FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35073

FusionGeneSummary for SNAPIN_FMNL1

check button Fusion gene summary
Fusion gene informationFusion gene name: SNAPIN_FMNL1
Fusion gene ID: 35073
HgeneTgene
Gene symbol

SNAPIN

FMNL1

Gene ID

23557

752

Gene nameSNAP associated proteinformin like 1
SynonymsBLOC1S7|BLOS7|BORCS3|SNAPAPC17orf1|C17orf1B|FHOD4|FMNL|KW-13
Cytomap

1q21.3

17q21.31

Type of geneprotein-codingprotein-coding
DescriptionSNARE-associated protein SnapinBLOC-1 subunit 7SNAP-25-binding proteinSNARE associated protein snapinbiogenesis of lysosomal organelles complex-1, subunit 7biogenesis of lysosome-related organelles complex 1 subunit 7synaptosomal-associated protein formin-like protein 1CLL-associated antigen KW-13leukocyte formin
Modification date2018051920180519
UniProtAcc

O95295

O95466

Ensembl transtripts involved in fusion geneENST00000368685, ENST00000478558, 
ENST00000331495, ENST00000328118, 
ENST00000592006, ENST00000587489, 
Fusion gene scores* DoF score2 X 1 X 2=44 X 4 X 3=48
# samples 24
** MAII scorelog2(2/4*10)=2.32192809488736log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SNAPIN [Title/Abstract] AND FMNL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSNAPIN

GO:0016079

synaptic vesicle exocytosis

10195194


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-R6-A8W5-01BSNAPINchr1

153632042

+FMNL1chr17

43317843

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368685ENST00000331495SNAPINchr1

153632042

+FMNL1chr17

43317843

+
In-frameENST00000368685ENST00000328118SNAPINchr1

153632042

+FMNL1chr17

43317843

+
5CDS-intronENST00000368685ENST00000592006SNAPINchr1

153632042

+FMNL1chr17

43317843

+
5CDS-intronENST00000368685ENST00000587489SNAPINchr1

153632042

+FMNL1chr17

43317843

+
3UTR-3CDSENST00000478558ENST00000331495SNAPINchr1

153632042

+FMNL1chr17

43317843

+
3UTR-3CDSENST00000478558ENST00000328118SNAPINchr1

153632042

+FMNL1chr17

43317843

+
3UTR-intronENST00000478558ENST00000592006SNAPINchr1

153632042

+FMNL1chr17

43317843

+
3UTR-intronENST00000478558ENST00000587489SNAPINchr1

153632042

+FMNL1chr17

43317843

+

Top

FusionProtFeatures for SNAPIN_FMNL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SNAPIN

O95295

FMNL1

O95466

Component of the BLOC-1 complex, a complex that isrequired for normal biogenesis of lysosome-related organelles(LRO), such as platelet dense granules and melanosomes. In concertwith the AP-3 complex, the BLOC-1 complex is required to targetmembrane protein cargos into vesicles assembled at cell bodies fordelivery into neurites and nerve terminals. The BLOC-1 complex, inassociation with SNARE proteins, is also proposed to be involvedin neurite extension. Plays a role in intracellular vesicletrafficking and synaptic vesicle recycling. May modulate a stepbetween vesicle priming, fusion and calcium-dependentneurotransmitter release through its ability to potentiate theinteraction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation stateinfluences exocytotic protein interactions and may regulatesynaptic vesicle exocytosis. May also have a role in themechanisms of SNARE-mediated membrane fusion in non-neuronal cells(PubMed:17182842, PubMed:18167355). As part of the BORC complexmay play a role in lysosomes movement and localization at the cellperiphery. Associated with the cytosolic face of lysosomes, theBORC complex may recruit ARL8B and couple lysosomes to microtubuleplus-end-directed kinesin motor (PubMed:25898167).{ECO:0000269|PubMed:17182842, ECO:0000269|PubMed:18167355,ECO:0000269|PubMed:25898167}. May play a role in the control of cell motility andsurvival of macrophages (By similarity). Plays a role in theregulation of cell morphology and cytoskeletal organization.Required in the cortical actin filament dynamics and cell shape.{ECO:0000250, ECO:0000269|PubMed:21834987}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFMNL1chr1:153632042chr17:43317843ENST00000328118+1026459_6163601105Compositional biasNote=Pro-rich
TgeneFMNL1chr1:153632042chr17:43317843ENST00000331495+1027459_6163601097Compositional biasNote=Pro-rich
TgeneFMNL1chr1:153632042chr17:43317843ENST00000328118+10261059_10903601105DomainDAD
TgeneFMNL1chr1:153632042chr17:43317843ENST00000328118+1026632_10233601105DomainFH2
TgeneFMNL1chr1:153632042chr17:43317843ENST00000331495+10271059_10903601097DomainDAD
TgeneFMNL1chr1:153632042chr17:43317843ENST00000331495+1027632_10233601097DomainFH2

