FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35030

FusionGeneSummary for SMYD3_COPA

check button Fusion gene summary
Fusion gene informationFusion gene name: SMYD3_COPA
Fusion gene ID: 35030
HgeneTgene
Gene symbol

SMYD3

COPA

Gene ID

64754

1314

Gene nameSET and MYND domain containing 3coatomer protein complex subunit alpha
SynonymsKMT3E|ZMYND1|ZNFN3A1|bA74P14.1AILJK|HEP-COP
Cytomap

1q44

1q23.2

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase SMYD3SET and MYND domain-containing protein 3bA74P14.1 (novel protein)zinc finger MYND domain-containing protein 1zinc finger protein, subfamily 3A (MYND domain containing), 1zinc finger, MYND domain containing 1coatomer subunit alphaHEPCOPalpha coat proteinalpha-COPproxeninxenin
Modification date2018051920180523
UniProtAcc

Q9H7B4

P53621

Ensembl transtripts involved in fusion geneENST00000541742, ENST00000490107, 
ENST00000388985, ENST00000366517, 
ENST00000403792, 
ENST00000368069, 
ENST00000241704, 
Fusion gene scores* DoF score10 X 7 X 9=6309 X 11 X 5=495
# samples 1210
** MAII scorelog2(12/630*10)=-2.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/495*10)=-2.30742852519225
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SMYD3 [Title/Abstract] AND COPA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCOPA

GO:0030157

pancreatic juice secretion

1429581


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-5518-01ASMYD3chr1

245927343

-COPAchr1

160305112

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000541742ENST00000368069SMYD3chr1

245927343

-COPAchr1

160305112

-
Frame-shitENST00000541742ENST00000241704SMYD3chr1

245927343

-COPAchr1

160305112

-
In-frameENST00000490107ENST00000368069SMYD3chr1

245927343

-COPAchr1

160305112

-
In-frameENST00000490107ENST00000241704SMYD3chr1

245927343

-COPAchr1

160305112

-
In-frameENST00000388985ENST00000368069SMYD3chr1

245927343

-COPAchr1

160305112

-
In-frameENST00000388985ENST00000241704SMYD3chr1

245927343

-COPAchr1

160305112

-
5UTR-3CDSENST00000366517ENST00000368069SMYD3chr1

245927343

-COPAchr1

160305112

-
5UTR-3CDSENST00000366517ENST00000241704SMYD3chr1

245927343

-COPAchr1

160305112

-
intron-3CDSENST00000403792ENST00000368069SMYD3chr1

245927343

-COPAchr1

160305112

-
intron-3CDSENST00000403792ENST00000241704SMYD3chr1

245927343

-COPAchr1

160305112

-

Top

FusionProtFeatures for SMYD3_COPA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMYD3

Q9H7B4

COPA

P53621

Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but notmonomethylation (PubMed:15235609, PubMed:22419068). Alsomethylates 'Lys-5' of histone H4 (PubMed:22419068). Plays animportant role in transcriptional activation as a member of an RNApolymerase complex (PubMed:15235609). Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences (PubMed:15235609).{ECO:0000269|PubMed:15235609, ECO:0000269|PubMed:22419068}. The coatomer is a cytosolic protein complex that bindsto dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosyntheticprotein transport from the ER, via the Golgi up to the trans Golginetwork. Coatomer complex is required for budding from Golgimembranes, and is essential for the retrograde Golgi-to-ERtransport of dilysine-tagged proteins. In mammals, the coatomercan only be recruited by membranes associated to ADP-ribosylationfactors (ARFs), which are small GTP-binding proteins; the complexalso influences the Golgi structural integrity, as well as theprocessing, activity, and endocytic recycling of LDL receptors (Bysimilarity). {ECO:0000250}. Xenin stimulates exocrine pancreatic secretion. Itinhibits pentagastrin-stimulated secretion of acid, to induceexocrine pancreatic secretion and to affect small and largeintestinal motility. In the gut, xenin interacts with theneurotensin receptor.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SMYD3_COPA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMYD3_ENST00000490107_chr1_245927343_-_COPA_ENST00000368069_chr1_160305112_-_1158aa
VWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISG
LRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAV
FHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDF
NSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLL
IKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISKVKYVIWSADMSHVALLAKHEHSCPLPLTAIVICNRK
LDALCNIHENIRVKSGAWDESGVFIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRK
YDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRT
KNFDKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDPEKETIPD
IDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTVGTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEG
GGWDVEEDLELPPELDISPGAAGGAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFLQTYARGR
TTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITIC
REYIVGLSVETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQTRKILSA

>In-frame_SMYD3_ENST00000490107_chr1_245927343_-_COPA_ENST00000241704_chr1_160305112_-_1149aa
VWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISG
LRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAV
FHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDF
NSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLL
IKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHE
NIRVKSGAWDESGVFIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVR
NAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFL
YLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDPEKETIPDIDPNAKLLQ
PPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTVGTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDL
ELPPELDISPGAAGGAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFLQTYARGRTTYQALPCL
PSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSV
ETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQTRKILSACEKNPTDAY

>In-frame_SMYD3_ENST00000388985_chr1_245927343_-_COPA_ENST00000368069_chr1_160305112_-_1553aa
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCL
KSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVIC
NSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQD
KDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRI
FFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVL
TGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIV
SGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAGHD
GGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDAD
SQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISKV
KYVIWSADMSHVALLAKHEHSCPLPLTAIVICNRKLDALCNIHENIRVKSGAWDESGVFIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTR
VKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEIAL
EAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNC
GQKSLAYLTAATHGLDEEAESLKETFDPEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTVGT
EGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAGGAEDGFFVPPTKGTSPTQIWCNNSQLPVDHIL
AGSFETAMRLLHDQVGVIQFGPYKQLFLQTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKF
EEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLF
FKLKNFKTAATFARRLLELGPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQICR

>In-frame_SMYD3_ENST00000388985_chr1_245927343_-_COPA_ENST00000241704_chr1_160305112_-_1544aa
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCL
KSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVIC
NSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQD
KDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRI
FFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVL
TGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIV
SGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAHPNLNLFAAGHD
GGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDAD
SQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISKV
KYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGVFIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCL
DRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDK
NCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLT
AATHGLDEEAESLKETFDPEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTVGTEGWGEDAEL
QLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAGGAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMR
LLHDQVGVIQFGPYKQLFLQTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRS
ILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTA
ATFARRLLELGPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQICRVTTVTEIGK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMYD3_ENST00000490107_chr1_245927343_-_COPA_ENST00000368069_chr1_160305112_-_3474nt
GTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTTCATCATGAATATCCC
TGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTAACAGGGCACAACCAT
TATGTGATGTGTGCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTTTGGGATATTTCTGGT
CTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGAACTACAGATGCAGTG
GTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTATCTGGGGCAGATGAT
CGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAATGTATCTTGTGCCGTC
TTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGGACTGGGGTTCAGACT
TTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGATGGTGGTATGATTGTG
TTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTACGACAGCTGGATTTC
AACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAATCCAGCAGAAAATGCA
GTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGACTCCCAGAATCCTGAT
GCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGGATGCATTCGCTTCTG
ATCAAGAATCTGAAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACAGGCAATCTCCTGCTT
CGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTGAAATACGTTATCTGG
TCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGAACACTCATGCCCTTTGCCTCTTACAGCCATTGTGATCTGTAACCGCAAA
CTGGATGCTTTATGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATCTATACCACAAGCAAC
CACATCAAATATGCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGGGCAACAAT
GTATACTGCCTAGACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCCCTGATCAACAGAAAA
TATGATGAGGTACTGCACATGGTGAGGAATGCCAAACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTG
GCACTGCATTTTGTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTGGAAGCAGCCAAAGCA
CTGGATGACAAGAACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATGTGCTATCAGCGTACC
AAAAACTTTGACAAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATTGCTGAGATCAGAAAG
GACATGAGTGGCCACTATCAGAATGCCCTATACCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTG
GCCTATCTCACAGCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAGGAGACAATCCCAGAC
ATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACTGTATCCAAAGGATTT
TTTGAAGGCACCATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACAGAGGGCTGGGGAGAG
GATGCAGAGCTGCAGTTGGATGAAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGA
GGTGGCTGGGATGTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCTGAAGATGGTTTCTTT
GTGCCCCCAACCAAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAA
ACAGCCATGCGGCTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACATACGCCCGAGGCCGC
ACAACCTATCAGGCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATGGTGTACCA
GCTGTGGGCCTGAAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTTGAGGAGGCTGTGGAA
AAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCTTGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGC
CGTGAGTACATTGTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAGCGCATCTGTGAGATG
GCAGCCTATTTCACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTCTTCAAGCTCAAGAAC
TTCAAGACAGCTGCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGAAAAATCCTGTCTGCC
TGTGAGAAGAATCCCACAGATGCCTACCAGCTCAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTAC
CGTGGAAAGCCAGTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGGGTCACCACAGTGACA

>In-frame_SMYD3_ENST00000490107_chr1_245927343_-_COPA_ENST00000241704_chr1_160305112_-_3447nt
GTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTTCATCATGAATATCCC
TGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTAACAGGGCACAACCAT
TATGTGATGTGTGCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTTTGGGATATTTCTGGT
CTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGAACTACAGATGCAGTG
GTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTATCTGGGGCAGATGAT
CGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAATGTATCTTGTGCCGTC
TTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGGACTGGGGTTCAGACT
TTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGATGGTGGTATGATTGTG
TTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTACGACAGCTGGATTTC
AACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAATCCAGCAGAAAATGCA
GTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGACTCCCAGAATCCTGAT
GCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGGATGCATTCGCTTCTG
ATCAAGAATCTGAAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACAGGCAATCTCCTGCTT
CGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTGAAATACGTTATCTGG
TCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGCCATTGTGATCTGTAACCGCAAACTGGATGCTTTATGTAACATTCATGAG
AACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATCTATACCACAAGCAACCACATCAAATATGCTGTCACCACTGGG
GACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGGGCAACAATGTATACTGCCTAGACAGGGAGTGTCGT
CCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCCCTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGG
AATGCCAAACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCATTTTGTCAAGGATGAGAAA
ACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTGGAAGCAGCCAAAGCACTGGATGACAAGAACTGCTGGGAAAAG
CTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATGTGCTATCAGCGTACCAAAAACTTTGACAAACTTTCCTTCCTG
TATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATTGCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCC
CTATACCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTCACAGCTGCTACCCATGGC
TTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAGGAGACAATCCCAGACATTGACCCTAATGCCAAGCTGCTCCAG
CCACCTGCACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGCACCATTGCCAGCAAAGGG
AAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACAGAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATGAAGAT
GGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGAGGTGGCTGGGATGTAGAAGAAGATCTG
GAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCTGAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCA
ACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATGCGGCTCCTTCATGACCAA
GTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACATACGCCCGAGGCCGCACAACCTATCAGGCTCTGCCCTGCCTA
CCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATGGTGTACCAGCTGTGGGCCTGAAGCTTAATGACCTC
ATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTTGAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTG
CCACTTCTTGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTACATTGTGGGTTTGTCCGTG
GAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAGCGCATCTGTGAGATGGCAGCCTATTTCACCCACTCAAACCTG
CAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTCTTCAAGCTCAAGAACTTCAAGACAGCTGCCACCTTTGCTCGG
CGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGAAAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTAC
CAGCTCAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAGCCAGTAGAAAAGTGTCCA
CTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGGGTCACCACAGTGACAGAGATTGGCAAAGATGTGATTGGTTTA

