FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34816

FusionGeneSummary for SMARCB1_SNW1

check button Fusion gene summary
Fusion gene informationFusion gene name: SMARCB1_SNW1
Fusion gene ID: 34816
HgeneTgene
Gene symbol

SMARCB1

SNW1

Gene ID

6598

22938

Gene nameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1SNW domain containing 1
SynonymsBAF47|CSS3|INI1|MRD15|PPP1R144|RDT|RTPS1|SNF5|SNF5L1|SWNTS1|Sfh1p|Snr1|hSNFSBx42|FUN20|NCOA-62|PRPF45|Prp45|SKIIP|SKIP|SKIP1
Cytomap

22q11.23|22q11

14q24.3

Type of geneprotein-codingprotein-coding
DescriptionSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1BRG1-associated factor 47SNF5 homologSWI/SNF-related matrix-associated proteinhSNF5integrase interactor 1 proteinmalignant rhabdoid tumor suppressorproteinSNW domain-containing protein 1SKI interacting proteinhomolog of Drosophila BX42nuclear protein SkiPnuclear receptor coactivator NCoA-62nuclear receptor coactivator, 62-kDski-interacting protein
Modification date2018052320180519
UniProtAcc

Q12824

Q13573

Ensembl transtripts involved in fusion geneENST00000344921, ENST00000263121, 
ENST00000407422, ENST00000407082, 
ENST00000477836, 
ENST00000261531, 
ENST00000554775, ENST00000555761, 
Fusion gene scores* DoF score7 X 11 X 4=30815 X 4 X 12=720
# samples 1816
** MAII scorelog2(18/308*10)=-0.774933444365227
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/720*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SMARCB1 [Title/Abstract] AND SNW1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSMARCB1

GO:0006337

nucleosome disassembly

8895581

HgeneSMARCB1

GO:0006338

chromatin remodeling

11726552

HgeneSMARCB1

GO:0039692

single stranded viral RNA replication via double stranded DNA intermediate

14963118

HgeneSMARCB1

GO:0045944

positive regulation of transcription by RNA polymerase II

11950834

HgeneSMARCB1

GO:0051091

positive regulation of DNA binding transcription factor activity

11950834

HgeneSMARCB1

GO:1902661

positive regulation of glucose mediated signaling pathway

22368283

TgeneSNW1

GO:0000122

negative regulation of transcription by RNA polymerase II

14985122

TgeneSNW1

GO:0000398

mRNA splicing, via spliceosome

15194481|28076346

TgeneSNW1

GO:0030511

positive regulation of transforming growth factor beta receptor signaling pathway

11278756

TgeneSNW1

GO:0043923

positive regulation by host of viral transcription

15905409

TgeneSNW1

GO:0045892

negative regulation of transcription, DNA-templated

10713164|15878163

TgeneSNW1

GO:0045944

positive regulation of transcription by RNA polymerase II

14985122|19934264

TgeneSNW1

GO:0048384

retinoic acid receptor signaling pathway

19934264

TgeneSNW1

GO:0048385

regulation of retinoic acid receptor signaling pathway

14985122

TgeneSNW1

GO:0070562

regulation of vitamin D receptor signaling pathway

14985122

TgeneSNW1

GO:0070564

positive regulation of vitamin D receptor signaling pathway

9632709|11514567

TgeneSNW1

GO:0071300

cellular response to retinoic acid

19934264


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-UY-A9PE-01ASMARCB1chr22

24129449

+SNW1chr14

78201355

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000344921ENST00000261531SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000344921ENST00000554775SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000344921ENST00000555761SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000263121ENST00000261531SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000263121ENST00000554775SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000263121ENST00000555761SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000407422ENST00000261531SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000407422ENST00000554775SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000407422ENST00000555761SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000407082ENST00000261531SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000407082ENST00000554775SMARCB1chr22

24129449

+SNW1chr14

78201355

-
In-frameENST00000407082ENST00000555761SMARCB1chr22

24129449

+SNW1chr14

78201355

-
intron-3CDSENST00000477836ENST00000261531SMARCB1chr22

24129449

+SNW1chr14

78201355

-
intron-3CDSENST00000477836ENST00000554775SMARCB1chr22

24129449

+SNW1chr14

78201355

-
intron-3CDSENST00000477836ENST00000555761SMARCB1chr22

24129449

+SNW1chr14

78201355

-

Top

FusionProtFeatures for SMARCB1_SNW1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMARCB1