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNAPINchr1:153632042chr17:43317843ENST00000368685+3437_126103137Coiled coilOntology_term=ECO:0000255
TgeneFMNL1chr1:153632042chr17:43317843ENST00000328118+102627_4683601105DomainGBD/FH3
TgeneFMNL1chr1:153632042chr17:43317843ENST00000331495+102727_4683601097DomainGBD/FH3


Top

FusionGeneSequence for SNAPIN_FMNL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SNAPIN_ENST00000368685_chr1_153632042_+_FMNL1_ENST00000331495_chr17_43317843_+_844aa
MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARR
RVVLVNNILQNAQRLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTERLRDAENESMAKIAELEKQLSQAR
KELETLRERFSESTAMGPSRRPPEPEKAPPAAPTRPSALELKVEELEEKGLIRILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPS
PDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPD
ALGRRDSELGPGVKAKKPIQTKFRMPLLNWVALKPSQITGTVFTELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSALKSKAAQKAPSKA
TLIEANRAKNLAITLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFEREQRPMEELSEEDRFMLCFSRIPRLPER
MTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVI
AEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGEN
PKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMDLISELKRRQQKEPLIYESDRDGAIED

>In-frame_SNAPIN_ENST00000368685_chr1_153632042_+_FMNL1_ENST00000328118_chr17_43317843_+_848aa
MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARR
RVVLVNNILQNAQRLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTERLRDAENESMAKIAELEKQLSQAR
KELETLRERFSESTAMGPSRRPPEPEKAPPAAPTRPSALELKVEELEEKGLIRILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPS
PDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPD
ALGRRDSELGPGVKAKKPIQTKFRMPLLNWVALKPSQITGTVFTELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSALKSKAAQKAPSKA
TLIEANRAKNLAITLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFEREQRPMEELSEEDRFMLCFSRIPRLPER
MTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVI
AEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGEN
PKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMDLISELKRRQQKEPLIYESDRDGAIED