>In-frame_SMYD3_ENST00000388985_chr1_245927343_-_COPA_ENST00000368069_chr1_160305112_-_4659nt
ATGGAGCCGCTGAAGGTGGAAAAGTTCGCAACCGCCAAGAGGGGAAACGGGCTGCGCGCCGTGACCCCGCTGCGCCCCGGAGAGCTACTC
TTCCGCTCGGATCCCTTGGCGTACACGGTGTGCAAGGGGAGTCGTGGCGTCGTCTGCGACCGCTGCCTTCTCGGGAAGGAAAAGCTGATG
CGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGAAAAAAGCTTGGCCAGACCACAAGCGGGAATGCAAATGCCTT
AAAAGCTGCAAACCCAGATATCCTCCAGACTCCGTTCGACTTCTTGGCAGAGTTGTCTTCAAACTTATGGATGGAGCACCTTCAGAATCA
GAGAAGCTTTACTCATTTTATGATCTGGAGTCAAATATTAACAAACTGACTGAAGATAAGAAAGAGGGCCTCAGGCAACTCGTAATGACA
TTTCAACATTTCATGAGAGAAGAAATACAGGATGCCTCTCAGCTGCCACCTGCCTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGC
AACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCC
AACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTG
GATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGAC
AAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGG
AAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTG
CTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATT
TTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATG
AAGAATCTGAGACTGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTT
CATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTA
ACAGGGCACAACCATTATGTGATGTGTGCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTT
TGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGA
ACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTA
TCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAAT
GTATCTTGTGCCGTCTTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGG
ACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGAT
GGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTA
CGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAAT
CCAGCAGAAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGAC
TCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGG
ATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACA
GGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTG
AAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGAACACTCATGCCCTTTGCCTCTTACAGCCATTGTG
ATCTGTAACCGCAAACTGGATGCTTTATGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATC
TATACCACAAGCAACCACATCAAATATGCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGG
GTGAAGGGCAACAATGTATACTGCCTAGACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCC
CTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGGAATGCCAAACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAG
GGCTATCCTGAAGTGGCACTGCATTTTGTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTG
GAAGCAGCCAAAGCACTGGATGACAAGAACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATG
TGCTATCAGCGTACCAAAAACTTTGACAAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATT
GCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCCCTATACCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGT
GGACAGAAGTCCCTGGCCTATCTCACAGCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAG
GAGACAATCCCAGACATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACT
GTATCCAAAGGATTTTTTGAAGGCACCATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACA
GAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATGAAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAG
GGACAGGAAGAAGGAGGTGGCTGGGATGTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCT
GAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTG
GCAGGCTCTTTCGAAACAGCCATGCGGCTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACA
TACGCCCGAGGCCGCACAACCTATCAGGCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTG
AAGAATGGTGTACCAGCTGTGGGCCTGAAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTT
GAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCTTGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAG
CTCATCACCATTTGCCGTGAGTACATTGTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAG
CGCATCTGTGAGATGGCAGCCTATTTCACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTC
TTCAAGCTCAAGAACTTCAAGACAGCTGCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGA
AAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTACCAGCTCAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCA
TATCGGCCCATCTACCGTGGAAAGCCAGTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGG

