FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35036

FusionGeneSummary for SMYD3_WLS

check button Fusion gene summary
Fusion gene informationFusion gene name: SMYD3_WLS
Fusion gene ID: 35036
HgeneTgene
Gene symbol

SMYD3

WLS

Gene ID

64754

79971

Gene nameSET and MYND domain containing 3wntless Wnt ligand secretion mediator
SynonymsKMT3E|ZMYND1|ZNFN3A1|bA74P14.1C1orf139|EVI|GPR177|MRP|mig-14
Cytomap

1q44

1p31.3

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase SMYD3SET and MYND domain-containing protein 3bA74P14.1 (novel protein)zinc finger MYND domain-containing protein 1zinc finger protein, subfamily 3A (MYND domain containing), 1zinc finger, MYND domain containing 1protein wntless homologG protein-coupled receptor 177integral membrane protein GPR177protein evenness interrupted homologputative NF-kappa-B-activating protein 373putative NFkB activating protein 373
Modification date2018051920180527
UniProtAcc

Q9H7B4

Q5T9L3

Ensembl transtripts involved in fusion geneENST00000541742, ENST00000490107, 
ENST00000388985, ENST00000366517, 
ENST00000403792, 
ENST00000540432, 
ENST00000354777, ENST00000262348, 
ENST00000370976, ENST00000370971, 
ENST00000491811, 
Fusion gene scores* DoF score10 X 7 X 9=6304 X 2 X 4=32
# samples 124
** MAII scorelog2(12/630*10)=-2.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SMYD3 [Title/Abstract] AND WLS [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A1N6-01ASMYD3chr1

246518333

-WLSchr1

68659910

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000541742ENST00000540432SMYD3chr1

246518333

-WLSchr1

68659910

-
In-frameENST00000541742ENST00000354777SMYD3chr1

246518333

-WLSchr1

68659910

-
In-frameENST00000541742ENST00000262348SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000541742ENST00000370976SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000541742ENST00000370971SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000541742ENST00000491811SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000490107ENST00000540432SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000490107ENST00000354777SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000490107ENST00000262348SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000490107ENST00000370976SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000490107ENST00000370971SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000490107ENST00000491811SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000388985ENST00000540432SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000388985ENST00000354777SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000388985ENST00000262348SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000388985ENST00000370976SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000388985ENST00000370971SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000388985ENST00000491811SMYD3chr1

246518333

-WLSchr1

68659910

-
intron-3CDSENST00000366517ENST00000540432SMYD3chr1

246518333

-WLSchr1

68659910

-
intron-3CDSENST00000366517ENST00000354777SMYD3chr1

246518333

-WLSchr1

68659910

-
intron-3CDSENST00000366517ENST00000262348SMYD3chr1

246518333

-WLSchr1

68659910

-
intron-intronENST00000366517ENST00000370976SMYD3chr1

246518333

-WLSchr1

68659910

-
intron-intronENST00000366517ENST00000370971SMYD3chr1

246518333

-WLSchr1

68659910

-
intron-intronENST00000366517ENST00000491811SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000403792ENST00000540432SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000403792ENST00000354777SMYD3chr1

246518333

-WLSchr1

68659910

-
Frame-shitENST00000403792ENST00000262348SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000403792ENST00000370976SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000403792ENST00000370971SMYD3chr1