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SNAPIN_ENST00000368685_chr1_153632042_+_FMNL1_ENST00000331495_chr17_43317843_+_2532nt
ATGGCGGGGGCTGGTTCCGCCGCTGTATCGGGGGCAGGGACCCCGGTGGCGGGGCCCACAGGCCGCGACCTTTTCGCCGAAGGGCTGCTG
GAGTTCCTGCGACCCGCTGTGCAGCAGCTCGACTCTCACGTACACGCCGTCAGAGAGAGCCAGGTAGAGCTCCGGGAACAAATTGACAAC
CTAGCCACAGAACTGTGCCGCATAAATGAGGATCAGAAGGTGGCCCTGGATCTTGACCCCTATGTTAAGAAGCTACTTAATGCCCGGCGA
CGCGTTGTCTTGGTTAACAACATTCTACAGAATGCTCAGAGGCTTCGGCTCACCGAGAGTGACAAGCTGCAGGTGCAGATCCAGGCGTAC
CTGGACAATATTTTTGATGTGGGGGCGCTGCTGGAGGACACAGAGACCAAGAACGCTGTGCTGGAGCACATGGAGGAACTGCAGGAGCAA
GTGGCGCTGCTGACAGAGCGGCTTCGGGACGCGGAGAACGAATCCATGGCCAAGATTGCAGAACTGGAAAAACAGCTAAGCCAGGCGCGC
AAGGAGTTGGAGACCCTGCGGGAGCGCTTCAGCGAATCGACCGCCATGGGGCCCTCCAGGCGTCCCCCAGAGCCTGAGAAAGCGCCTCCC
GCTGCCCCGACGCGGCCCTCGGCCCTGGAGCTGAAGGTGGAGGAGCTGGAGGAGAAGGGGTTAATCCGTATTCTGCGGGGGCCGGGGGAT
GCTGTCTCCATCGAGATCCTCCCCGTCGCTGTGGCAACTCCGAGCGGCGGTGATGCTCCGACTCCGGGGGTGCCGACCGGCTCCCCCAGC
CCAGATCTCGCACCTGCAGCAGAGCCGGCTCCCGGAGCAGCGCCACCGCCGCCGCCCCCACTGCCCGGCCTCCCCTCCCCGCAGGAAGCC
CCGCCCTCTGCGCCCCCACAGGCCCCGCCTCTCCCTGGCAGCCCGGAGCCCCCGCCTGCGCCGCCGCTGCCCGGAGACCTGCCGCCCCCA
CCCCCGCCACCGCCACCACCTCCGGGCACTGACGGGCCGGTGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCTCCCGGAGGTCCTCCTGAT
GCCCTAGGAAGACGCGACTCAGAATTGGGCCCAGGAGTGAAGGCCAAGAAGCCCATCCAGACTAAGTTCCGAATGCCACTCTTGAACTGG
GTGGCACTGAAACCCAGCCAGATCACCGGCACTGTCTTCACAGAGCTCAATGATGAGAAGGTGCTGCAGGAGCTAGACATGAGTGATTTT
GAGGAACAGTTCAAGACCAAGTCCCAAGGCCCCAGCCTGGACCTCAGCGCTCTCAAGAGTAAGGCAGCCCAGAAGGCCCCCAGCAAGGCG
ACACTCATTGAGGCCAACCGGGCCAAGAACTTGGCCATCACCCTGCGGAAGGGCAACCTGGGGGCCGAGCGCATCTGCCAAGCCATTGAG
GCGTACGACCTGCAGGCTCTGGGCCTGGACTTCCTGGAGCTGCTGATGCGCTTCCTGCCCACAGAGTATGAGCGCAGCCTCATCACCCGC
TTTGAGCGGGAGCAGCGGCCAATGGAGGAGCTGTCAGAGGAGGACCGCTTCATGCTATGCTTCAGCCGCATCCCGCGCCTGCCGGAGCGC
ATGACCACACTCACCTTCCTGGGCAACTTCCCGGACACAGCCCAGCTGCTCATGCCGCAACTGAATGCCATCATTGCAGCCTCAATGTCC
ATCAAGTCCTCTGACAAACTCCGCCAGATCCTGGAGATTGTCCTGGCCTTTGGCAACTACATGAACAGTAGCAAGCGTGGGGCAGCCTAT
GGCTTCCGGCTCCAGAGCCTGGATGCGCTGTTGGAGATGAAGTCGACTGATCGCAAGCAGACGCTGCTGCACTACCTGGTGAAGGTCATT
GCTGAGAAGTACCCGCAACTCACAGGCTTCCACAGCGACCTGCACTTCCTGGACAAGGCGGGCTCAGTGTCCCTGGACAGTGTCCTGGCG
GACGTGCGCTCCCTGCAGCGAGGCCTAGAGTTGACACAGAGAGAGTTTGTGCGGCAGGATGACTGCATGGTGCTCAAGGAGTTCCTGAGG
GCCAACTCGCCCACCATGGACAAGCTGCTGGCAGACAGCAAGACGGCTCAGGAGGCCTTTGAGTCTGTGGTGGAGTACTTCGGAGAGAAC
CCCAAGACCACATCCCCAGGCCTGTTCTTCTCCCTCTTTAGCCGCTTCATTAAGGCCTACAAGAAAGCTGAGCAGGAGGTGGAACAGTGG
AAAAAAGAAGCCGCTGCCCAGGAGGCAGGCGCTGATACCCCGGGCAAAGGGGAGCCCCCAGCACCCAAGTCACCGCCAAAGGCCCGGCGG
CCACAGATGGACCTCATCTCTGAGCTGAAACGGAGGCAGCAGAAGGAGCCACTCATTTATGAGAGCGACCGTGATGGGGCCATTGAAGAC
ATCATCACAGTGATCAAGACGGTGCCCTTCACGGCCCGCACCGGCAAGCGGACATCCCGGCTCCTCTGTGAGGCCAGCCTGGGAGAAGAG