>In-frame_SMYD3_ENST00000388985_chr1_245927343_-_COPA_ENST00000241704_chr1_160305112_-_4632nt
ATGGAGCCGCTGAAGGTGGAAAAGTTCGCAACCGCCAAGAGGGGAAACGGGCTGCGCGCCGTGACCCCGCTGCGCCCCGGAGAGCTACTC
TTCCGCTCGGATCCCTTGGCGTACACGGTGTGCAAGGGGAGTCGTGGCGTCGTCTGCGACCGCTGCCTTCTCGGGAAGGAAAAGCTGATG
CGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGAAAAAAGCTTGGCCAGACCACAAGCGGGAATGCAAATGCCTT
AAAAGCTGCAAACCCAGATATCCTCCAGACTCCGTTCGACTTCTTGGCAGAGTTGTCTTCAAACTTATGGATGGAGCACCTTCAGAATCA
GAGAAGCTTTACTCATTTTATGATCTGGAGTCAAATATTAACAAACTGACTGAAGATAAGAAAGAGGGCCTCAGGCAACTCGTAATGACA
TTTCAACATTTCATGAGAGAAGAAATACAGGATGCCTCTCAGCTGCCACCTGCCTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGC
AACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCC
AACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTG
GATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGAC
AAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGG
AAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTG
CTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATT
TTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATG
AAGAATCTGAGACTGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTT
CATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTA
ACAGGGCACAACCATTATGTGATGTGTGCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTT
TGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGA
ACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTA
TCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAAT
GTATCTTGTGCCGTCTTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGG
ACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGAT
GGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTA
CGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAAT
CCAGCAGAAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGAC
TCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGG
ATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACA
GGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTG
AAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGCCATTGTGATCTGTAACCGCAAACTGGATGCTTTA
TGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATCTATACCACAAGCAACCACATCAAATAT
GCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGGGCAACAATGTATACTGCCTA
GACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCCCTGATCAACAGAAAATATGATGAGGTA
CTGCACATGGTGAGGAATGCCAAACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCATTTT
GTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTGGAAGCAGCCAAAGCACTGGATGACAAG
AACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATGTGCTATCAGCGTACCAAAAACTTTGAC
AAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATTGCTGAGATCAGAAAGGACATGAGTGGC
CACTATCAGAATGCCCTATACCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTCACA
GCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAGGAGACAATCCCAGACATTGACCCTAAT
GCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGCACC
ATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACAGAGGGCTGGGGAGAGGATGCAGAGCTG
CAGTTGGATGAAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGAGGTGGCTGGGAT
GTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCTGAAGATGGTTTCTTTGTGCCCCCAACC
AAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATGCGG
CTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACATACGCCCGAGGCCGCACAACCTATCAG
GCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATGGTGTACCAGCTGTGGGCCTG
AAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTTGAGGAGGCTGTGGAAAAATTCCGTTCC
ATCCTTCTCAGTGTGCCACTTCTTGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTACATT
GTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAGCGCATCTGTGAGATGGCAGCCTATTTC
ACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTCTTCAAGCTCAAGAACTTCAAGACAGCT
GCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGAAAAATCCTGTCTGCCTGTGAGAAGAAT
CCCACAGATGCCTACCAGCTCAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAGCCA
GTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGGGTCACCACAGTGACAGAGATTGGCAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMYD3_ENST00000490107_chr1_245927343_-_COPA_ENST00000368069_chr1_160305112_-_5583nt
GGACGCGGGTAGCCGTCTGAGGTGCCGGAGCTGCGGGAGGATGGAGCCGCTGAAGGTGGAAAAGTTCGCAACCGCCAAGAGGGGAAACGG
GCTGCGCGCCGTGACCCCGCTGCGCCCCGGAGAGCTACTCTTCCGCTCGGATCCCTTGGCGTACACGGTGTGCAAGGGGAGTCGTGGCGT
CGTCTGCGACCGCTGCCTTCTCGGGAAGGAAAAGCTGATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGAA
AAAAGCTTGGCCAGACCACAAGCGGGAATGCAAATGCCTTAAAAGCTGCAAACCCAGATATCCTCCAGACTCCGTTCGACTTCTTGGCAG
AGTTGTCTTCAAACTTATGGATGGAGCACCTTCAGAATCAGAGAAGCTTTACTCATTTTATGATCTGGAGTCAAATATTAACAAACTGAC
TGAAGATAAGAAAGAGGGCCTCAGGCAACTCGTAATGACATTTCAACATTTCATGAGAGAAGAAATACAGGATGCCTCTCAGCTGCCACC
TGCCTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCT
ATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCG
AGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTA
CTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCA
AGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTC
TGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGC
CTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGG
CAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCAC
ATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTTCATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCG
AGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTAACAGGGCACAACCATTATGTGATGTGTGCTCAGTTCCACCCCACAGAAGA
CTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTTTGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGA
ATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGAACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGT
AAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTATCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAA
GGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAATGTATCTTGTGCCGTCTTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTC
TGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGGACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGC
TGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGATGGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGT
TCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTACGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCG
GAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAATCCAGCAGAAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAA
TAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGACTCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGC
CGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGGATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGATCACCAAAAAGGT
ACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACAGGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACA
GCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTGAAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAA
ACACGAACACTCATGCCCTTTGCCTCTTACAGCCATTGTGATCTGTAACCGCAAACTGGATGCTTTATGTAACATTCATGAGAACATTCG
TGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATCTATACCACAAGCAACCACATCAAATATGCTGTCACCACTGGGGACCACGG
GATCATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGGGCAACAATGTATACTGCCTAGACAGGGAGTGTCGTCCCCGGGT
ACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCCCTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGGAATGCCAA
ACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCATTTTGTCAAGGATGAGAAAACTCGCTT
TAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTGGAAGCAGCCAAAGCACTGGATGACAAGAACTGCTGGGAAAAGCTGGGAGA
AGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATGTGCTATCAGCGTACCAAAAACTTTGACAAACTTTCCTTCCTGTATCTTAT
CACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATTGCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCCCTATACCT
GGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTCACAGCTGCTACCCATGGCTTAGATGA
AGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAGGAGACAATCCCAGACATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGC
ACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGCACCATTGCCAGCAAAGGGAAGGGAGG
AGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACAGAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATGAAGATGGGTTTGT
GGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGAGGTGGCTGGGATGTAGAAGAAGATCTGGAGCTCCC
TCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCTGAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCAACTCAGAT
CTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATGCGGCTCCTTCATGACCAAGTAGGGGT
AATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACATACGCCCGAGGCCGCACAACCTATCAGGCTCTGCCCTGCCTACCCTCCAT
GTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATGGTGTACCAGCTGTGGGCCTGAAGCTTAATGACCTCATCCAACG
GTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTTGAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCT
TGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTACATTGTGGGTTTGTCCGTGGAGACAGA
AAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAGCGCATCTGTGAGATGGCAGCCTATTTCACCCACTCAAACCTGCAGCCTGT
GCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTCTTCAAGCTCAAGAACTTCAAGACAGCTGCCACCTTTGCTCGGCGCCTACT
AGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGAAAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTACCAGCTCAA
TTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAGCCAGTAGAAAAGTGTCCACTCAGTGG
GGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGGGTCACCACAGTGACAGAGATTGGCAAAGATGTGATTGGTTTAAGGATCAG
TCCTCTGCAGTTTCGCTAAGGCCCCCTTTGTGTGCATGGGTCAGTCACCATATGTTCCCCCCAGAGAATGTGTCTATATCCTCCTTCTAA
CAGCACCTTCCCCCTGCAGCTACTCTTCAGATCTGGCTCTCTGTACCCTAAAACCTAGTATCTTTTTCTCTTCTATGGAAAATCCGAAGG
TCTAAACTTGACTTTTTTGAGGTCTTCTCAACTTGACTACAGTTGTGCTCATAATTGTCCTTGCCTTTCCAGCTTAATTATTTTAAGGAA
CAAATGAAAACTCTGGGCTGGGTGGAGTGGCTCATACCTGTAATCCCAGCACTTTGGGAGGCTACGGTGGGCAGATCATCTGAGGCCAGG
AGTTCGAGACCTGCCTGGCCAACATGGCAACACCCCGTCTCTAATAAAAATATAAAAATTAGCCTGGCATGGTAGCATGCGCCTATAGTC
CCAGCTGCTCAGGAGGCTGAGGCATGAGAATCGCTTGAACCTAGGAGGTGGAGGTTGCATTCAACTGAGATCATACCACTTCATTCCAGC
CTGGGTGACAGAGCAAGACTCTGTCTCAAAAAAAAAAAAAAGGAAAACTCTGTGATGGACATTTGTTTAGTAAATCCCTTCAGTATTTAT
CCCTCCTTTCCCCACAGCAGCTTTCTTTCCTGTCAACTAGAAAGGAGCAGGATGTAATAAATACATTTTGGTGTGACTAGGCCACACCAA
CTCTTAATCATCTCCCATTTTCCTTAGACATTTAAATTTCAAGGCAGGTACCCTCTGTGTACTCAGAAATTTGAAGAAGTTATTTGGTTT
TCCAAAATGCACACTGCGGGTTATTGATTTGTTCTTTACAACTATTGTTCTCATATTTCTCACACTAAATAAATCTCTATGAGAGCTTCT

