANQFCLPRTLPFPRRSRRKXPSFSYWPXDXDYICLMLXEMVTFKDVAVVFTREELGLLDLAQRKLYQDVMLENFRNLLSVGY
QPFKLDVILQLGKEDKLRMMETEIQGDGCSGKELLINMMIMEYTKERKLLATIIVEKTVXRNHPSIAXSNQESKPLMKMEKAXVLALILN
FTSNYTXETSLMXMLSTGRAXVTAQGFPGISVSTXERNAIGMVTVVRASVRAHICNLIRESAQERTSTDVRYMPGAPTRTPVFPLMSLLT
QERSCVHVAGVGRASIIAXILTFTVXTVLEREPVNVMYMIKASVRHHNFKPIREVTLETRHTNGKXVTGYLIGILVFTREFTLERNHINV
RYVIRASVRPQIFKPIRESTLERNPTNVMCVIRTSAVIPTFRPIRESIQERNPTNVTHVGRTSVRSLIFRPIREFTKERSHTNVRHVGRA
LVRVRISKTISKSILERIPTNVMCVGKASVGVHIFKPIRESTQERNHTNVKNVGKASSGTHIFMFIRGSTRERNPINVACVVRASVRLHI

>In-frame_SNUPN_ENST00000564644_chr15_75909749_-_ZNF233_ENST00000334152_chr19_44768467_+_666aa
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENKKDDEEMDIDT
VKKLPKHYANQFCLPRTLPFPRRSRRKXPSFSYWPXDXDYICLMLXEMVTFKDVAVVFTREELGLLDLAQRKLYQDVMLENFRNLLSVGY
QPFKLDVILQLGKEDKLRMMETEIQGDGCSGKELLINMMIMEYTKERKLLATIIVEKTVXRNHPSIAXSNQESKPLMKMEKAXVLALILN
FTSNYTXETSLMXMLSTGRAXVTAQGFPGISVSTXERNAIGMVTVVRASVRAHICNLIRESAQERTSTDVRYMPGAPTRTPVFPLMSLLT
QERSCVHVAGVGRASIIAXILTFTVXTVLEREPVNVMYMIKASVRHHNFKPIREVTLETRHTNGKXVTGYLIGILVFTREFTLERNHINV
RYVIRASVRPQIFKPIRESTLERNPTNVMCVIRTSAVIPTFRPIRESIQERNPTNVTHVGRTSVRSLIFRPIREFTKERSHTNVRHVGRA
LVRVRISKTISKSILERIPTNVMCVGKASVGVHIFKPIRESTQERNHTNVKNVGKASSGTHIFMFIRGSTRERNPINVACVVRASVRLHI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SNUPN_ENST00000567134_chr15_75909749_-_ZNF233_ENST00000334152_chr19_44768467_+_2000nt
ATGGAAGAGTTGAGTCAGGCCCTGGCTAGTAGCTTTTCTGTGTCTCAAGATCTGAACAGCACAGCTGCCCCACACCCCCGCCTATCCCAG
TACAAGTCCAAGTACAGTTCCTTGGAGCAGAGTGAGCGCCGCCGGAGGTTACTGGAACTGCAGAAATCCAAGCGGCTGGATTATGTGAAC
CATGCCAGAAGACTGGCTGAAGATGACTGGACAGGGATGGAGAGTGAGGAAGAAAATAAGAAAGATGATGAAGAAATGGACATTGACACT
GTCAAGAAGTTACCAAAACACTATGCTAATCAATTCTGCCTTCCCAGGACCCTGCCCTTCCCCAGAAGGAGCAGGAGAAAATGACCAAGT
TTCAGTTATTGGCCATAAGATTGAGATTACATCTGCTTGATGTTGTAGGAGATGGTGACATTCAAGGATGTGGCTGTGGTCTTCACCAGG
GAGGAGCTGGGGTTGCTGGACCTTGCCCAGAGAAAGCTGTACCAAGATGTGATGCTGGAGAACTTCAGGAACCTGCTGTCAGTGGGCTAT