>In-frame_SNAPIN_ENST00000368685_chr1_153632042_+_FMNL1_ENST00000328118_chr17_43317843_+_2544nt
ATGGCGGGGGCTGGTTCCGCCGCTGTATCGGGGGCAGGGACCCCGGTGGCGGGGCCCACAGGCCGCGACCTTTTCGCCGAAGGGCTGCTG
GAGTTCCTGCGACCCGCTGTGCAGCAGCTCGACTCTCACGTACACGCCGTCAGAGAGAGCCAGGTAGAGCTCCGGGAACAAATTGACAAC
CTAGCCACAGAACTGTGCCGCATAAATGAGGATCAGAAGGTGGCCCTGGATCTTGACCCCTATGTTAAGAAGCTACTTAATGCCCGGCGA
CGCGTTGTCTTGGTTAACAACATTCTACAGAATGCTCAGAGGCTTCGGCTCACCGAGAGTGACAAGCTGCAGGTGCAGATCCAGGCGTAC
CTGGACAATATTTTTGATGTGGGGGCGCTGCTGGAGGACACAGAGACCAAGAACGCTGTGCTGGAGCACATGGAGGAACTGCAGGAGCAA
GTGGCGCTGCTGACAGAGCGGCTTCGGGACGCGGAGAACGAATCCATGGCCAAGATTGCAGAACTGGAAAAACAGCTAAGCCAGGCGCGC
AAGGAGTTGGAGACCCTGCGGGAGCGCTTCAGCGAATCGACCGCCATGGGGCCCTCCAGGCGTCCCCCAGAGCCTGAGAAAGCGCCTCCC
GCTGCCCCGACGCGGCCCTCGGCCCTGGAGCTGAAGGTGGAGGAGCTGGAGGAGAAGGGGTTAATCCGTATTCTGCGGGGGCCGGGGGAT
GCTGTCTCCATCGAGATCCTCCCCGTCGCTGTGGCAACTCCGAGCGGCGGTGATGCTCCGACTCCGGGGGTGCCGACCGGCTCCCCCAGC
CCAGATCTCGCACCTGCAGCAGAGCCGGCTCCCGGAGCAGCGCCACCGCCGCCGCCCCCACTGCCCGGCCTCCCCTCCCCGCAGGAAGCC
CCGCCCTCTGCGCCCCCACAGGCCCCGCCTCTCCCTGGCAGCCCGGAGCCCCCGCCTGCGCCGCCGCTGCCCGGAGACCTGCCGCCCCCA
CCCCCGCCACCGCCACCACCTCCGGGCACTGACGGGCCGGTGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCTCCCGGAGGTCCTCCTGAT
GCCCTAGGAAGACGCGACTCAGAATTGGGCCCAGGAGTGAAGGCCAAGAAGCCCATCCAGACTAAGTTCCGAATGCCACTCTTGAACTGG
GTGGCACTGAAACCCAGCCAGATCACCGGCACTGTCTTCACAGAGCTCAATGATGAGAAGGTGCTGCAGGAGCTAGACATGAGTGATTTT
GAGGAACAGTTCAAGACCAAGTCCCAAGGCCCCAGCCTGGACCTCAGCGCTCTCAAGAGTAAGGCAGCCCAGAAGGCCCCCAGCAAGGCG
ACACTCATTGAGGCCAACCGGGCCAAGAACTTGGCCATCACCCTGCGGAAGGGCAACCTGGGGGCCGAGCGCATCTGCCAAGCCATTGAG
GCGTACGACCTGCAGGCTCTGGGCCTGGACTTCCTGGAGCTGCTGATGCGCTTCCTGCCCACAGAGTATGAGCGCAGCCTCATCACCCGC
TTTGAGCGGGAGCAGCGGCCAATGGAGGAGCTGTCAGAGGAGGACCGCTTCATGCTATGCTTCAGCCGCATCCCGCGCCTGCCGGAGCGC
ATGACCACACTCACCTTCCTGGGCAACTTCCCGGACACAGCCCAGCTGCTCATGCCGCAACTGAATGCCATCATTGCAGCCTCAATGTCC
ATCAAGTCCTCTGACAAACTCCGCCAGATCCTGGAGATTGTCCTGGCCTTTGGCAACTACATGAACAGTAGCAAGCGTGGGGCAGCCTAT