Q12824

SNW1

Q13573

Core component of the BAF (hSWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles incell proliferation and differentiation, in cellular antiviralactivities and inhibition of tumor formation. The BAF complex isable to create a stable, altered form of chromatin that constrainsfewer negative supercoils than normal. This change in supercoilingwould be due to the conversion of up to one-half of thenucleosomes on polynucleosomal arrays into asymmetric structures,termed altosomes, each composed of 2 histones octamers. Stimulatesin vitro the remodeling activity of SMARCA4/BRG1/BAF190A. Involvedin activation of CSF1 promoter. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and theneuron-specific chromatin remodeling complex (nBAF complex).During neural development a switch from a stem/progenitor to apostmitotic chromatin remodeling mechanism occurs as neurons exitthe cell cycle and become committed to their adult state. Thetransition from proliferating neural stem/progenitor cells topostmitotic neurons requires a switch in subunit composition ofthe npBAF and nBAF complexes. As neural progenitors exit mitosisand differentiate into neurons, npBAF complexes which containACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologousalternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunitsin neuron-specific complexes (nBAF). The npBAF complex isessential for the self-renewal/proliferative capacity of themultipotent neural stem cells. The nBAF complex along with CRESTplays a role regulating the activity of genes essential fordendrite growth (By similarity). Plays a key role in cell-cyclecontrol and causes cell cycle arrest in G0/G1.{ECO:0000250|UniProtKB:Q9Z0H3, ECO:0000269|PubMed:10078207,ECO:0000269|PubMed:12226744, ECO:0000269|PubMed:14604992,ECO:0000269|PubMed:16267391, ECO:0000269|PubMed:16314535,ECO:0000269|PubMed:9448295}. Involved in pre-mRNA splicing as component of thespliceosome (PubMed:11991638, PubMed:28502770, PubMed:28076346).Is required in the specific splicing of CDKN1A pre-mRNA; thefunction probably involves the recruitment of U2AF2 to the mRNA.Is proposed to recruit PPIL1 to the spliceosome. May be involvedin cyclin-D1/CCND1 mRNA stability through the SNARP complex whichassociates with both the 3'end of the CCND1 gene and its mRNA.Involved in transcriptional regulation. Modulates TGF-beta-mediated transcription via association with SMAD proteins, MYOD1-mediated transcription via association with PABPN1, RB1-mediatedtranscriptional repression, and retinoid-X receptor (RXR)- andvitamin D receptor (VDR)-dependent gene transcription in a cellline-specific manner probably involving coactivators NCOA1 andGRIP1. Is involved in NOTCH1-mediated transcriptional activation.Binds to multimerized forms of Notch intracellular domain (NICD)and is proposed to recruit transcriptional coactivators such asMAML1 to form an intermediate preactivation complex whichassociates with DNA-bound CBF-1/RBPJ to form a transcriptionalactivation complex by releasing SNW1 and redundant NOTCH1 NICD.{ECO:0000269|PubMed:10644367, ECO:0000269|PubMed:11278756,ECO:0000269|PubMed:11371506, ECO:0000269|PubMed:11514567,ECO:0000269|PubMed:11991638, ECO:0000269|PubMed:12840015,ECO:0000269|PubMed:14985122, ECO:0000269|PubMed:15194481,ECO:0000269|PubMed:15905409, ECO:0000269|PubMed:18794151,ECO:0000269|PubMed:19818711, ECO:0000269|PubMed:21245387,ECO:0000269|PubMed:21460037, ECO:0000269|PubMed:28076346,ECO:0000269|PubMed:28502770, ECO:0000269|PubMed:9632709}. (Microbial infection) Is recruited by HIV-1 Tat toTat:P-TEFb:TAR RNA complexes and is involved in Tat transcriptionby recruitment of MYC, MEN1 and TRRAP to the HIV promoter.{ECO:0000269|PubMed:15905409, ECO:0000269|PubMed:19818711}. (Microbial infection) Proposed to be involved intranscriptional activation by EBV EBNA2 of CBF-1/RBPJ-repressedpromoters. {ECO:0000269|PubMed:10644367}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000263121+19183_24331386RegionNote=HIV-1 integrase-binding
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000263121+19186_24531386RegionMYC-binding
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000263121+19186_31931386RegionNote=2 X approximate tandem repeats
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000263121+191_11331386RegionDNA-binding
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000407422+19183_24331377RegionNote=HIV-1 integrase-binding
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000407422+19186_24531377RegionMYC-binding
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000407422+19186_31931377RegionNote=2 X approximate tandem repeats
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000407422+191_11331377RegionDNA-binding
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000263121+19259_31931386RepeatNote=2
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000407422+19259_31931377RepeatNote=2
TgeneSNW1chr22:24129449chr14:78201355ENST00000261531-614219_233236537Compositional biasNote=Pro-rich
TgeneSNW1chr22:24129449chr14:78201355ENST00000261531-614174_339236537RegionNote=SNW


Top

FusionGeneSequence for SMARCB1_SNW1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_367aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRCQAI
QLNFSVYTGESKVVHSFFSFSLDLFPTRSFLVQTVDREAEKDQCSLRKILLVWTSFWKKPNSMVALKDPQIAAAPRNTSMKARRGGRNRH

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_367aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRCQAI
QLNFSVYTGESKVVHSFFSFSLDLFPTRSFLVQTVDREAEKDQCSLRKILLVWTSFWKKPNSMVALKDPQIAAAPRNTSMKARRGGRNRH

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_367aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRCQAI
QLNFSVYTGESKVVHSFFSFSLDLFPTRSFLVQTVDREAEKDQCSLRKILLVWTSFWKKPNSMVALKDPQIAAAPRNTSMKARRGGRNRH

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_332aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRFVPD

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_367aa
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEMTVKEQQEWKIPPCISNWKNAKGTTIPLDKRLAADGRGLQTVHINENFAKLAEALYIAD
RKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNEN
RDISEVIALGVPNPRTSNEVQTDQRLFNQSKGMDSGFAGGEDEITNVTDQAWRGGKDMAQSITRPSKNLDKDMTGDDLEARIKTNRCQAI
QLNFSVYTGESKVVHSFFSFSLDLFPTRSFLVQTVDREAEKDQCSLRKILLVWTSFWKKPNSMVALKDPQIAAAPRNTSMKARRGGRNRH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1101nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGGTGCCAAGCCATA
CAACTCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTTCCCGACAAGGAGTTTT
CTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCA
AACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCAC

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1101nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGGTGCCAAGCCATA
CAACTCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTTCCCGACAAGGAGTTTT
CTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCA
AACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCAC

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1101nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGGTGCCAAGCCATA
CAACTCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTTCCCGACAAGGAGTTTT
CTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCA
AACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCAC

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_996nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGAC
AAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTG
GAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAG

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1101nt
ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCC
GAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGAC
AAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGAT
CGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGA
GAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATC
CGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAAT
CGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCC
AAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAG
AGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGGTGCCAAGCCATA
CAACTCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTTCCCGACAAGGAGTTTT
CTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCA
AACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_1692nt
AACGCCAGCGCCTGCGCACTGAGGGCGGCCTGGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGG
CCCGGTCCGCATTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGG
CTCCGGCCGCCCGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGAC
GACGGCGAGTTCTACATGATCGGCTCCGAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAAT
GCAAAGGGTTATACAATTCCATTAGACAAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAA
TTGGCAGAAGCCCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAA
AAGGAAAAACATGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGAT
GGGGAGGCACGTGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAG
AGGTCGAAACTTCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAG
TATGACCAAAGGCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCC
TGGAGAGGTGGTAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGA
ATAAAGACCAACAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAA
GATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACAC
GAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCA
TATGGGGGAACACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGTGCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGG
GGATAGAAAATTCTACTTTGAATTATTTAGTTTTTTTTAAAGAGTGGGTTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACAT
GCTGCCCCACATACAAAGTCAAGACCACTTACTTTTATGTGACACTAGTAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGA
GTAAAGTTACCCCAACCACAGTGAGGAGGAAGATGTTCACATACTGGAACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTT

>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_1663nt
AACGCCAGCGCCTGCGCACTGAGGGCGGCCTGGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGG
CCCGGTCCGCATTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGG
CTCCGGCCGCCCGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGAC
GACGGCGAGTTCTACATGATCGGCTCCGAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAAT
GCAAAGGGTTATACAATTCCATTAGACAAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAA
TTGGCAGAAGCCCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAA
AAGGAAAAACATGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGAT
GGGGAGGCACGTGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAG
AGGTCGAAACTTCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAG
TATGACCAAAGGCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCC
TGGAGAGGTGGTAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGA
ATAAAGACCAACAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAA
GATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACAC
GAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCA
TATGGGGGAACACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGTGCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGG
GGATAGAAAATTCTACTTTGAATTATTTAGTTTTTTTTAAAGAGTGGGTTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACAT
GCTGCCCCACATACAAAGTCAAGACCACTTACTTTTATGTGACACTAGTAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGA
GTAAAGTTACCCCAACCACAGTGAGGAGGAAGATGTTCACATACTGGAACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTT

>In-frame_SMARCB1_ENST00000344921_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1418nt
AACGCCAGCGCCTGCGCACTGAGGGCGGCCTGGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGG
CCCGGTCCGCATTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGG
CTCCGGCCGCCCGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGAC
GACGGCGAGTTCTACATGATCGGCTCCGAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAAT
GCAAAGGGTTATACAATTCCATTAGACAAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAA
TTGGCAGAAGCCCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAA
AAGGAAAAACATGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGAT
GGGGAGGCACGTGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAG
AGGTCGAAACTTCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAG
TATGACCAAAGGCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCC
TGGAGAGGTGGTAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGA
ATAAAGACCAACAGGTGCCAAGCCATACAACTCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCC
TTAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTG
GTTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAG
GCAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAA

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_1681nt
CTGCGCACTGAGGGCGGCCTGGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCA
TTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCC
CGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTT
CTACATGATCGGCTCCGAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTA
TACAATTCCATTAGACAAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGC
CCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACA
TGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACG
TGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACT
TCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAG
GCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGG
TAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAA
CAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGG
TTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGG
CAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAAC
ACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGTGCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGGGGATAGAAAAT
TCTACTTTGAATTATTTAGTTTTTTTTAAAGAGTGGGTTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACATGCTGCCCCACA
TACAAAGTCAAGACCACTTACTTTTATGTGACACTAGTAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGAGTAAAGTTACC
CCAACCACAGTGAGGAGGAAGATGTTCACATACTGGAACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTTTAATTTGGAGT

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_1652nt
CTGCGCACTGAGGGCGGCCTGGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCA
TTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCC
CGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTT
CTACATGATCGGCTCCGAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTA
TACAATTCCATTAGACAAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGC
CCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACA
TGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACG
TGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACT
TCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAG
GCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGG
TAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAA
CAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGG
TTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGG
CAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAAC
ACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGTGCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGGGGATAGAAAAT
TCTACTTTGAATTATTTAGTTTTTTTTAAAGAGTGGGTTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACATGCTGCCCCACA
TACAAAGTCAAGACCACTTACTTTTATGTGACACTAGTAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGAGTAAAGTTACC
CCAACCACAGTGAGGAGGAAGATGTTCACATACTGGAACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTTTAATTTGGAGT

>In-frame_SMARCB1_ENST00000263121_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1407nt
CTGCGCACTGAGGGCGGCCTGGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCA
TTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCC
CGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTT
CTACATGATCGGCTCCGAGATGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTA
TACAATTCCATTAGACAAACGTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGC
CCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACA
TGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACG
TGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACT
TCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAG
GCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGG
TAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAA
CAGGTGCCAAGCCATACAACTCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTT
CCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAG
TTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGG
AGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAA

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_1661nt
GGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCATTTCGCCTTCCGGCTTCGGT
TTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCCCGCCTCTGCCGCCGCAATGA
TGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCCGAGA
TGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGACAAAC
GTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGATCGGA
AGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGAGAAA
TGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATCCGGC
ATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAATCGGG
ATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCCAAGG
GTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAGAGTA
TTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGACAAGG
AGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAG
AAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAAT
AGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAATGGTCAGGAT
AAAAACCAAATCTGGGTGCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGGGGATAGAAAATTCTACTTTGAATTATTTAGT
TTTTTTTAAAGAGTGGGTTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACATGCTGCCCCACATACAAAGTCAAGACCACTTA
CTTTTATGTGACACTAGTAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGAGTAAAGTTACCCCAACCACAGTGAGGAGGAA
GATGTTCACATACTGGAACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTTTAATTTGGAGTGGGCAAAGTAACCTCTTGCT

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_1632nt
GGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCATTTCGCCTTCCGGCTTCGGT
TTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCCCGCCTCTGCCGCCGCAATGA
TGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCCGAGA
TGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGACAAAC
GTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGATCGGA
AGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGAGAAA
TGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATCCGGC
ATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAATCGGG
ATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCCAAGG
GTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAGAGTA
TTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGACAAGG
AGTTTTCTGGTTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAG
AAGCCAAACAGCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAAT
AGGCACAGGTCTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAATGGTCAGGAT
AAAAACCAAATCTGGGTGCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGGGGATAGAAAATTCTACTTTGAATTATTTAGT
TTTTTTTAAAGAGTGGGTTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACATGCTGCCCCACATACAAAGTCAAGACCACTTA
CTTTTATGTGACACTAGTAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGAGTAAAGTTACCCCAACCACAGTGAGGAGGAA
GATGTTCACATACTGGAACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTTTAATTTGGAGTGGGCAAAGTAACCTCTTGCT

>In-frame_SMARCB1_ENST00000407422_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1387nt
GGTCGTCGTCTGCGGCGGCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCATTTCGCCTTCCGGCTTCGGT
TTCCCTCGGCCCAGCACGCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCCCGCCTCTGCCGCCGCAATGA
TGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCCGAGA
TGACTGTAAAGGAACAACAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGACAAAC
GTCTGGCTGCTGATGGAAGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGATCGGA
AGGCTCGTGAAGCTGTGGAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGAGAAA
TGGCCCAGAAAGCCAGGGAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATCCGGC
ATGACAGGCGAAAAGAGAGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAATCGGG
ATATCAGTGAAGTTATTGCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCCAAGG
GTATGGACAGTGGATTTGCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAGAGTA
TTTATAGGCCCAGTAAAAATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGGTGCCAAGCCATACAAC
TCAATTTCAGTGTTTACACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTTCCCGACAAGGAGTTTTCTGG
TTCAGACCGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCAAACA
GCATGGTGGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCACAGGT
CTCTCCAAAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAATGGTCAGGATAAAAACCAAA

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000261531_chr14_78201355_-_1644nt
GCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCATTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCAC
GCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCCCGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGC
AAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCCGAGATGACTGTAAAGGAACAA
CAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGACAAACGTCTGGCTGCTGATGGA
AGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTG
GAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGG
GAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAG
AGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATT
GCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTT
GCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAA
AATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGAC
CGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGT
GGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCA
AAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGT
GCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGGGGATAGAAAATTCTACTTTGAATTATTTAGTTTTTTTTAAAGAGTGGG
TTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACATGCTGCCCCACATACAAAGTCAAGACCACTTACTTTTATGTGACACTAG
TAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGAGTAAAGTTACCCCAACCACAGTGAGGAGGAAGATGTTCACATACTGGA
ACTGTCCTGCCAAATAAATTTTGCCCCTATTGTGCTCTGTTTTAATTTGGAGTGGGCAAAGTAACCTCTTGCTTGGTGCAACTATTTGTT

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000554775_chr14_78201355_-_1615nt
GCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCATTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCAC
GCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCCCGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGC
AAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCCGAGATGACTGTAAAGGAACAA
CAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGACAAACGTCTGGCTGCTGATGGA
AGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTG
GAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGG
GAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAG
AGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATT
GCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTT
GCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAA
AATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGAC
CGTAGACAGAGAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGT
GGCTCTAAAAGACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCA
AAGTGAATGAACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGT
GCCAGATCCCAGCACTACTTTTTATTACTGGAGAAATGGGGGGGATAGAAAATTCTACTTTGAATTATTTAGTTTTTTTTAAAGAGTGGG
TTGTGTTTGTGCTTCTCCCACCTTTCAGCATTTATAGAACATGCTGCCCCACATACAAAGTCAAGACCACTTACTTTTATGTGACACTAG
TAGTTTGGGGTTAATGTTTTGTGTAAGAACAGCTGCATATGAGTAAAGTTACCCCAACCACAGTGAGGAGGAAGATGTTCACATACTGGA

>In-frame_SMARCB1_ENST00000407082_chr22_24129449_+_SNW1_ENST00000555761_chr14_78201355_-_1370nt
GCGGCGGCGGCTGAGGAGCCCGGCTGAGGCGCCAGTACCCGGCCCGGTCCGCATTTCGCCTTCCGGCTTCGGTTTCCCTCGGCCCAGCAC
GCCCCGGCCCCGCCCCAGCCCTCCTGATCCCTCGCAGCCCGGCTCCGGCCGCCCGCCTCTGCCGCCGCAATGATGATGATGGCGCTGAGC
AAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCGAGTTCTACATGATCGGCTCCGAGATGACTGTAAAGGAACAA
CAAGAGTGGAAGATTCCTCCTTGTATTTCTAACTGGAAAAATGCAAAGGGTTATACAATTCCATTAGACAAACGTCTGGCTGCTGATGGA
AGAGGACTACAGACAGTACACATAAATGAAAATTTCGCCAAATTGGCAGAAGCCCTCTACATTGCTGATCGGAAGGCTCGTGAAGCTGTG
GAAATGCGTGCCCAAGTAGAGAGAAAAATGGCTCAGAAAGAAAAGGAAAAACATGAAGAGAAACTTAGAGAAATGGCCCAGAAAGCCAGG
GAGAGAAGAGCTGGGATCAAAACTCATGTGGAAAAAGAGGATGGGGAGGCACGTGAGAGGGATGAAATCCGGCATGACAGGCGAAAAGAG
AGACAGCATGACCGGAATCTTTCCAGGGCAGCTCCTGATAAGAGGTCGAAACTTCAGAGAAATGAAAATCGGGATATCAGTGAAGTTATT
GCTCTCGGTGTTCCTAATCCTCGGACTTCCAATGAAGTTCAGTATGACCAAAGGCTCTTCAACCAATCCAAGGGTATGGACAGTGGATTT
GCAGGTGGAGAAGATGAAATTTATAATGTTTATGATCAAGCCTGGAGAGGTGGTAAAGATATGGCCCAGAGTATTTATAGGCCCAGTAAA
AATCTGGACAAGGACATGTATGGTGATGACCTAGAAGCCAGAATAAAGACCAACAGGTGCCAAGCCATACAACTCAATTTCAGTGTTTAC
ACTGGTGAAAGCAAAGTAGTTCATAGTTTTTTCTCCTTTTCCTTAGATTTGTTCCCGACAAGGAGTTTTCTGGTTCAGACCGTAGACAGA
GAGGCCGAGAAGGACCAGTGCAGTTTGAGGAAGATCCTTTTGGTTTGGACAAGTTTTTGGAAGAAGCCAAACAGCATGGTGGCTCTAAAA
GACCCTCAGATAGCAGCCGCCCCAAGGAACACGAGCATGAAGGCAAGAAGAGGAGGAAGGAATAGGCACAGGTCTCTCCAAAGTGAATGA
ACTCTTACCCATAACCCTAATGATGCAAGTCATATGGGGGAACACTTTGTAAATGGTCAGGATAAAAACCAAATCTGGGTGCCAGATCCC


Top

FusionGenePPI for SMARCB1_SNW1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMARCB1RELB, TACC2, SMARCA2, SMARCA4, SMARCC1, SIN3A, HDAC1, HDAC2, RBBP4, POLR2A, KLF1, GATA1, MYC, TP53, XPO1, RAN, YEATS4, MLLT10, BRCA1, SMARCB1, HSF1, SS18, ARID1A, ARID1B, SMARCC2, SMARCE1, ACTL6A, CCNE1, NCOR1, PPP1R15A, KMT2A, CREBBP, CDK8, MED21, KAT2B, PPP1CA, PPP1CB, PPP1CC, UBQLN4, ING1, MECP2, ING2, XPC, ATM, KMT2C, KMT2B, CDYL, MCPH1, BCL7C, AKT1, ACTA1, CDX2, PRMT5, SIN3B, TAF6, NR0B2, BCL2L11, SMARCD1, NONO, CARM1, EMD, DPF2, RB1CC1, RUNX1, PBRM1, ARID2, MAPK8IP2, GADD45G, CALR, TAF1D, RPS6KA5, PDPK1, MAP1LC3B, ZAK, SMARCAD1, SOX2, DPF3, CHFR, CEBPB, TFAP4, CUL3, COPS5, CAND1, APP, SMARCD2, SMARCD3, TOP2B, SAP18, EIF4A3, NCSTN, PHF10, VTN, TRA2A, SON, DPF1, EPAS1, ZDHHC17, BCL7A, BCL7B, CHMP4A, CPSF6, TBL1X, TBL1XR1, QSOX2, JUN, NFATC1, FOXN1, C1orf131, BARD1, BRCA2, ROR1, CDK9, APC, VHL, NR3C1, AR, DLST, ABI2, AES, ARL11, ATP5A1, DPH6, BHLHE40, BLZF1, FAM208B, CAMK2D, CCDC120, CCDC33, CCDC36, CD69, CDC23, CXCL11, CYB5D2, DNAJA3, FAM154A, FAM9B, GFAP, GOLGA2, HNRNPM, HOMEZ, HOOK2, HSFY1, IKZF3, KCTD9, KLC3, KPNA6, KRT15, KRT19, KRT6A, KRT6B, KRT6C, LDOC1, LENG8, LNX2, LY96, LZTS2, MBIP, MIF4GD, MXI1, NCK2, OSGIN1, OTX2, RINT1, RXRA, TEKT5, TFIP11, TNFAIP1, TNRC6A, TRIM27, TSC22D4, VIM, ZC3H11A, ZNF398SNW1SKI, RBPJ, CIR1, HDAC2, SIN3A, NCOR2, SND1, NOTCH1, NOTCH3, ASCC2, RB1, RBL1, RBL2, SMAD2, SMAD3, SMAD4, SKIL, VDR, PABPN1, MYOD1, RXRA, NCOA2, NCOA1, TCEA2, CCNT1, MYC, CDK9, KMT2A, MEN1, IKBKG, PCBD2, TRIM15, ZSCAN1, SRRM1, NCOR1, EP300, TADA2A, PRPF8, UBR5, ZMAT3, EFTUD2, HNRNPU, DDB1, SFPQ, DDX23, CDC5L, HSPA5, PFKL, ABCF2, TUBB4A, EEF1G, EEF1A1, TUBB1, MSH2, NR0B1, NR0B2, ACTN2, CKAP5, MAPK6, TNNT1, VAV2, SIRT7, PRKAA2, CUL3, CUL2, DAXX, LNX1, MAGEA1, TOP1, PABPC1, CWC27, DHX38, SKIV2L2, DHX15, SNRPD2, DDX5, RAD21, EIF4A3, MAGOH, NHP2L1, SART1, CTNNBL1, XAB2, SNIP1, MFAP1, ZNF830, CXorf56, TTC14, HDAC11, HECW2, AURKB, TP53, TUBGCP3, GOLGA2, TRAF1, IKZF1, MTUS2, TFIP11, PPIL1, CEP55, TEX11, RINT1, LZTS2, KRT40, NXF1, MSL1, ZDHHC17, CUL7, OBSL1, SIRT1, RARA, SUZ12, RNF2, BMI1, OCLN, SNRPA1, DHX8, TSSC4, USB1, FHL3, PPIE, WDR83, CCDC94, LUC7L2, HSPB1, NTRK1, GCN1L1, HARS, HNRNPR, PFKM, PRPF4, SEPT2, SEPT7, SNRNP200, BUD31, CDC40, CRNKL1, PFKP, PLRG1, PRPF19, SARS, TRMT6, SYF2, TTC37, VARS, MUS81, KRAS, SF3B4, SYNCRIP, CPSF4, HNRNPA0, EBNA1BP2, CLP1, CPSF6, SRSF3, HNRNPA3, RBMX, CPSF1, HNRNPA1, HNRNPAB, HNRNPD, NCBP1, PCF11, LUC7L3, PPP2R1B, PRPF40A, METTL3, SRSF2, SRSF5, SRSF6, SNRPB2, RBM10, SRSF11, DDX46, PPP1CA, LOC102724594, BCAS2, SF3A1, CHERP, SF3A3, SF3B2, DDX42, U2AF2, HNRNPK, TRUB1, CSTF3, ELAVL1, XRN2, SNW1, U2SURP, TARDBP, SF3B3, SF3B1, PRPF6, FUS, HNRNPA2B1, HNRNPC, HNRNPF, HNRNPH1, HSPA8, HNRNPM, NONO, GEMIN4, PCBP1, SF3B6, CPSF3, EXOSC10, CPSF2, LUC7L, RBM4, SRSF1, SMN1, SMN2, SNRNP70, SNRPD3, U2AF1, CPSF7, RBM17, HNRNPLL, SNRNP40, RBM39, BZW1, PDCD6IP, SNUPN, ACTR1A, CDK3, STAG1, TUBB3, SEC23B, ARFGEF2, MAGED2, COPS6, CHD3, CHD4, WDR5, PKP3, KTI12, ARAP1, CSK, DCTN1, DDX1, DHX9, DOCK1, DOCK2, MLKL, CTTN, PUF60, ACIN1, WAPAL, XPO6, DNAJC13, SRRM2, GTPBP4, XRCC6, NIPBL, SEC31B, LDLRAP1, KIAA1279, ZNF326, BABAM1, GSPT1, OLA1, PIK3R4, IK, ILK, KPNA1, MLH1, ATM, PAK1, METTL13, CDK12, POLE, ATR, APBB1IP, ATRX, PPP2R1A, KIF27, UBE2Q1, CHD7, PRKAG1, ASUN, EXOC1, CAND1, MAP2K2, MAP2K3, LRRC47, TAOK1, PURA, WIZ, BLM, NCAPG, RBM15, YTHDC2, SRP19, AURKA, TTK, VASP, VRK1, NUP37, SPATA5L1, SHOC2, FIP1L1, DIAPH3, RIOK1, USP48, FYTTD1, RAE1, COPS3, API5, AP3B1, FUBP1, CPNE3, OTULIN, BCL7C, TRIP12, GNA14, AQR, CDK1, TOX4, G3BP2, NUP153, PSMC3, ACTB, SMC4, DNM1L, TUBB, ACTR2, RAD50, TRAP1, TUBA4A, PSMC6, DDX39A, PAK4, TUBB4B, NDC80, DCTN2, CCT7, CCT4, CCT2, EXOC5, KHDRBS1, CCT8, NUDC, SEPT9, TUBGCP2, RUVBL2, SUGT1, EHD1, KIF2C, CHEK1, DDX19B, PSMC1, RBM45, COPA, COPB1, CSE1L, AP1B1, SPATA5, DFNA5, DIAPH1, DYNC1LI2, DNM2, DSP, FASN, LRWD1, FEN1, COPG1, RALY, CCT5, CNOT1, MDN1, EXOC7, SMCHD1, NCAPH, ORC6, ORC3, KIF4A, HSPA12A, INTS1, PHGDH, VPS33B, COPG2, ZNF638, FHOD1, RACGAP1, MSH6, PARVB, HDLBP, HELLS, EHD4, DNAJA1, HSP90AA1, HSP90AB1, HSPD1, ARCN1, KIF11, KPNB1, KPNA2, LIMS1, LMNA, MRE11A, MYH9, NBN, DRG1, NSF, ORC2, ORC4, ORC5, UCHL5, DDX41, GULP1, RTCB, PLEC, PLK1, PNN, POLD1, ANLN, RIF1, FANCI, DDX19A, ABCF3, WDR33, CDKN2AIP, KIF21A, FERMT1, LRRC40, SCYL2, NSUN5, IPO9, ENAH, PARVA, EXOC2, PKN2, UNC45A, PRKDC, MAP2K7, RAD18, SMARCAD1, PSMC2, PSMC4, PSMC5, PSMD1, PSMD2, PSMD3, PSMD11, PSMD12, PSMD13, WDR18, TWF1, SHROOM3, CHD8, RANBP2, RANGAP1, RBBP5, RBBP7, UPF1, RFC2, RFC3, RFC4, RFC5, EXOC4, RPA1, SRSF7, ANAPC1, EPS8L2, FAM129B, INTS3, HLTF, SPTAN1, SPTBN1, SRP54, SRP68, SRP72, TCP1, BUB1, BUB1B, TLN1, TMPO, HSP90B1, CCT3, TUBG1, UBE2N, VIM, AHNAK, DDX39B, CDC73, UBA5, MYO15B, SYMPK, SEH1L, CAPG, SMC1A, UBL4A, ARID1A, CAPZA1, PICALM, EPPK1, NUF2, MAD1L1, CUL1, SMARCA5, RUVBL1, CDC23, IQGAP1, CCNB1, HIP1R, UBE2M, BTAF1, CCT6A, SMC3, ARHGEF1, DEPDC7, ARHGEF2, BUB3, PDLIM7, TRIP13, ROCK2, CHD1L, NUP155, NCAPD2, OXSR1, CDC27, MVP, TUBA1B, EXOC3, SNRPE, DVL3, ELAVL2, C11orf57, SNRPG, KIAA1143, SNRPF, ZC3H18, CD2BP2, EAPP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000263121+19304_31831386PPP1R15A
HgeneSMARCB1chr22:24129449chr14:78201355ENST00000407422+19304_31831377PPP1R15A
TgeneSNW1chr22:24129449chr14:78201355ENST00000261531-61459_79236537PPIL1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMARCB1_SNW1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SMARCB1_SNW1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSMARCB1C0206743Rhabdoid Tumor2CTD_human
HgeneSMARCB1C3553248MENTAL RETARDATION, AUTOSOMAL DOMINANT 152UNIPROT
HgeneSMARCB1C0265338Coffin-Siris syndrome1CTD_human;ORPHANET
HgeneSMARCB1C1335929Schwannomatosis1CTD_human;ORPHANET