>In-frame_SMYD3_ENST00000490107_chr1_245927343_-_COPA_ENST00000241704_chr1_160305112_-_5556nt
GGACGCGGGTAGCCGTCTGAGGTGCCGGAGCTGCGGGAGGATGGAGCCGCTGAAGGTGGAAAAGTTCGCAACCGCCAAGAGGGGAAACGG
GCTGCGCGCCGTGACCCCGCTGCGCCCCGGAGAGCTACTCTTCCGCTCGGATCCCTTGGCGTACACGGTGTGCAAGGGGAGTCGTGGCGT
CGTCTGCGACCGCTGCCTTCTCGGGAAGGAAAAGCTGATGCGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGAA
AAAAGCTTGGCCAGACCACAAGCGGGAATGCAAATGCCTTAAAAGCTGCAAACCCAGATATCCTCCAGACTCCGTTCGACTTCTTGGCAG
AGTTGTCTTCAAACTTATGGATGGAGCACCTTCAGAATCAGAGAAGCTTTACTCATTTTATGATCTGGAGTCAAATATTAACAAACTGAC
TGAAGATAAGAAAGAGGGCCTCAGGCAACTCGTAATGACATTTCAACATTTCATGAGAGAAGAAATACAGGATGCCTCTCAGCTGCCACC
TGCCTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCT
ATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCG
AGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTA
CTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCA
AGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTC
TGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGC
CTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGG
CAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCAC
ATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTTCATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCG
AGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTAACAGGGCACAACCATTATGTGATGTGTGCTCAGTTCCACCCCACAGAAGA
CTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTTTGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGA
ATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGAACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGT
AAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTATCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAA
GGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAATGTATCTTGTGCCGTCTTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTC
TGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGGACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGC
TGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGATGGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGT
TCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTACGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCG
GAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAATCCAGCAGAAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAA
TAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGACTCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGC
CGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGGATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGATCACCAAAAAGGT
ACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACAGGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACA
GCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTGAAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAA
ACACGCCATTGTGATCTGTAACCGCAAACTGGATGCTTTATGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAG
TGGGGTATTTATCTATACCACAAGCAACCACATCAAATATGCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCAT
CTATGTCACACGGGTGAAGGGCAACAATGTATACTGCCTAGACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAA
ATTCAAGCTGGCCCTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGGAATGCCAAACTAGTTGGCCAGTCTATTATTGCTTA
TCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCATTTTGTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACAT
TGAGATTGCTCTGGAAGCAGCCAAAGCACTGGATGACAAGAACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCA
GATTGTGGAAATGTGCTATCAGCGTACCAAAAACTTTGACAAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAA
GATGATGAAGATTGCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCCCTATACCTGGGTGATGTGTCAGAGCGTGTGCGGAT
CCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTCACAGCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATT
TGACCCAGAGAAGGAGACAATCCCAGACATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTG
GCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGCACCATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGA
CACTGTTGGTACAGAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATGAAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGA
TGCTCTTGGCAAGGGACAGGAAGAAGGAGGTGGCTGGGATGTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGC
AGCTGGTGGGGCTGAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGT
TGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATGCGGCTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACT
GTTCCTACAGACATACGCCCGAGGCCGCACAACCTATCAGGCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAA
GGATGCAGGGCTGAAGAATGGTGTACCAGCTGTGGGCCTGAAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCAC
AGTTGGCAAATTTGAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCTTGTTGTGGACAATAAACAAGAGATTGC
AGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTACATTGTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCT
AGAACAGCAGAAGCGCATCTGTGAGATGGCAGCCTATTTCACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGC
CCTCAATCTGTTCTTCAAGCTCAAGAACTTCAAGACAGCTGCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGC
CCAACAGACCCGAAAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTACCAGCTCAATTATGACATGCACAACCCCTTTGACAT
TTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAGCCAGTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGG
TCAAATCTGCAGGGTCACCACAGTGACAGAGATTGGCAAAGATGTGATTGGTTTAAGGATCAGTCCTCTGCAGTTTCGCTAAGGCCCCCT
TTGTGTGCATGGGTCAGTCACCATATGTTCCCCCCAGAGAATGTGTCTATATCCTCCTTCTAACAGCACCTTCCCCCTGCAGCTACTCTT
CAGATCTGGCTCTCTGTACCCTAAAACCTAGTATCTTTTTCTCTTCTATGGAAAATCCGAAGGTCTAAACTTGACTTTTTTGAGGTCTTC
TCAACTTGACTACAGTTGTGCTCATAATTGTCCTTGCCTTTCCAGCTTAATTATTTTAAGGAACAAATGAAAACTCTGGGCTGGGTGGAG
TGGCTCATACCTGTAATCCCAGCACTTTGGGAGGCTACGGTGGGCAGATCATCTGAGGCCAGGAGTTCGAGACCTGCCTGGCCAACATGG
CAACACCCCGTCTCTAATAAAAATATAAAAATTAGCCTGGCATGGTAGCATGCGCCTATAGTCCCAGCTGCTCAGGAGGCTGAGGCATGA
GAATCGCTTGAACCTAGGAGGTGGAGGTTGCATTCAACTGAGATCATACCACTTCATTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTC
AAAAAAAAAAAAAAGGAAAACTCTGTGATGGACATTTGTTTAGTAAATCCCTTCAGTATTTATCCCTCCTTTCCCCACAGCAGCTTTCTT
TCCTGTCAACTAGAAAGGAGCAGGATGTAATAAATACATTTTGGTGTGACTAGGCCACACCAACTCTTAATCATCTCCCATTTTCCTTAG
ACATTTAAATTTCAAGGCAGGTACCCTCTGTGTACTCAGAAATTTGAAGAAGTTATTTGGTTTTCCAAAATGCACACTGCGGGTTATTGA