CAACCCTTCAAACTAGATGTGATATTACAGTTGGGAAAAGAAGACAAGCTTCGGATGATGGAGACAGAAATCCAAGGAGATGGGTGTTCA
GGCAAAGAATTGCTCATCAACATGATGATCATGGAGTACACAAAAGAGAGAAAGCTTTTAGCCACAATAATTGTGGAAAAGACTGTGTGA
AGGAATCATCCCAGCATAGCATAATCCAATCAGGAGAGCAAACCTCTGATGAAAATGGAAAAGGCTTAAGTGTTGGCTCTAATCTTGAAC
TTCACCAGCAACTACACTTAAGAGACAAGCCTCATGTAAATGTTGAGTACGGGAAGGGCATAGGTTACAGCTCAGGGCTTCCCAGGCATC
AGTGTTTCCACATAGGAGAGAAATGCTATAGGAATGGTGACAGTGGTGAGGGCTTCAGTCAGGGCTCACATCTGCAACCTCATCAGAGAG
TCAGCACAGGAGAGAACCTCTACAGATGTCAGGTATATGCCCGGAGCTCCAACCAGAACTCCTGTCTTCCCTCTCATGAGCTTACTCACC
CAGGAGAGAAGTTGTGTACATGTGGCAGGTGTGGGAAGGGCTTCCATCATAGCTTAGATTTTGACATTCACTGTGTAGACAGTGCTGGAG
AGAGAGCCTGTAAATGTGATGTATATGATAAAGGCTTCAGTCAGACATCACAACTTCAAGCCCATCAGAGAGGTCACTCTAGAGACAAGA
CATACAAATGGGAAGTAAGTGACAGGATATTTAATAGGAATTCTGGTCTTCACCAGAGAGTTCACACTGGAGAGAAACCATATAAATGTG
AGGTATGTGATAAGGGCTTCAGTAAGGCCTCAAATCTTCAAGCCCATCAGAGAATCCACACTGGAGAGAAACCCTACAAATGTGATGTGT
GTGATAAGAACTTCAGCCGTAATTCCCACCTTCAGGCCCATCAGAGAGTCCATACAGGAGAGAAACCCTACAAATGTGACACATGTGGGA
AGGACTTCAGTCAGATCTCTCATCTTCAGGCCCATCAGAGAGTTCACAAAGGAGAGAAGCCATACAAATGTGAGACATGTGGGAAGGGCT
TTAGTCAGAGTTCGCATCTCCAAGACCATCAGCAAGTCCATACTGGAGAGAATCCCTACAAATGTGATGTGTGTGGGAAAGGCTTCAGTT
GGAGTTCACATCTTCAAGCCCATCAGAGAGTCCACACAGGAGAGAAACCATACAAATGTGAAGAATGTAGGAAAGGCTTCATCTGGAACT
CATATCTTCATGTTCATCAGAGGATCCACACGGGAGAGAAACCCTATAAATGTGGCATGTGTGGTAAGAGCTTCAGTCAGACTTCACATC
TTCAAGCCCATCAGAGAGTCCATACTGGAGAGAAACCATACAAATGTTTTGTGTGTGGTAAGGGCTTTAGTAAGAGTTCGTTGTCTTCAG

>In-frame_SNUPN_ENST00000564644_chr15_75909749_-_ZNF233_ENST00000334152_chr19_44768467_+_2000nt
ATGGAAGAGTTGAGTCAGGCCCTGGCTAGTAGCTTTTCTGTGTCTCAAGATCTGAACAGCACAGCTGCCCCACACCCCCGCCTATCCCAG
TACAAGTCCAAGTACAGTTCCTTGGAGCAGAGTGAGCGCCGCCGGAGGTTACTGGAACTGCAGAAATCCAAGCGGCTGGATTATGTGAAC
CATGCCAGAAGACTGGCTGAAGATGACTGGACAGGGATGGAGAGTGAGGAAGAAAATAAGAAAGATGATGAAGAAATGGACATTGACACT
GTCAAGAAGTTACCAAAACACTATGCTAATCAATTCTGCCTTCCCAGGACCCTGCCCTTCCCCAGAAGGAGCAGGAGAAAATGACCAAGT