246518333

-WLSchr1

68659910

-
5CDS-intronENST00000403792ENST00000491811SMYD3chr1

246518333

-WLSchr1

68659910

-

Top

FusionProtFeatures for SMYD3_WLS


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMYD3

Q9H7B4

WLS

Q5T9L3

Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but notmonomethylation (PubMed:15235609, PubMed:22419068). Alsomethylates 'Lys-5' of histone H4 (PubMed:22419068). Plays animportant role in transcriptional activation as a member of an RNApolymerase complex (PubMed:15235609). Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences (PubMed:15235609).{ECO:0000269|PubMed:15235609, ECO:0000269|PubMed:22419068}. Regulates Wnt proteins sorting and secretion in afeedback regulatory mechanism. This reciprocal interaction plays akey role in the regulation of expression, subcellular location,binding and organelle-specific association of Wnt proteins. Playsalso an important role in establishment of the anterior-posteriorbody axis formation during development (By similarity).{ECO:0000250, ECO:0000269|PubMed:16678095,ECO:0000269|PubMed:16678096}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSMYD3chr1:246518333chr1:68659910ENST00000388985-21214_1676429RegionS-adenosyl-L-methionine binding
HgeneSMYD3chr1:246518333chr1:68659910ENST00000490107-21214_1617370RegionS-adenosyl-L-methionine binding
HgeneSMYD3chr1:246518333chr1:68659910ENST00000541742-21214_1617370RegionS-adenosyl-L-methionine binding
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012254_26835542Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012290_30335542Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012325_33135542Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012353_38035542Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012402_43135542Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-01243_23235542Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012453_47135542Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012493_54135542Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012254_26835544Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012290_30335544Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012325_33135544Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012353_38035544Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012402_43135544Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-01243_23235544Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012453_47135544Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012493_54135544Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011254_268-82451Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011290_303-82451Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011325_331-82451Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011353_380-82451Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011402_431-82451Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-01143_232-82451Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011453_471-82451Topological domainLumenal
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011493_541-82451Topological domainCytoplasmic
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012233_25335542TransmembraneHelical%3B Name%3D1
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012269_28935542TransmembraneHelical%3B Name%3D2
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012304_32435542TransmembraneHelical%3B Name%3D3
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012332_35235542TransmembraneHelical%3B Name%3D4
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012381_40135542TransmembraneHelical%3B Name%3D5
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012432_45235542TransmembraneHelical%3B Name%3D6
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012472_49235542TransmembraneHelical%3B Name%3D7
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012233_25335544TransmembraneHelical%3B Name%3D1
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012269_28935544TransmembraneHelical%3B Name%3D2
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012304_32435544TransmembraneHelical%3B Name%3D3
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012332_35235544TransmembraneHelical%3B Name%3D4
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012381_40135544TransmembraneHelical%3B Name%3D5
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012432_45235544TransmembraneHelical%3B Name%3D6
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012472_49235544TransmembraneHelical%3B Name%3D7
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011233_253-82451TransmembraneHelical%3B Name%3D1
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011269_289-82451TransmembraneHelical%3B Name%3D2
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011304_324-82451TransmembraneHelical%3B Name%3D3
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011332_352-82451TransmembraneHelical%3B Name%3D4
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011381_401-82451TransmembraneHelical%3B Name%3D5
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011432_452-82451TransmembraneHelical%3B Name%3D6
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011472_492-82451TransmembraneHelical%3B Name%3D7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSMYD3chr1:246518333chr1:68659910ENST00000388985-2124_24076429DomainSET
HgeneSMYD3chr1:246518333chr1:68659910ENST00000490107-2124_24017370DomainSET
HgeneSMYD3chr1:246518333chr1:68659910ENST00000541742-2124_24017370DomainSET
HgeneSMYD3chr1:246518333chr1:68659910ENST00000388985-212205_20676429RegionS-adenosyl-L-methionine binding
HgeneSMYD3chr1:246518333chr1:68659910ENST00000490107-212205_20617370RegionS-adenosyl-L-methionine binding
HgeneSMYD3chr1:246518333chr1:68659910ENST00000541742-212205_20617370RegionS-adenosyl-L-methionine binding
HgeneSMYD3chr1:246518333chr1:68659910ENST00000388985-21249_8776429Zinc fingerMYND-type
HgeneSMYD3chr1:246518333chr1:68659910ENST00000490107-21249_8717370Zinc fingerMYND-type
HgeneSMYD3chr1:246518333chr1:68659910ENST00000541742-21249_8717370Zinc fingerMYND-type


Top

FusionGeneSequence for SMYD3_WLS


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000540432_chr1_68659910_-_527aa
MRCSQCRVAKYCSAKCQLQGPQRQCPTCRXNVWMPVRTITRQNGSCLGDPIIVTRSETLKRQFQGKLKPMTSCFLFTFPSPTWRXVLGSN
SCCLSCSWTLPSSXTTKSEKMQKSPWTFPWLTVMTRLLSGLKWPMKEYHGNSNAPSHLPRLQSMRAVTMNVMSFLSWKLGLWPISFTFXT
SGCLXMRRRKSMWELGRXRISGWWGSTKMEASPRCGLPXRPSLRPASSSLWCGIGGGSPXCPDPQCFWKKSSLPLGFPXPLSISQWNGFP
SGLTGPGCCCLVTSDRASSMRCFCPSGSSSVASTXWISTSGTTSQGIGSKSDPLPLAPSASSYLTCVREGYNSRIPSTVSGLQTLEQSWP
WPSSSWLESASASTSCFYASWYFRCFGTSVGSSPACQLXAKSGGYTMRGXFLGSSSSCLSPWPALPXLSSSSSLVRXRKAIGNGAASQSK