>In-frame_SMYD3_ENST00000388985_chr1_245927343_-_COPA_ENST00000368069_chr1_160305112_-_5543nt
ATGGAGCCGCTGAAGGTGGAAAAGTTCGCAACCGCCAAGAGGGGAAACGGGCTGCGCGCCGTGACCCCGCTGCGCCCCGGAGAGCTACTC
TTCCGCTCGGATCCCTTGGCGTACACGGTGTGCAAGGGGAGTCGTGGCGTCGTCTGCGACCGCTGCCTTCTCGGGAAGGAAAAGCTGATG
CGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGAAAAAAGCTTGGCCAGACCACAAGCGGGAATGCAAATGCCTT
AAAAGCTGCAAACCCAGATATCCTCCAGACTCCGTTCGACTTCTTGGCAGAGTTGTCTTCAAACTTATGGATGGAGCACCTTCAGAATCA
GAGAAGCTTTACTCATTTTATGATCTGGAGTCAAATATTAACAAACTGACTGAAGATAAGAAAGAGGGCCTCAGGCAACTCGTAATGACA
TTTCAACATTTCATGAGAGAAGAAATACAGGATGCCTCTCAGCTGCCACCTGCCTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGC
AACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCC
AACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTG
GATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGAC
AAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGG
AAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTG
CTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATT
TTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATG
AAGAATCTGAGACTGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTT
CATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTA
ACAGGGCACAACCATTATGTGATGTGTGCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTT
TGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGA
ACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTA
TCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAAT
GTATCTTGTGCCGTCTTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGG
ACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGAT
GGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTA
CGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAAT
CCAGCAGAAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGAC
TCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGG
ATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACA
GGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTG
AAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGAACACTCATGCCCTTTGCCTCTTACAGCCATTGTG
ATCTGTAACCGCAAACTGGATGCTTTATGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATC
TATACCACAAGCAACCACATCAAATATGCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGG
GTGAAGGGCAACAATGTATACTGCCTAGACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCC
CTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGGAATGCCAAACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAG
GGCTATCCTGAAGTGGCACTGCATTTTGTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTG
GAAGCAGCCAAAGCACTGGATGACAAGAACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATG
TGCTATCAGCGTACCAAAAACTTTGACAAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATT
GCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCCCTATACCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGT
GGACAGAAGTCCCTGGCCTATCTCACAGCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAG
GAGACAATCCCAGACATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACT
GTATCCAAAGGATTTTTTGAAGGCACCATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACA
GAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATGAAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAG
GGACAGGAAGAAGGAGGTGGCTGGGATGTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCT
GAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTG
GCAGGCTCTTTCGAAACAGCCATGCGGCTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACA
TACGCCCGAGGCCGCACAACCTATCAGGCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTG
AAGAATGGTGTACCAGCTGTGGGCCTGAAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTT
GAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCTTGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAG
CTCATCACCATTTGCCGTGAGTACATTGTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAG
CGCATCTGTGAGATGGCAGCCTATTTCACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTC
TTCAAGCTCAAGAACTTCAAGACAGCTGCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGA
AAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTACCAGCTCAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCA
TATCGGCCCATCTACCGTGGAAAGCCAGTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGG
GTCACCACAGTGACAGAGATTGGCAAAGATGTGATTGGTTTAAGGATCAGTCCTCTGCAGTTTCGCTAAGGCCCCCTTTGTGTGCATGGG
TCAGTCACCATATGTTCCCCCCAGAGAATGTGTCTATATCCTCCTTCTAACAGCACCTTCCCCCTGCAGCTACTCTTCAGATCTGGCTCT
CTGTACCCTAAAACCTAGTATCTTTTTCTCTTCTATGGAAAATCCGAAGGTCTAAACTTGACTTTTTTGAGGTCTTCTCAACTTGACTAC
AGTTGTGCTCATAATTGTCCTTGCCTTTCCAGCTTAATTATTTTAAGGAACAAATGAAAACTCTGGGCTGGGTGGAGTGGCTCATACCTG
TAATCCCAGCACTTTGGGAGGCTACGGTGGGCAGATCATCTGAGGCCAGGAGTTCGAGACCTGCCTGGCCAACATGGCAACACCCCGTCT
CTAATAAAAATATAAAAATTAGCCTGGCATGGTAGCATGCGCCTATAGTCCCAGCTGCTCAGGAGGCTGAGGCATGAGAATCGCTTGAAC
CTAGGAGGTGGAGGTTGCATTCAACTGAGATCATACCACTTCATTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTCAAAAAAAAAAAAA
AGGAAAACTCTGTGATGGACATTTGTTTAGTAAATCCCTTCAGTATTTATCCCTCCTTTCCCCACAGCAGCTTTCTTTCCTGTCAACTAG
AAAGGAGCAGGATGTAATAAATACATTTTGGTGTGACTAGGCCACACCAACTCTTAATCATCTCCCATTTTCCTTAGACATTTAAATTTC
AAGGCAGGTACCCTCTGTGTACTCAGAAATTTGAAGAAGTTATTTGGTTTTCCAAAATGCACACTGCGGGTTATTGATTTGTTCTTTACA