TTCAGTTATTGGCCATAAGATTGAGATTACATCTGCTTGATGTTGTAGGAGATGGTGACATTCAAGGATGTGGCTGTGGTCTTCACCAGG
GAGGAGCTGGGGTTGCTGGACCTTGCCCAGAGAAAGCTGTACCAAGATGTGATGCTGGAGAACTTCAGGAACCTGCTGTCAGTGGGCTAT
CAACCCTTCAAACTAGATGTGATATTACAGTTGGGAAAAGAAGACAAGCTTCGGATGATGGAGACAGAAATCCAAGGAGATGGGTGTTCA
GGCAAAGAATTGCTCATCAACATGATGATCATGGAGTACACAAAAGAGAGAAAGCTTTTAGCCACAATAATTGTGGAAAAGACTGTGTGA
AGGAATCATCCCAGCATAGCATAATCCAATCAGGAGAGCAAACCTCTGATGAAAATGGAAAAGGCTTAAGTGTTGGCTCTAATCTTGAAC
TTCACCAGCAACTACACTTAAGAGACAAGCCTCATGTAAATGTTGAGTACGGGAAGGGCATAGGTTACAGCTCAGGGCTTCCCAGGCATC
AGTGTTTCCACATAGGAGAGAAATGCTATAGGAATGGTGACAGTGGTGAGGGCTTCAGTCAGGGCTCACATCTGCAACCTCATCAGAGAG
TCAGCACAGGAGAGAACCTCTACAGATGTCAGGTATATGCCCGGAGCTCCAACCAGAACTCCTGTCTTCCCTCTCATGAGCTTACTCACC
CAGGAGAGAAGTTGTGTACATGTGGCAGGTGTGGGAAGGGCTTCCATCATAGCTTAGATTTTGACATTCACTGTGTAGACAGTGCTGGAG
AGAGAGCCTGTAAATGTGATGTATATGATAAAGGCTTCAGTCAGACATCACAACTTCAAGCCCATCAGAGAGGTCACTCTAGAGACAAGA
CATACAAATGGGAAGTAAGTGACAGGATATTTAATAGGAATTCTGGTCTTCACCAGAGAGTTCACACTGGAGAGAAACCATATAAATGTG
AGGTATGTGATAAGGGCTTCAGTAAGGCCTCAAATCTTCAAGCCCATCAGAGAATCCACACTGGAGAGAAACCCTACAAATGTGATGTGT
GTGATAAGAACTTCAGCCGTAATTCCCACCTTCAGGCCCATCAGAGAGTCCATACAGGAGAGAAACCCTACAAATGTGACACATGTGGGA
AGGACTTCAGTCAGATCTCTCATCTTCAGGCCCATCAGAGAGTTCACAAAGGAGAGAAGCCATACAAATGTGAGACATGTGGGAAGGGCT
TTAGTCAGAGTTCGCATCTCCAAGACCATCAGCAAGTCCATACTGGAGAGAATCCCTACAAATGTGATGTGTGTGGGAAAGGCTTCAGTT
GGAGTTCACATCTTCAAGCCCATCAGAGAGTCCACACAGGAGAGAAACCATACAAATGTGAAGAATGTAGGAAAGGCTTCATCTGGAACT
CATATCTTCATGTTCATCAGAGGATCCACACGGGAGAGAAACCCTATAAATGTGGCATGTGTGGTAAGAGCTTCAGTCAGACTTCACATC
TTCAAGCCCATCAGAGAGTCCATACTGGAGAGAAACCATACAAATGTTTTGTGTGTGGTAAGGGCTTTAGTAAGAGTTCGTTGTCTTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SNUPN_ENST00000567134_chr15_75909749_-_ZNF233_ENST00000334152_chr19_44768467_+_2283nt
GGCGCGAGGCCTGTGGGCCCAGCGGTGAGGCAGCAGCTGGGGGCGGGGGGAGGGCGGACCTAGCTTCCCAGGGCAGGTGATTCGTCGGCC