>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000354777_chr1_68659910_-_525aa
MRCSQCRVAKYCSAKCQGPQRQCPTCRXNVWMPVRTITRQNGSCLGDPIIVTRSETLKRQFQGKLKPMTSCFLFTFPSPTWRXVLGSNSC
CLSCSWTLPSSXTTKSEKMQKSPWTFPWLTVMTRLLSGLKWPMKEYHGNSNAPSHLPRLQSMRAVTMNVMSFLSWKLGLWPISFTFXTSG
CLXMRRRKSMWELGRXRISGWWGSTKMEASPRCGLPXRPSLRPASSSLWCGIGGGSPXCPDPQCFWKKSSLPLGFPXPLSISQWNGFPSG
LTGPGCCCLVTSDRASSMRCFCPSGSSSVASTXWISTSGTTSQGIGSKSDPLPLAPSASSYLTCVREGYNSRIPSTVSGLQTLEQSWPWP
SSSWLESASASTSCFYASWYFRCFGTSVGSSPACQLXAKSGGYTMRGXFLGSSSSCLSPWPALPXLSSSSSLVRXRKAIGNGAASQSKXT

>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000262348_chr1_68659910_-_523aa
MRCSQCRVAKYCSAKCQLQGPQRQCPTCRXNVWMPVRTITRQNGSCLGDPIIVTRSETLKRQFQGKLKPMTSCFLFTFPSPTWRXVLGSN
SCCLSCSWTLPSSXTTKSEKMQKSPWTFPWLTVMTRLLSGLKWPMKEYHGNSNAPSHLPRLQSMRAVTMNVMSFLSWKLGLWPISFTFXT
SGCLXMRRRKSMWELGRXRISGWWGSTKMEASPRCGLPXRPSLRPASSSLWCGIGGGSPXCPDPQCFWKKSSLPLGFPXPLSISQWNGFP
SGLTGPGCCCLVTSDRASSMRCFCPSGSSSVASTXWISTSGTTSQGIGSKSDPLPLAPSASSYLTCVREGYNSRIPSTVSGLQTLEQSWP
WPSSSWLESASASTSCFYASWYFRCFGTSVGSSPACQLXAKSGGYTMRGXFLGSSSSCLSPWPALPXLSSSSSLVRXRKAIGNGAASQSK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000540432_chr1_68659910_-_1583nt
ATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGA
AATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAG
AGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAAT
TCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGG
CTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGA
CTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACA
TCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAG
GCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGA
TGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCA
TCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCT
GTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCC
TCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCA
TGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTG
GGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCA
CCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAG
TGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACT
ATGGAGAAGACCAGTCCAATGGAATGCAACTCCCATGTAAATCGAGGGAAGATTGTGCTTTGTTTGTTTCGGAACTTTATCAAGAATTGT

>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000354777_chr1_68659910_-_1577nt
ATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTG
TGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAA
TTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGC
TGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACC
GTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAG
AGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGC
TGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCA
CCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCC
GACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGT
TTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCG
AGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCA
TATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCT
TCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGC
AGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGG
CCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACA
GTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAG
AAGACCAGTCCAATGGAATGCAACTCCCATGTAAATCGAGGGAAGATTGTGCTTTGTTTGTTTCGGAACTTTATCAAGAATTGTTCAGCG

>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000262348_chr1_68659910_-_1571nt
ATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGA
AATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAG
AGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAAT
TCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGG
CTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGA
CTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACA
TCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAG
GCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGA
TGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCA
TCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCT
GTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCC
TCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCA
TGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTG
GGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCA
CCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAG
TGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACT
ATGGAGAAGACCAGTCCAATGGCGATCTGGGTGTCCATAGTGGGGAAGAACTCCAGCTCACCACCACTATCACCCATGTGGACGGACCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000540432_chr1_68659910_-_1886nt
GAGGTGGATTTGAGAGATACCTCCCCTCCTTCTGCTCAGCTGCCTTGCAGTAATTAAACTCTTTCTCTGCTGCAACACCCCTACTGTTCT
CCGTGTATTGGCTTTTCTGGGCAGCAGGAAGGAAAAGCTGATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCA
GCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCT
TGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCAC
ATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAA
ATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGA
GTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATG
GAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAG
ATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATC
TTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATT
TCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGC
ATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTAT
TGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTC
TACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTT
CTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTAT
GAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTA
ACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTC
TTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGAATGCAACTCCCATGTAAATCGAGGGAA
GATTGTGCTTTGTTTGTTTCGGAACTTTATCAAGAATTGTTCAGCGCTTCGAAATATTCCTTCATCAATGACAACGCAGCTTCTGGTATT
TGAGTCAACAAGGCAACACATGTTTATCAGCTTTGCATTTGCAGTTGTCACAGTCACATTGATTGTACTTGTATACGCACACAAATACAC

>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000354777_chr1_68659910_-_1866nt
GAGGTGGATTTGAGAGATACCTCCCCTCCTTCTGCTCAGCTGCCTTGCAGTAATTAAACTCTTTCTCTGCTGCAACACCCCTACTGTTCT
CCGTGTATTGGCTTTTCTGGGCAGCAGGAAGGAAAAGCTGATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCA
GGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGA
CCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCACATTCCC
CTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGA
GAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAGTACCA
CGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATT
GGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGATAAAG
GATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCTTCATC
ATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATG
ACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCATCTTC
TATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAG
CAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCTACAGT
ATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGC
TTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATGAGGGG
CTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAA
GGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCTTTGCT
CTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGAATGCAACTCCCATGTAAATCGAGGGAAGATTGT
GCTTTGTTTGTTTCGGAACTTTATCAAGAATTGTTCAGCGCTTCGAAATATTCCTTCATCAATGACAACGCAGCTTCTGGTATTTGAGTC
AACAAGGCAACACATGTTTATCAGCTTTGCATTTGCAGTTGTCACAGTCACATTGATTGTACTTGTATACGCACACAAATACACTCATTT

>In-frame_SMYD3_ENST00000541742_chr1_246518333_-_WLS_ENST00000262348_chr1_68659910_-_2569nt
GAGGTGGATTTGAGAGATACCTCCCCTCCTTCTGCTCAGCTGCCTTGCAGTAATTAAACTCTTTCTCTGCTGCAACACCCCTACTGTTCT
CCGTGTATTGGCTTTTCTGGGCAGCAGGAAGGAAAAGCTGATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCA
GCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCT
TGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCAC
ATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAA
ATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGA
GTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATG
GAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAG
ATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATC
TTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATT
TCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGC
ATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTAT
TGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTC
TACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTT
CTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTAT
GAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTA
ACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTC
TTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGCGATCTGGGTGTCCATAGTGGGGAAGAA
CTCCAGCTCACCACCACTATCACCCATGTGGACGGACCCACTGAGATCTACAAGTTGACCCGCAAGGAGGCCCAGGAGTAGGAGGCTGCA
GCGCCCGGCTGGGACGGTCTCTCCATACCCCAGCCCCTCTAACTAGAGTGGGGAGCATGCCAGAGAGAGCTCAATGTACAAATGAATGCC
TCATGGCTCTTAGCTGTGGTTTCTTGGACCAGCGGCATGGACATTTGTCAGTTTGCCTTCTGACGGTAGCTTTTGGAGGAAGATTCCTGC
AGCCACTAATGCATTGTGTATGATAACAAAAACTCTGGTATGACACATTTTCTGTGATCATTGTTAATTAGTGACATAGTAACATCTGTA
GCAGCTGGTTAGTAAACCTCATGTGGGGGTGGGGTGGGGGTGTATTCCTTGGGGGATGGTTTGGGCCGAATGGGGAGTGGAATATTTGAC
ATTTTTCCTGTTTTAAATTCTAGGATAGATTTTAACATCCTTTGCGGTCCCAGTCCAAGGTAGGCTGGTGTCATAGTCTTCTCACTCCTA
ATCCATGACCACTGTTTTTTTCCTATTTATATCACCAGGTAGCCCACTGAGTTAATATTTAAGTTGTCAATAGATAAGTGTCCCTGTTTT
GTGGCATAATATAACTGAATTTCATGAGAAGATTTATTCCACCAGGGGTATTTCAGCTTTGAAACCAAATCTGTGTATCTAATACTAACC
AATCTGTTGGATGTGGGTTTTAAAAAATGTTTGCTAAACTACCCAAGTAAGATTTACTGTATTAAATGGCCTTCGGGTCTGAAAAGCTTT
TTTAACTTCTTGCTTAAAATGCGTTTTATTTTGATAAGATACTTCAAATAGCCTCCAAAAGTGTAGATCCAATCATTTAAATAAACCTGT


Top

FusionGenePPI for SMYD3_WLS


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMYD3MEST, HELZ, POLR2A, HSP90AA1, HIST3H3, ESR1, EZH2, EED, APP, CAMK2B, NDUFAB1, NFYB, CYP39A1, VANGL1, H3F3C, TRIT1, ZNF557, CDC37, HSP90AB1, HSP90AB4P, HSP90AB3P, HSP90AA5P, MAGED4B, KDM3B, RCAN3, PLCB3, TRMT2A, KMT2EWLSMOV10, NXF1, OPRM1, OPRD1, OPRK1, WNT4, HTR3C, TCTN2, TCTN3, NCSTN, WNT7A, CHRND, WNT5A, HTR3A, GABRA3, WNT16, TMED6, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneWLSchr1:246518333chr1:68659910ENST00000262348-012101_23235542Wnt proteins
TgeneWLSchr1:246518333chr1:68659910ENST00000354777-012101_23235544Wnt proteins
TgeneWLSchr1:246518333chr1:68659910ENST00000370976-011101_232-82451Wnt proteins


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMYD3_WLS


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SMYD3_WLS


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSMYD3C0236733Amphetamine-Related Disorders1CTD_human
TgeneWLSC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneWLSC0858355addicted to cocaine1PSYGENET