>In-frame_SMYD3_ENST00000388985_chr1_245927343_-_COPA_ENST00000241704_chr1_160305112_-_5516nt
ATGGAGCCGCTGAAGGTGGAAAAGTTCGCAACCGCCAAGAGGGGAAACGGGCTGCGCGCCGTGACCCCGCTGCGCCCCGGAGAGCTACTC
TTCCGCTCGGATCCCTTGGCGTACACGGTGTGCAAGGGGAGTCGTGGCGTCGTCTGCGACCGCTGCCTTCTCGGGAAGGAAAAGCTGATG
CGATGCTCTCAGTGCCGCGTCGCCAAATACTGTAGTGCTAAGTGTCAGAAAAAAGCTTGGCCAGACCACAAGCGGGAATGCAAATGCCTT
AAAAGCTGCAAACCCAGATATCCTCCAGACTCCGTTCGACTTCTTGGCAGAGTTGTCTTCAAACTTATGGATGGAGCACCTTCAGAATCA
GAGAAGCTTTACTCATTTTATGATCTGGAGTCAAATATTAACAAACTGACTGAAGATAAGAAAGAGGGCCTCAGGCAACTCGTAATGACA
TTTCAACATTTCATGAGAGAAGAAATACAGGATGCCTCTCAGCTGCCACCTGCCTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGC
AACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCC
AACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTG
GATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGAC
AAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGG
AAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTG
CTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATT
TTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATG
AAGAATCTGAGACTGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTTTTT
CATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGGAACTGGCAATCTAGAACCTGTGTTTGTGTGTTA
ACAGGGCACAACCATTATGTGATGTGTGCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTT
TGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGTTGATCTATTTGGA
ACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATTGTA
TCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAAT
GTATCTTGTGCCGTCTTCCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAGCGG
ACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTAACCTCTTTGCAGCAGGCCATGAT
GGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTA
CGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAAT
CCAGCAGAAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCTGAC
TCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGGGTCGCTCGAAATCGGTTTGCTGTCCTAGATCGG
ATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACA
GGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAAGTG
AAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGCCATTGTGATCTGTAACCGCAAACTGGATGCTTTA
TGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATCTATACCACAAGCAACCACATCAAATAT
GCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGGGCAACAATGTATACTGCCTA
GACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAGCTGGCCCTGATCAACAGAAAATATGATGAGGTA
CTGCACATGGTGAGGAATGCCAAACTAGTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCATTTT
GTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTGGAAGCAGCCAAAGCACTGGATGACAAG
AACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATGTGCTATCAGCGTACCAAAAACTTTGAC
AAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATGAAGATTGCTGAGATCAGAAAGGACATGAGTGGC
CACTATCAGAATGCCCTATACCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTCACA
GCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAGGAGACAATCCCAGACATTGACCCTAAT
GCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTGGCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGCACC
ATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTTGGTACAGAGGGCTGGGGAGAGGATGCAGAGCTG
CAGTTGGATGAAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGAGGTGGCTGGGAT
GTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGGGCTGAAGATGGTTTCTTTGTGCCCCCAACC
AAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTCAGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATGCGG
CTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACATACGCCCGAGGCCGCACAACCTATCAG
GCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATGGTGTACCAGCTGTGGGCCTG
AAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGCAAATTTGAGGAGGCTGTGGAAAAATTCCGTTCC
ATCCTTCTCAGTGTGCCACTTCTTGTTGTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTACATT
GTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAGCGCATCTGTGAGATGGCAGCCTATTTC
ACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTCTTCAAGCTCAAGAACTTCAAGACAGCT
GCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAGACCCGAAAAATCCTGTCTGCCTGTGAGAAGAAT
CCCACAGATGCCTACCAGCTCAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAGCCA
GTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGGGTCACCACAGTGACAGAGATTGGCAAA
GATGTGATTGGTTTAAGGATCAGTCCTCTGCAGTTTCGCTAAGGCCCCCTTTGTGTGCATGGGTCAGTCACCATATGTTCCCCCCAGAGA
ATGTGTCTATATCCTCCTTCTAACAGCACCTTCCCCCTGCAGCTACTCTTCAGATCTGGCTCTCTGTACCCTAAAACCTAGTATCTTTTT
CTCTTCTATGGAAAATCCGAAGGTCTAAACTTGACTTTTTTGAGGTCTTCTCAACTTGACTACAGTTGTGCTCATAATTGTCCTTGCCTT
TCCAGCTTAATTATTTTAAGGAACAAATGAAAACTCTGGGCTGGGTGGAGTGGCTCATACCTGTAATCCCAGCACTTTGGGAGGCTACGG
TGGGCAGATCATCTGAGGCCAGGAGTTCGAGACCTGCCTGGCCAACATGGCAACACCCCGTCTCTAATAAAAATATAAAAATTAGCCTGG
CATGGTAGCATGCGCCTATAGTCCCAGCTGCTCAGGAGGCTGAGGCATGAGAATCGCTTGAACCTAGGAGGTGGAGGTTGCATTCAACTG
AGATCATACCACTTCATTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTCAAAAAAAAAAAAAAGGAAAACTCTGTGATGGACATTTGTT
TAGTAAATCCCTTCAGTATTTATCCCTCCTTTCCCCACAGCAGCTTTCTTTCCTGTCAACTAGAAAGGAGCAGGATGTAATAAATACATT
TTGGTGTGACTAGGCCACACCAACTCTTAATCATCTCCCATTTTCCTTAGACATTTAAATTTCAAGGCAGGTACCCTCTGTGTACTCAGA
AATTTGAAGAAGTTATTTGGTTTTCCAAAATGCACACTGCGGGTTATTGATTTGTTCTTTACAACTATTGTTCTCATATTTCTCACACTA