CCGGTGGCGGCGGCGCGTGCGACGGTCACCTCGGTTTGGGGTCCACCTAAAGTGGGAAGTCTGTTTTCAAAATGACATCTACTCCATGCC
TGTCTTGTTTCCCTAATGTACTTTATGGAAGTTCTTCACACTACTGGAGCATTGACGTTACTTGTTAAGCAGCCTTCCACATCCTAGCTC
TTTTCCAAGGAAGATGGAAGAGTTGAGTCAGGCCCTGGCTAGTAGCTTTTCTGTGTCTCAAGATCTGAACAGCACAGCTGCCCCACACCC
CCGCCTATCCCAGTACAAGTCCAAGTACAGTTCCTTGGAGCAGAGTGAGCGCCGCCGGAGGTTACTGGAACTGCAGAAATCCAAGCGGCT
GGATTATGTGAACCATGCCAGAAGACTGGCTGAAGATGACTGGACAGGGATGGAGAGTGAGGAAGAAAATAAGAAAGATGATGAAGAAAT
GGACATTGACACTGTCAAGAAGTTACCAAAACACTATGCTAATCAATTCTGCCTTCCCAGGACCCTGCCCTTCCCCAGAAGGAGCAGGAG
AAAATGACCAAGTTTCAGTTATTGGCCATAAGATTGAGATTACATCTGCTTGATGTTGTAGGAGATGGTGACATTCAAGGATGTGGCTGT
GGTCTTCACCAGGGAGGAGCTGGGGTTGCTGGACCTTGCCCAGAGAAAGCTGTACCAAGATGTGATGCTGGAGAACTTCAGGAACCTGCT
GTCAGTGGGCTATCAACCCTTCAAACTAGATGTGATATTACAGTTGGGAAAAGAAGACAAGCTTCGGATGATGGAGACAGAAATCCAAGG
AGATGGGTGTTCAGGCAAAGAATTGCTCATCAACATGATGATCATGGAGTACACAAAAGAGAGAAAGCTTTTAGCCACAATAATTGTGGA
AAAGACTGTGTGAAGGAATCATCCCAGCATAGCATAATCCAATCAGGAGAGCAAACCTCTGATGAAAATGGAAAAGGCTTAAGTGTTGGC
TCTAATCTTGAACTTCACCAGCAACTACACTTAAGAGACAAGCCTCATGTAAATGTTGAGTACGGGAAGGGCATAGGTTACAGCTCAGGG
CTTCCCAGGCATCAGTGTTTCCACATAGGAGAGAAATGCTATAGGAATGGTGACAGTGGTGAGGGCTTCAGTCAGGGCTCACATCTGCAA
CCTCATCAGAGAGTCAGCACAGGAGAGAACCTCTACAGATGTCAGGTATATGCCCGGAGCTCCAACCAGAACTCCTGTCTTCCCTCTCAT
GAGCTTACTCACCCAGGAGAGAAGTTGTGTACATGTGGCAGGTGTGGGAAGGGCTTCCATCATAGCTTAGATTTTGACATTCACTGTGTA
GACAGTGCTGGAGAGAGAGCCTGTAAATGTGATGTATATGATAAAGGCTTCAGTCAGACATCACAACTTCAAGCCCATCAGAGAGGTCAC
TCTAGAGACAAGACATACAAATGGGAAGTAAGTGACAGGATATTTAATAGGAATTCTGGTCTTCACCAGAGAGTTCACACTGGAGAGAAA
CCATATAAATGTGAGGTATGTGATAAGGGCTTCAGTAAGGCCTCAAATCTTCAAGCCCATCAGAGAATCCACACTGGAGAGAAACCCTAC
AAATGTGATGTGTGTGATAAGAACTTCAGCCGTAATTCCCACCTTCAGGCCCATCAGAGAGTCCATACAGGAGAGAAACCCTACAAATGT
GACACATGTGGGAAGGACTTCAGTCAGATCTCTCATCTTCAGGCCCATCAGAGAGTTCACAAAGGAGAGAAGCCATACAAATGTGAGACA
TGTGGGAAGGGCTTTAGTCAGAGTTCGCATCTCCAAGACCATCAGCAAGTCCATACTGGAGAGAATCCCTACAAATGTGATGTGTGTGGG