GGCTTCCGGCTCCAGAGCCTGGATGCGCTGTTGGAGATGAAGTCGACTGATCGCAAGCAGACGCTGCTGCACTACCTGGTGAAGGTCATT
GCTGAGAAGTACCCGCAACTCACAGGCTTCCACAGCGACCTGCACTTCCTGGACAAGGCGGGCTCAGTGTCCCTGGACAGTGTCCTGGCG
GACGTGCGCTCCCTGCAGCGAGGCCTAGAGTTGACACAGAGAGAGTTTGTGCGGCAGGATGACTGCATGGTGCTCAAGGAGTTCCTGAGG
GCCAACTCGCCCACCATGGACAAGCTGCTGGCAGACAGCAAGACGGCTCAGGAGGCCTTTGAGTCTGTGGTGGAGTACTTCGGAGAGAAC
CCCAAGACCACATCCCCAGGCCTGTTCTTCTCCCTCTTTAGCCGCTTCATTAAGGCCTACAAGAAAGCTGAGCAGGAGGTGGAACAGTGG
AAAAAAGAAGCCGCTGCCCAGGAGGCAGGCGCTGATACCCCGGGCAAAGGGGAGCCCCCAGCACCCAAGTCACCGCCAAAGGCCCGGCGG
CCACAGATGGACCTCATCTCTGAGCTGAAACGGAGGCAGCAGAAGGAGCCACTCATTTATGAGAGCGACCGTGATGGGGCCATTGAAGAC
ATCATCACAGATCTGCGGAACCAGCCCTACATCCGCGCAGACACAGGCCGCCGCAGTGCCCGTCGGCGTCCCCCGGGCCCCCCACTGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SNAPIN_ENST00000368685_chr1_153632042_+_FMNL1_ENST00000331495_chr17_43317843_+_3084nt
CGGGCGCCCCCTCACGGGGCGGGGCAGTGCGGCGCGGCTCCGGTTCCCGGCGGCCCTCGCGGCAGGTTTCGGGCTTCAGGACAATTCGTG
ATGGCGGGGGCTGGTTCCGCCGCTGTATCGGGGGCAGGGACCCCGGTGGCGGGGCCCACAGGCCGCGACCTTTTCGCCGAAGGGCTGCTG
GAGTTCCTGCGACCCGCTGTGCAGCAGCTCGACTCTCACGTACACGCCGTCAGAGAGAGCCAGGTAGAGCTCCGGGAACAAATTGACAAC
CTAGCCACAGAACTGTGCCGCATAAATGAGGATCAGAAGGTGGCCCTGGATCTTGACCCCTATGTTAAGAAGCTACTTAATGCCCGGCGA
CGCGTTGTCTTGGTTAACAACATTCTACAGAATGCTCAGAGGCTTCGGCTCACCGAGAGTGACAAGCTGCAGGTGCAGATCCAGGCGTAC
CTGGACAATATTTTTGATGTGGGGGCGCTGCTGGAGGACACAGAGACCAAGAACGCTGTGCTGGAGCACATGGAGGAACTGCAGGAGCAA
GTGGCGCTGCTGACAGAGCGGCTTCGGGACGCGGAGAACGAATCCATGGCCAAGATTGCAGAACTGGAAAAACAGCTAAGCCAGGCGCGC
AAGGAGTTGGAGACCCTGCGGGAGCGCTTCAGCGAATCGACCGCCATGGGGCCCTCCAGGCGTCCCCCAGAGCCTGAGAAAGCGCCTCCC
GCTGCCCCGACGCGGCCCTCGGCCCTGGAGCTGAAGGTGGAGGAGCTGGAGGAGAAGGGGTTAATCCGTATTCTGCGGGGGCCGGGGGAT
GCTGTCTCCATCGAGATCCTCCCCGTCGCTGTGGCAACTCCGAGCGGCGGTGATGCTCCGACTCCGGGGGTGCCGACCGGCTCCCCCAGC
CCAGATCTCGCACCTGCAGCAGAGCCGGCTCCCGGAGCAGCGCCACCGCCGCCGCCCCCACTGCCCGGCCTCCCCTCCCCGCAGGAAGCC
CCGCCCTCTGCGCCCCCACAGGCCCCGCCTCTCCCTGGCAGCCCGGAGCCCCCGCCTGCGCCGCCGCTGCCCGGAGACCTGCCGCCCCCA
CCCCCGCCACCGCCACCACCTCCGGGCACTGACGGGCCGGTGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCTCCCGGAGGTCCTCCTGAT
GCCCTAGGAAGACGCGACTCAGAATTGGGCCCAGGAGTGAAGGCCAAGAAGCCCATCCAGACTAAGTTCCGAATGCCACTCTTGAACTGG
GTGGCACTGAAACCCAGCCAGATCACCGGCACTGTCTTCACAGAGCTCAATGATGAGAAGGTGCTGCAGGAGCTAGACATGAGTGATTTT
GAGGAACAGTTCAAGACCAAGTCCCAAGGCCCCAGCCTGGACCTCAGCGCTCTCAAGAGTAAGGCAGCCCAGAAGGCCCCCAGCAAGGCG
ACACTCATTGAGGCCAACCGGGCCAAGAACTTGGCCATCACCCTGCGGAAGGGCAACCTGGGGGCCGAGCGCATCTGCCAAGCCATTGAG
GCGTACGACCTGCAGGCTCTGGGCCTGGACTTCCTGGAGCTGCTGATGCGCTTCCTGCCCACAGAGTATGAGCGCAGCCTCATCACCCGC
TTTGAGCGGGAGCAGCGGCCAATGGAGGAGCTGTCAGAGGAGGACCGCTTCATGCTATGCTTCAGCCGCATCCCGCGCCTGCCGGAGCGC
ATGACCACACTCACCTTCCTGGGCAACTTCCCGGACACAGCCCAGCTGCTCATGCCGCAACTGAATGCCATCATTGCAGCCTCAATGTCC
ATCAAGTCCTCTGACAAACTCCGCCAGATCCTGGAGATTGTCCTGGCCTTTGGCAACTACATGAACAGTAGCAAGCGTGGGGCAGCCTAT
GGCTTCCGGCTCCAGAGCCTGGATGCGCTGTTGGAGATGAAGTCGACTGATCGCAAGCAGACGCTGCTGCACTACCTGGTGAAGGTCATT
GCTGAGAAGTACCCGCAACTCACAGGCTTCCACAGCGACCTGCACTTCCTGGACAAGGCGGGCTCAGTGTCCCTGGACAGTGTCCTGGCG
GACGTGCGCTCCCTGCAGCGAGGCCTAGAGTTGACACAGAGAGAGTTTGTGCGGCAGGATGACTGCATGGTGCTCAAGGAGTTCCTGAGG
GCCAACTCGCCCACCATGGACAAGCTGCTGGCAGACAGCAAGACGGCTCAGGAGGCCTTTGAGTCTGTGGTGGAGTACTTCGGAGAGAAC
CCCAAGACCACATCCCCAGGCCTGTTCTTCTCCCTCTTTAGCCGCTTCATTAAGGCCTACAAGAAAGCTGAGCAGGAGGTGGAACAGTGG
AAAAAAGAAGCCGCTGCCCAGGAGGCAGGCGCTGATACCCCGGGCAAAGGGGAGCCCCCAGCACCCAAGTCACCGCCAAAGGCCCGGCGG
CCACAGATGGACCTCATCTCTGAGCTGAAACGGAGGCAGCAGAAGGAGCCACTCATTTATGAGAGCGACCGTGATGGGGCCATTGAAGAC
ATCATCACAGTGATCAAGACGGTGCCCTTCACGGCCCGCACCGGCAAGCGGACATCCCGGCTCCTCTGTGAGGCCAGCCTGGGAGAAGAG
ATGCCCCTCTAGCCCCTCAGATCTGCGGAACCAGCCCTACATCCGCGCAGACACAGGCCGCCGCAGTGCCCGTCGGCGTCCCCCGGGCCC
CCCACTGCAGGTCACCTCCGACCTCTCGCTGTAGCCGCTATTTCTGCAGGTGGATTCTGCAGGGGTGTGGGGCCGTGGACAGGCTGAGGC
TCAAGGAAGGTGGTCCTCAGCTCGGCTGGCCGGGCAGCCCCTCCTCCGCTGTGGCCCGCCTCAAACGGGCTGGTGCATCCTCCTCTTGGC
CACAGAGGGCAGCATCGCCCGCCCCTTCCCCCAAATGCTGCTTGCAGCACCCACCCTAAAGCCCCCTCCAAATAGCCATACTTAGCCTCA
GCAGGAGCCTGGCCTGTAACTTATAAAGTGCACCTCGCCCCCGCAAGCCCCAGCCCCGAGGACCGTCCATGGACCTTATTTTTATATGAG

>In-frame_SNAPIN_ENST00000368685_chr1_153632042_+_FMNL1_ENST00000328118_chr17_43317843_+_2978nt
CGGGCGCCCCCTCACGGGGCGGGGCAGTGCGGCGCGGCTCCGGTTCCCGGCGGCCCTCGCGGCAGGTTTCGGGCTTCAGGACAATTCGTG
ATGGCGGGGGCTGGTTCCGCCGCTGTATCGGGGGCAGGGACCCCGGTGGCGGGGCCCACAGGCCGCGACCTTTTCGCCGAAGGGCTGCTG
GAGTTCCTGCGACCCGCTGTGCAGCAGCTCGACTCTCACGTACACGCCGTCAGAGAGAGCCAGGTAGAGCTCCGGGAACAAATTGACAAC
CTAGCCACAGAACTGTGCCGCATAAATGAGGATCAGAAGGTGGCCCTGGATCTTGACCCCTATGTTAAGAAGCTACTTAATGCCCGGCGA
CGCGTTGTCTTGGTTAACAACATTCTACAGAATGCTCAGAGGCTTCGGCTCACCGAGAGTGACAAGCTGCAGGTGCAGATCCAGGCGTAC
CTGGACAATATTTTTGATGTGGGGGCGCTGCTGGAGGACACAGAGACCAAGAACGCTGTGCTGGAGCACATGGAGGAACTGCAGGAGCAA
GTGGCGCTGCTGACAGAGCGGCTTCGGGACGCGGAGAACGAATCCATGGCCAAGATTGCAGAACTGGAAAAACAGCTAAGCCAGGCGCGC
AAGGAGTTGGAGACCCTGCGGGAGCGCTTCAGCGAATCGACCGCCATGGGGCCCTCCAGGCGTCCCCCAGAGCCTGAGAAAGCGCCTCCC
GCTGCCCCGACGCGGCCCTCGGCCCTGGAGCTGAAGGTGGAGGAGCTGGAGGAGAAGGGGTTAATCCGTATTCTGCGGGGGCCGGGGGAT
GCTGTCTCCATCGAGATCCTCCCCGTCGCTGTGGCAACTCCGAGCGGCGGTGATGCTCCGACTCCGGGGGTGCCGACCGGCTCCCCCAGC
CCAGATCTCGCACCTGCAGCAGAGCCGGCTCCCGGAGCAGCGCCACCGCCGCCGCCCCCACTGCCCGGCCTCCCCTCCCCGCAGGAAGCC
CCGCCCTCTGCGCCCCCACAGGCCCCGCCTCTCCCTGGCAGCCCGGAGCCCCCGCCTGCGCCGCCGCTGCCCGGAGACCTGCCGCCCCCA
CCCCCGCCACCGCCACCACCTCCGGGCACTGACGGGCCGGTGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCTCCCGGAGGTCCTCCTGAT
GCCCTAGGAAGACGCGACTCAGAATTGGGCCCAGGAGTGAAGGCCAAGAAGCCCATCCAGACTAAGTTCCGAATGCCACTCTTGAACTGG
GTGGCACTGAAACCCAGCCAGATCACCGGCACTGTCTTCACAGAGCTCAATGATGAGAAGGTGCTGCAGGAGCTAGACATGAGTGATTTT
GAGGAACAGTTCAAGACCAAGTCCCAAGGCCCCAGCCTGGACCTCAGCGCTCTCAAGAGTAAGGCAGCCCAGAAGGCCCCCAGCAAGGCG
ACACTCATTGAGGCCAACCGGGCCAAGAACTTGGCCATCACCCTGCGGAAGGGCAACCTGGGGGCCGAGCGCATCTGCCAAGCCATTGAG
GCGTACGACCTGCAGGCTCTGGGCCTGGACTTCCTGGAGCTGCTGATGCGCTTCCTGCCCACAGAGTATGAGCGCAGCCTCATCACCCGC
TTTGAGCGGGAGCAGCGGCCAATGGAGGAGCTGTCAGAGGAGGACCGCTTCATGCTATGCTTCAGCCGCATCCCGCGCCTGCCGGAGCGC
ATGACCACACTCACCTTCCTGGGCAACTTCCCGGACACAGCCCAGCTGCTCATGCCGCAACTGAATGCCATCATTGCAGCCTCAATGTCC
ATCAAGTCCTCTGACAAACTCCGCCAGATCCTGGAGATTGTCCTGGCCTTTGGCAACTACATGAACAGTAGCAAGCGTGGGGCAGCCTAT
GGCTTCCGGCTCCAGAGCCTGGATGCGCTGTTGGAGATGAAGTCGACTGATCGCAAGCAGACGCTGCTGCACTACCTGGTGAAGGTCATT
GCTGAGAAGTACCCGCAACTCACAGGCTTCCACAGCGACCTGCACTTCCTGGACAAGGCGGGCTCAGTGTCCCTGGACAGTGTCCTGGCG
GACGTGCGCTCCCTGCAGCGAGGCCTAGAGTTGACACAGAGAGAGTTTGTGCGGCAGGATGACTGCATGGTGCTCAAGGAGTTCCTGAGG
GCCAACTCGCCCACCATGGACAAGCTGCTGGCAGACAGCAAGACGGCTCAGGAGGCCTTTGAGTCTGTGGTGGAGTACTTCGGAGAGAAC
CCCAAGACCACATCCCCAGGCCTGTTCTTCTCCCTCTTTAGCCGCTTCATTAAGGCCTACAAGAAAGCTGAGCAGGAGGTGGAACAGTGG
AAAAAAGAAGCCGCTGCCCAGGAGGCAGGCGCTGATACCCCGGGCAAAGGGGAGCCCCCAGCACCCAAGTCACCGCCAAAGGCCCGGCGG
CCACAGATGGACCTCATCTCTGAGCTGAAACGGAGGCAGCAGAAGGAGCCACTCATTTATGAGAGCGACCGTGATGGGGCCATTGAAGAC
ATCATCACAGATCTGCGGAACCAGCCCTACATCCGCGCAGACACAGGCCGCCGCAGTGCCCGTCGGCGTCCCCCGGGCCCCCCACTGCAG
GTCACCTCCGACCTCTCGCTGTAGCCGCTATTTCTGCAGGTGGATTCTGCAGGGGTGTGGGGCCGTGGACAGGCTGAGGCTCAAGGAAGG
TGGTCCTCAGCTCGGCTGGCCGGGCAGCCCCTCCTCCGCTGTGGCCCGCCTCAAACGGGCTGGTGCATCCTCCTCTTGGCCACAGAGGGC
AGCATCGCCCGCCCCTTCCCCCAAATGCTGCTTGCAGCACCCACCCTAAAGCCCCCTCCAAATAGCCATACTTAGCCTCAGCAGGAGCCT
GGCCTGTAACTTATAAAGTGCACCTCGCCCCCGCAAGCCCCAGCCCCGAGGACCGTCCATGGACCTTATTTTTATATGAGATTAATAAAG


Top

FusionGenePPI for SNAPIN_FMNL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SNAPINSNAP23, BLOC1S6, DTNBP1, BLOC1S2, BLOC1S3, BLOC1S4, BLOC1S1, TRPV1, RGS7, LAMC1, GPRASP1, KIF5C, SPAG5, EEF1G, HAP1, KAT5, IMMT, KAT7, DDR1, IKBKAP, SNAP25, MAPK14, SPP1, RNF13, TOR1A, COPS4, SMAD2, BNIPL, TEX35, CEP170, TMEM171, CCDC151, C17orf59, BCAS4, HERC2, SCLT1, CEP170P1, TRIM69, EXOC1, KLC1, SCOC, TCP10L, TSKS, COG6, SYBU, IKBIP, TRAK2, TRIML2, MTNR1AFMNL1XRCC6, RAC1, PFN1, PFN2, APP, AHNAK, FMNL1, ARHGAP4, CWF19L1, PARP1, HSP90B1, FLI1, LSP1, SIPA1, ARHGAP17, PLEC, TIA1, GEMIN5, FLII, LIMA1, MTCH2, PPP1R12A, RALY, NPM1, STOM, SUPT16H, TAP2, CHCHD3, TOMM40, COPB1, LMO7, HSPA5, FLNB, CAP1, ABCF1, ATP5B, MS4A1, XRCC5, KCTD10, VDAC1, ACTN4, TUFM, ZNF787, CORO1C, HSPA1B, ATAD3A, CD44, SSRP1, OTUD4, SIPA1L3, ABCB8, CORO1A, TMPO, PHB2, NUFIP2, RPL11, PRPF40A, MMS19, STRN3, TCERG1, GAS7, HMG20A, SRPK2, THOC5, POLR3E, ACTR5, PPP1R10, HEY1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSNAPINchr1:153632042chr17:43317843ENST00000368685+3483_136103137TOR1A


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SNAPIN_FMNL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SNAPIN_FMNL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFMNL1C0023893Liver Cirrhosis, Experimental1CTD_human