Top

FusionGenePPI for SMYD3_COPA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMYD3MEST, HELZ, POLR2A, HSP90AA1, HIST3H3, ESR1, EZH2, EED, APP, CAMK2B, NDUFAB1, NFYB, CYP39A1, VANGL1, H3F3C, TRIT1, ZNF557, CDC37, HSP90AB1, HSP90AB4P, HSP90AB3P, HSP90AA5P, MAGED4B, KDM3B, RCAN3, PLCB3, TRMT2A, KMT2ECOPASLC25A11, COPE, COPB2, COPB1, ARFGAP1, PDGFRB, BET1L, USP49, ATG101, DDA1, SPG20, SIRT7, FBXO25, CDK2, SACM1L, SMN1, GEMIN2, DDX20, TMED10, COPG1, COPA, ARCN1, COPZ1, COPG2, FBXO6, UBXN6, LMAN1, SEC24C, SEC23A, SEPT9, VCAM1, ITGA4, CCT3, SEPT2, DHX38, TCP1, RPA3, RPA2, RPA1, NUDCD1, STAU1, SHMT2, MOV10, NXF1, CUL7, OBSL1, CCDC8, SUZ12, RNF2, EGFR, UNK, CCDC97, GCN1L1, KHDRBS1, SF3B1, SRSF3, TRIP10, SF3B3, NTRK1, HERC2, OFD1, MKS1, CEP128, NPHP1, TMEM237, TMEM17, XPO1, SORT1, XRCC3, MATR3, DSN1, FOXB1, WBP1, CD8A, CRY2, FOXL1, FOXQ1, FOXR1, SNW1, CDC5L, RNF126, POU5F1, FAM210A, ZNF746, PPM1G, WBP2, MTNR1B, DLD, PDHA1, SDHA, SOD1, EDEM3, BRCA1, YAP1, TES, MTF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMYD3_COPA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SMYD3_COPA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSMYD3C0236733Amphetamine-Related Disorders1CTD_human
TgeneCOPAC0003864Arthritis1CTD_human
TgeneCOPAC0004364Autoimmune Diseases1CTD_human
TgeneCOPAC0206062Lung Diseases, Interstitial1CTD_human
TgeneCOPAC4225334AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE1ORPHANET;UNIPROT