AAAGGCTTCAGTTGGAGTTCACATCTTCAAGCCCATCAGAGAGTCCACACAGGAGAGAAACCATACAAATGTGAAGAATGTAGGAAAGGC
TTCATCTGGAACTCATATCTTCATGTTCATCAGAGGATCCACACGGGAGAGAAACCCTATAAATGTGGCATGTGTGGTAAGAGCTTCAGT
CAGACTTCACATCTTCAAGCCCATCAGAGAGTCCATACTGGAGAGAAACCATACAAATGTTTTGTGTGTGGTAAGGGCTTTAGTAAGAGT

>In-frame_SNUPN_ENST00000564644_chr15_75909749_-_ZNF233_ENST00000334152_chr19_44768467_+_2579nt
GTGCGACGGTCACCTCGGTTTGGGTGAGTCCCTGGGTTCGAGCCCGGGCCCCGCCAGCTGCCGAGTTGCCTCTCGGTGCCGGACTGTGAC
TCCCTCTGGCCGGCCCTGCACTCTGGCCTCCTGGGACGTCATCTGGAGGGATAGAGCCAGGCCTGGGACTCCTTTTGGGAGAGTTTCCGT
TCTTCTATTCCGTGCTGTCCGGCCAGGACCCCTCAGGGACTTCTGTGGGGCAGGGGCGAATCATGCATGGCCTAGATGACCCCATGCCTA
GAAAAAGGCAGTGCGGGGCGGTGGCGGCGCGCACGGCCGAGTGAAGCAGATAGCGTCCCCGGGGCTGGAGCCCGGTAGCAGGGCCGGGCG
TTGTGGCGCGTGCCTGTAATCCCAGCTACTCGGGAGGCTGAGGCAGGAGAATCGCTTGAATCCGGGAGATGGAGGTTGCAGTGAGCCGAG
ATCATGCCACTGCACTCCAGCCTGGGCAACAAGAGCGAAACTCTGTCTCAAAAAAAAAACAACAACAACAAAGAAAAAACAAAACGAAAC
AGCAGGAACCCGCCAAGAACAGCCTTGAAGGAAGGGAAGATGGAAGAGTTGAGTCAGGCCCTGGCTAGTAGCTTTTCTGTGTCTCAAGAT
CTGAACAGCACAGCTGCCCCACACCCCCGCCTATCCCAGTACAAGTCCAAGTACAGTTCCTTGGAGCAGAGTGAGCGCCGCCGGAGGTTA
CTGGAACTGCAGAAATCCAAGCGGCTGGATTATGTGAACCATGCCAGAAGACTGGCTGAAGATGACTGGACAGGGATGGAGAGTGAGGAA
GAAAATAAGAAAGATGATGAAGAAATGGACATTGACACTGTCAAGAAGTTACCAAAACACTATGCTAATCAATTCTGCCTTCCCAGGACC
CTGCCCTTCCCCAGAAGGAGCAGGAGAAAATGACCAAGTTTCAGTTATTGGCCATAAGATTGAGATTACATCTGCTTGATGTTGTAGGAG
ATGGTGACATTCAAGGATGTGGCTGTGGTCTTCACCAGGGAGGAGCTGGGGTTGCTGGACCTTGCCCAGAGAAAGCTGTACCAAGATGTG
ATGCTGGAGAACTTCAGGAACCTGCTGTCAGTGGGCTATCAACCCTTCAAACTAGATGTGATATTACAGTTGGGAAAAGAAGACAAGCTT
CGGATGATGGAGACAGAAATCCAAGGAGATGGGTGTTCAGGCAAAGAATTGCTCATCAACATGATGATCATGGAGTACACAAAAGAGAGA
AAGCTTTTAGCCACAATAATTGTGGAAAAGACTGTGTGAAGGAATCATCCCAGCATAGCATAATCCAATCAGGAGAGCAAACCTCTGATG
AAAATGGAAAAGGCTTAAGTGTTGGCTCTAATCTTGAACTTCACCAGCAACTACACTTAAGAGACAAGCCTCATGTAAATGTTGAGTACG
GGAAGGGCATAGGTTACAGCTCAGGGCTTCCCAGGCATCAGTGTTTCCACATAGGAGAGAAATGCTATAGGAATGGTGACAGTGGTGAGG
GCTTCAGTCAGGGCTCACATCTGCAACCTCATCAGAGAGTCAGCACAGGAGAGAACCTCTACAGATGTCAGGTATATGCCCGGAGCTCCA
ACCAGAACTCCTGTCTTCCCTCTCATGAGCTTACTCACCCAGGAGAGAAGTTGTGTACATGTGGCAGGTGTGGGAAGGGCTTCCATCATA
GCTTAGATTTTGACATTCACTGTGTAGACAGTGCTGGAGAGAGAGCCTGTAAATGTGATGTATATGATAAAGGCTTCAGTCAGACATCAC
AACTTCAAGCCCATCAGAGAGGTCACTCTAGAGACAAGACATACAAATGGGAAGTAAGTGACAGGATATTTAATAGGAATTCTGGTCTTC
ACCAGAGAGTTCACACTGGAGAGAAACCATATAAATGTGAGGTATGTGATAAGGGCTTCAGTAAGGCCTCAAATCTTCAAGCCCATCAGA
GAATCCACACTGGAGAGAAACCCTACAAATGTGATGTGTGTGATAAGAACTTCAGCCGTAATTCCCACCTTCAGGCCCATCAGAGAGTCC
ATACAGGAGAGAAACCCTACAAATGTGACACATGTGGGAAGGACTTCAGTCAGATCTCTCATCTTCAGGCCCATCAGAGAGTTCACAAAG
GAGAGAAGCCATACAAATGTGAGACATGTGGGAAGGGCTTTAGTCAGAGTTCGCATCTCCAAGACCATCAGCAAGTCCATACTGGAGAGA
ATCCCTACAAATGTGATGTGTGTGGGAAAGGCTTCAGTTGGAGTTCACATCTTCAAGCCCATCAGAGAGTCCACACAGGAGAGAAACCAT
ACAAATGTGAAGAATGTAGGAAAGGCTTCATCTGGAACTCATATCTTCATGTTCATCAGAGGATCCACACGGGAGAGAAACCCTATAAAT
GTGGCATGTGTGGTAAGAGCTTCAGTCAGACTTCACATCTTCAAGCCCATCAGAGAGTCCATACTGGAGAGAAACCATACAAATGTTTTG


Top

FusionGenePPI for SNUPN_ZNF233


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SNUPNTNNT3, ENO2, PEX5, SMN1, DDX20, SNRPB, ZPR1, RAN, XPO1, KPNB1, DBN1, MEX3B, RNF126, GCNT3, HOTAIR, SNRPA1, PDP1, TOE1, EGLN1, USP15, SNRPD1, PPP1R8, XRCC5, YEATS4, SLC33A1, SNW1, SNRPE, SNRPNZNF233CACNA1A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSNUPNchr15:75909749chr19:44768467ENST00000308588-39127_129101361m3G-cap structure
HgeneSNUPNchr15:75909749chr19:44768467ENST00000564644-410127_129101361m3G-cap structure
HgeneSNUPNchr15:75909749chr19:44768467ENST00000564675-39127_129101361m3G-cap structure
HgeneSNUPNchr15:75909749chr19:44768467ENST00000567134-410127_129101361m3G-cap structure


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SNUPN_ZNF233


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SNUPN_ZNF233


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource