FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34807

FusionGeneSummary for SMARCA5_LRBA

check button Fusion gene summary
Fusion gene informationFusion gene name: SMARCA5_LRBA
Fusion gene ID: 34807
HgeneTgene
Gene symbol

SMARCA5

LRBA

Gene ID

8467

987

Gene nameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5LPS responsive beige-like anchor protein
SynonymsISWI|SNF2H|WCRF135|hISWI|hSNF2HBGL|CDC4L|CVID8|LAB300|LBA
Cytomap

4q31.21

4q31.3

Type of geneprotein-codingprotein-coding
DescriptionSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5sucrose nonfermenting protein 2 homologsucrose nonfermenting-like 5lipopolysaccharide-responsive and beige-like anchor proteinCDC4-like proteinLPS-responsive vesicle trafficking, beach and anchor containingvesicle trafficking, beach and anchor containing
Modification date2018051920180519
UniProtAcc

O60264

P50851

Ensembl transtripts involved in fusion geneENST00000283131, ENST00000535741, 
ENST00000510413, ENST00000503716, 
ENST00000357115, ENST00000507224, 
Fusion gene scores* DoF score2 X 2 X 2=815 X 15 X 7=1575
# samples 218
** MAII scorelog2(2/8*10)=1.32192809488736log2(18/1575*10)=-3.12928301694497
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SMARCA5 [Title/Abstract] AND LRBA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSMARCA5

GO:0006334

nucleosome assembly

12972596

HgeneSMARCA5

GO:0006338

chromatin remodeling

9836642

HgeneSMARCA5

GO:0006352

DNA-templated transcription, initiation

9836642

HgeneSMARCA5

GO:0016584

nucleosome positioning

9836642


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-FD-A3B7-01ASMARCA5chr4

144469293

+LRBAchr4

151358016

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283131ENST00000535741SMARCA5chr4

144469293

+LRBAchr4

151358016

-
In-frameENST00000283131ENST00000510413SMARCA5chr4

144469293

+LRBAchr4

151358016

-
5CDS-5UTRENST00000283131ENST00000503716SMARCA5chr4

144469293

+LRBAchr4

151358016

-
5CDS-5UTRENST00000283131ENST00000357115SMARCA5chr4

144469293

+LRBAchr4

151358016

-
5CDS-5UTRENST00000283131ENST00000507224SMARCA5chr4

144469293

+LRBAchr4

151358016

-

Top

FusionProtFeatures for SMARCA5_LRBA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMARCA5

O60264

LRBA

P50851

Helicase that possesses intrinsic ATP-dependentnucleosome-remodeling activity. Complexes containing SMARCA5 arecapable of forming ordered nucleosome arrays on chromatin; thismay require intact histone H4 tails. Also required for replicationof pericentric heterochromatin in S-phase specifically inconjunction with BAZ1A. Probably plays a role in repression ofpolI dependent transcription of the rDNA locus, through therecruitment of the SIN3/HDAC1 corepressor complex to the rDNApromoter. Essential component of the WICH complex, a chromatinremodeling complex that mobilizes nucleosomes and reconfiguresirregular chromatin to a regular nucleosomal array structure. TheWICH complex regulates the transcription of various genes, has arole in RNA polymerase I and RNA polymerase III transcription,mediates the histone H2AX phosphorylation at 'Tyr-142', and isinvolved in the maintenance of chromatin structures during DNAreplication processes. Essential component of the NoRC (nucleolarremodeling complex) complex, a complex that mediates silencing ofa fraction of rDNA by recruiting histone-modifying enzymes and DNAmethyltransferases, leading to heterochromatin formation andtranscriptional silencing. {ECO:0000269|PubMed:10880450,ECO:0000269|PubMed:11980720, ECO:0000269|PubMed:12198550,ECO:0000269|PubMed:12434153, ECO:0000269|PubMed:12972596,ECO:0000269|PubMed:15543136, ECO:0000269|PubMed:16603771}. May be involved in coupling signal transduction andvesicle trafficking to enable polarized secretion and/or membranedeposition of immune effector molecules. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+22247_139951053Compositional biasNote=Poly-Pro
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+2224192_3579951053DomainHelicase ATP-binding
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+2224487_6389951053DomainHelicase C-terminal
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+2224840_8929951053DomainSANT 1
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+2224308_3119951053MotifNote=DEAH box
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+2224205_2129951053Nucleotide bindingATP
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582591_263322712864RepeatNote=WD 2
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582636_267922712864RepeatNote=WD 3
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582695_273522712864RepeatNote=WD 4
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582777_281622712864RepeatNote=WD 5
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582819_285822712864RepeatNote=WD 6
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572591_263322602852RepeatNote=WD 2
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572636_267922602852RepeatNote=WD 3
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572695_273522602852RepeatNote=WD 4
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572777_281622602852RepeatNote=WD 5
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572819_285822602852RepeatNote=WD 6

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSMARCA5chr4:144469293chr4:151358016ENST00000283131+2224943_10079951053DomainSANT 2
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44581006_105322712864Coiled coilOntology_term=ECO:0000255
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43571006_105322602852Coiled coilOntology_term=ECO:0000255
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44581990_199422712864Compositional biasNote=Poly-Arg
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43571990_199422602852Compositional biasNote=Poly-Arg
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582073_218122712864DomainBEACH-type PH
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44582200_248922712864DomainBEACH
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572073_218122602852DomainBEACH-type PH
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43572200_248922602852DomainBEACH
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44581301_134322712864RepeatNote=WD 1
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43571301_134322602852RepeatNote=WD 1
TgeneLRBAchr4:144469293chr4:151358016ENST00000357115-44581531_154822712864TransmembraneHelical
TgeneLRBAchr4:144469293chr4:151358016ENST00000510413-43571531_154822602852TransmembraneHelical


Top

FusionGeneSequence for SMARCA5_LRBA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMARCA5_ENST00000283131_chr4_144469293_+_LRBA_ENST00000535741_chr4_151358016_-_1588aa
MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRAN
RFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKL
RDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAF
VRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFN
SADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNIL
MQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQD
SINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSI
VIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYR
EKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAA
QAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKI
MAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLK
SRTAMPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSD
IKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYY
LTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAV
ITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTD
TGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYWNGKCSGIGDNPGSETAAPRAILTGHDYEVTCAAVCAELGLVLSGS
QEGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVR

>In-frame_SMARCA5_ENST00000283131_chr4_144469293_+_LRBA_ENST00000510413_chr4_151358016_-_1587aa
MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRAN
RFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKL
RDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAF
VRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFN
SADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNIL
MQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQD
SINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSI
VIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYR
EKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAA
QAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKI
MAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLK
SRTAMPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSD
IKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRALNVFYY
LTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDKAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAV
ITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSFRVYSTD
TGRLIQVVFGHWDVVTCLARSESYIGGNCYILSGSRDATLLLWYWNGKCSGIGDNPGETAAPRAILTGHDYEVTCAAVCAELGLVLSGSQ
EGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGLFCTFSVNGKLQATMETDDNIRAIQLSRDGQYLLTGGDRGVVVVRQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMARCA5_ENST00000283131_chr4_144469293_+_LRBA_ENST00000535741_chr4_151358016_-_4764nt
ATGTCGTCCGCGGCCGAGCCTCCGCCACCCCCGCCTCCCGAGAGCGCGCCTTCCAAGCCCGCAGCCTCGATCGCCAGCGGCGGGAGCAAC
AGCAGCAACAAAGGCGGCCCCGAAGGCGTCGCGGCGCAGGCGGTTGCGTCTGCGGCCAGCGCTGGTCCCGCAGACGCCGAGATGGAGGAA
ATATTTGATGATGCGTCACCTGGAAAGCAAAAGGAAATCCAAGAACCAGATCCTACCTATGAAGAAAAAATGCAAACTGACCGGGCAAAT
AGATTCGAGTATTTATTAAAGCAGACAGAACTTTTTGCACATTTCATTCAACCTGCTGCTCAGAAGACTCCAACTTCACCTTTGAAGATG
AAACCAGGGCGCCCACGAATAAAAAAAGATGAGAAGCAGAACTTACTATCCGTTGGCGATTACCGACACCGTAGAACAGAGCAAGAGGAG
GATGAAGAGCTATTAACAGAAAGCTCCAAAGCAACCAATGTTTGCACTCGATTTGAAGACTCTCCATCGTATGTAAAATGGGGTAAACTG
AGAGATTATCAGGTCCGAGGATTAAACTGGCTCATTTCTTTGTATGAGAATGGCATCAATGGTATCCTTGCAGATGAAATGGGCCTAGGA
AAGACTCTTCAAACAATTTCTCTTCTTGGGTACATGAAACATTATAGAAACATTCCTGGGCCTCATATGGTTTTGGTTCCTAAGTCTACA
TTACACAACTGGATGAGTGAATTCAAGAGATGGGTACCAACACTTAGATCTGTTTGTTTGATAGGAGATAAAGAACAAAGAGCTGCTTTT
GTCAGAGACGTTTTATTACCGGGAGAATGGGATGTATGTGTAACATCTTATGAAATGCTTATTAAAGAGAAGTCTGTGTTCAAAAAATTT
AATTGGAGATACTTAGTAATAGATGAAGCTCACAGGATCAAAAATGAAAAATCTAAGTTGTCAGAAATAGTGAGGGAATTCAAGACTACA
AATAGACTATTATTAACTGGAACACCTCTTCAGAACAACTTGCATGAGCTGTGGTCACTTCTTAACTTTCTGTTGCCAGATGTGTTTAAT
TCAGCAGATGACTTTGATTCCTGGTTTGATACAAACAACTGCCTTGGGGATCAAAAACTAGTTGAGAGGCTTCATATGGTTTTGCGTCCA
TTCCTCCTTCGTCGAATTAAGGCTGATGTTGAAAAGAGTTTGCCTCCAAAGAAGGAAGTAAAAATCTATGTGGGCCTCAGCAAAATGCAA
AGGGAATGGTATACTCGGATATTAATGAAGGATATAGATATACTCAACTCAGCAGGCAAGATGGACAAAATGAGGTTATTGAACATCCTA
ATGCAGTTGAGAAAATGTTGTAATCATCCATATCTCTTTGATGGAGCAGAACCTGGTCCACCTTATACAACAGATATGCATCTAGTAACC
AACAGTGGCAAAATGGTGGTTTTAGACAAGCTGCTCCCTAAGTTAAAAGAACAAGGTTCACGAGTACTAATCTTCAGTCAAATGACAAGG
GTATTGGACATTTTGGAAGATTATTGCATGTGGAGAAATTATGAGTACTGCAGGTTGGATGGTCAGACACCCCATGATGAGAGACAAGAC
TCCATCAATGCATACAATGAACCAAACAGCACAAAGTTTGTTTTCATGTTAAGCACGCGTGCTGGTGGTCTTGGCATCAATCTTGCGACT
GCTGATGTAGTAATTTTGTATGATTCTGATTGGAATCCCCAAGTAGATCTTCAGGCTATGGACCGAGCACATAGAATTGGGCAGACTAAG
ACAGTCAGAGTGTTCCGCTTTATAACTGATAACACTGTAGAAGAAAGAATAGTAGAACGTGCTGAGATGAAACTCAGACTGGATTCAATA
GTCATTCAACAAGGGAGGCTTGTGGATCAGAATCTGAACAAAATTGGGAAAGATGAAATGCTTCAAATGATTAGACATGGAGCAACACAT
GTGTTTGCTTCAAAGGAAAGTGAGATCACTGATGAAGATATCGATGGTATTTTGGAAAGAGGTGCAAAGAAGACTGCAGAGATGAATGAA
AAGCTCTCCAAGATGGGCGAAAGTTCACTTAGAAACTTTACAATGGATACAGAGTCAAGTGTTTATAACTTCGAAGGAGAAGACTATAGA
GAAAAACAAAAGATTGCATTCACAGAGTGGATTGAACCACCTAAACGAGAAAGAAAAGCCAACTATGCCGTTGATGCATATTTCAGGGAA
GCTCTTCGTGTTAGTGAACCTAAAGCACCCAAGGCTCCTCGACCTCCAAAACAACCCAATGTTCAGGATTTCCAGTTCTTTCCTCCACGT
TTATTTGAATTACTGGAAAAAGAAATTCTGTTTTACAGAAAAACTATTGGGTACAAGGTACCTCGAAATCCTGAGCTGCCTAATGCAGCA
CAGGCACAAAAAGAAGAACAGCTTAAAATTGATGAAGCTGAATCCCTTAATGATGAAGAGTTAGAGGAAAAAGAGAAGCTTCTAACACAG
GGATTTACCAATTGGAATAAGAGAGATTTTAACCAGTTTATCAAAGCTAATGAGAAGTGGGGTCGTGATGATATTGAAAATATAGCAAGA
GAAGTAGAAGGCAAAACTCCAGAAGAAGTCATTGAATATTCAGCTGTGTTTTGGGAAAGGTGCAACGAGCTCCAGGACATAGAGAAGATT
ATGGCTCAGATTGAAAGGGGAGAGGCGAGAATTCAAAGAAGAATAAGCATCAAGAAAGCACTTGACACAAAGATTGGACGGTACAAAGCA
CCTTTTCATCAGCTGAGAATATCATATGGTACTAACAAAGGAAAAAACTATACTGAAGAAGAAGATCGTTTTCTGATTTGTATGCTTCAC
AAACTTGGATTTGACAAAGAAAATGTTTATGATGAATTGCGACAGTGTATTCGCAACTCTCCTCAGTTCAGATTTGACTGGTTTCTTAAG
TCCAGAACTGCAATGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGGGAAGATGATCAAGTT
CCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTTACAACTTATTTCCTA
AATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAGCGTGATACCTCTGAT
ATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTGATGGATGATGGGACA
GTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTGGAGAGTGAATTTGTT
TCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTCAATGTGTTCTATTAC
TTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATCCGAAGTTTTGGACAG
ACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACAGACAAAGCCCAGCAG
GATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTGGCAACTCCCGCTGTG
ATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAAGACCAGCCATACCAG
CTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGACCAAAGTATTCAAGTG
CATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGAGTCTATTCTACAGAC
ACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATTGGGGGAAATTGCTAC
ATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAACCCAGGCAGTGAGACT
GCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCA
CAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATT
CAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATG
GAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGG
CAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATC

>In-frame_SMARCA5_ENST00000283131_chr4_144469293_+_LRBA_ENST00000510413_chr4_151358016_-_4761nt
ATGTCGTCCGCGGCCGAGCCTCCGCCACCCCCGCCTCCCGAGAGCGCGCCTTCCAAGCCCGCAGCCTCGATCGCCAGCGGCGGGAGCAAC
AGCAGCAACAAAGGCGGCCCCGAAGGCGTCGCGGCGCAGGCGGTTGCGTCTGCGGCCAGCGCTGGTCCCGCAGACGCCGAGATGGAGGAA
ATATTTGATGATGCGTCACCTGGAAAGCAAAAGGAAATCCAAGAACCAGATCCTACCTATGAAGAAAAAATGCAAACTGACCGGGCAAAT
AGATTCGAGTATTTATTAAAGCAGACAGAACTTTTTGCACATTTCATTCAACCTGCTGCTCAGAAGACTCCAACTTCACCTTTGAAGATG
AAACCAGGGCGCCCACGAATAAAAAAAGATGAGAAGCAGAACTTACTATCCGTTGGCGATTACCGACACCGTAGAACAGAGCAAGAGGAG
GATGAAGAGCTATTAACAGAAAGCTCCAAAGCAACCAATGTTTGCACTCGATTTGAAGACTCTCCATCGTATGTAAAATGGGGTAAACTG
AGAGATTATCAGGTCCGAGGATTAAACTGGCTCATTTCTTTGTATGAGAATGGCATCAATGGTATCCTTGCAGATGAAATGGGCCTAGGA
AAGACTCTTCAAACAATTTCTCTTCTTGGGTACATGAAACATTATAGAAACATTCCTGGGCCTCATATGGTTTTGGTTCCTAAGTCTACA
TTACACAACTGGATGAGTGAATTCAAGAGATGGGTACCAACACTTAGATCTGTTTGTTTGATAGGAGATAAAGAACAAAGAGCTGCTTTT
GTCAGAGACGTTTTATTACCGGGAGAATGGGATGTATGTGTAACATCTTATGAAATGCTTATTAAAGAGAAGTCTGTGTTCAAAAAATTT
AATTGGAGATACTTAGTAATAGATGAAGCTCACAGGATCAAAAATGAAAAATCTAAGTTGTCAGAAATAGTGAGGGAATTCAAGACTACA
AATAGACTATTATTAACTGGAACACCTCTTCAGAACAACTTGCATGAGCTGTGGTCACTTCTTAACTTTCTGTTGCCAGATGTGTTTAAT
TCAGCAGATGACTTTGATTCCTGGTTTGATACAAACAACTGCCTTGGGGATCAAAAACTAGTTGAGAGGCTTCATATGGTTTTGCGTCCA
TTCCTCCTTCGTCGAATTAAGGCTGATGTTGAAAAGAGTTTGCCTCCAAAGAAGGAAGTAAAAATCTATGTGGGCCTCAGCAAAATGCAA
AGGGAATGGTATACTCGGATATTAATGAAGGATATAGATATACTCAACTCAGCAGGCAAGATGGACAAAATGAGGTTATTGAACATCCTA
ATGCAGTTGAGAAAATGTTGTAATCATCCATATCTCTTTGATGGAGCAGAACCTGGTCCACCTTATACAACAGATATGCATCTAGTAACC
AACAGTGGCAAAATGGTGGTTTTAGACAAGCTGCTCCCTAAGTTAAAAGAACAAGGTTCACGAGTACTAATCTTCAGTCAAATGACAAGG
GTATTGGACATTTTGGAAGATTATTGCATGTGGAGAAATTATGAGTACTGCAGGTTGGATGGTCAGACACCCCATGATGAGAGACAAGAC
TCCATCAATGCATACAATGAACCAAACAGCACAAAGTTTGTTTTCATGTTAAGCACGCGTGCTGGTGGTCTTGGCATCAATCTTGCGACT
GCTGATGTAGTAATTTTGTATGATTCTGATTGGAATCCCCAAGTAGATCTTCAGGCTATGGACCGAGCACATAGAATTGGGCAGACTAAG
ACAGTCAGAGTGTTCCGCTTTATAACTGATAACACTGTAGAAGAAAGAATAGTAGAACGTGCTGAGATGAAACTCAGACTGGATTCAATA
GTCATTCAACAAGGGAGGCTTGTGGATCAGAATCTGAACAAAATTGGGAAAGATGAAATGCTTCAAATGATTAGACATGGAGCAACACAT
GTGTTTGCTTCAAAGGAAAGTGAGATCACTGATGAAGATATCGATGGTATTTTGGAAAGAGGTGCAAAGAAGACTGCAGAGATGAATGAA
AAGCTCTCCAAGATGGGCGAAAGTTCACTTAGAAACTTTACAATGGATACAGAGTCAAGTGTTTATAACTTCGAAGGAGAAGACTATAGA
GAAAAACAAAAGATTGCATTCACAGAGTGGATTGAACCACCTAAACGAGAAAGAAAAGCCAACTATGCCGTTGATGCATATTTCAGGGAA
GCTCTTCGTGTTAGTGAACCTAAAGCACCCAAGGCTCCTCGACCTCCAAAACAACCCAATGTTCAGGATTTCCAGTTCTTTCCTCCACGT
TTATTTGAATTACTGGAAAAAGAAATTCTGTTTTACAGAAAAACTATTGGGTACAAGGTACCTCGAAATCCTGAGCTGCCTAATGCAGCA
CAGGCACAAAAAGAAGAACAGCTTAAAATTGATGAAGCTGAATCCCTTAATGATGAAGAGTTAGAGGAAAAAGAGAAGCTTCTAACACAG
GGATTTACCAATTGGAATAAGAGAGATTTTAACCAGTTTATCAAAGCTAATGAGAAGTGGGGTCGTGATGATATTGAAAATATAGCAAGA
GAAGTAGAAGGCAAAACTCCAGAAGAAGTCATTGAATATTCAGCTGTGTTTTGGGAAAGGTGCAACGAGCTCCAGGACATAGAGAAGATT
ATGGCTCAGATTGAAAGGGGAGAGGCGAGAATTCAAAGAAGAATAAGCATCAAGAAAGCACTTGACACAAAGATTGGACGGTACAAAGCA
CCTTTTCATCAGCTGAGAATATCATATGGTACTAACAAAGGAAAAAACTATACTGAAGAAGAAGATCGTTTTCTGATTTGTATGCTTCAC
AAACTTGGATTTGACAAAGAAAATGTTTATGATGAATTGCGACAGTGTATTCGCAACTCTCCTCAGTTCAGATTTGACTGGTTTCTTAAG
TCCAGAACTGCAATGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGGGAAGATGATCAAGTT
CCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTTACAACTTATTTCCTA
AATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAGCGTGATACCTCTGAT
ATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTGATGGATGATGGGACA
GTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTGGAGAGTGAATTTGTT
TCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTCAATGTGTTCTATTAC
TTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATCCGAAGTTTTGGACAG
ACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACAGACAAAGCCCAGCAG
GATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTGGCAACTCCCGCTGTG
ATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAAGACCAGCCATACCAG
CTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGACCAAAGTATTCAAGTG
CATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGAGTCTATTCTACAGAC
ACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATTGGGGGAAATTGCTAC
ATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAACCCAGGTGAGACTGCT
GCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTGAGTGGTTCACAA
GAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCAAAACTCATTCAG
GCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAGGCCACGATGGAA
ACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTCGTGGTCCGGCAG
GTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAGAGGTGCATCATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMARCA5_ENST00000283131_chr4_144469293_+_LRBA_ENST00000535741_chr4_151358016_-_6506nt
GCGAGTGTTGAAAGTCGGTGGCGTAGGTCGTCGTCCTGGATGCTGGCGAGATAGATGTTATCTTCCAGAGGAAGAGGAGGAGGCGGCGAA
GCGTTTTCCCAGCCTCAGTCTCTCTTTCGTTTTCCTTTTCCCTTCCCCCAACCCTCCGCCCTTCTCTAAATCAGCCGGCCTTCCTTGACC
TCAGTGACCCGTCTGGCCCCGCCCACCCTCGTCGACGTGATTCCCGCCGTGAGGTAAGCGCCGGTGGAACCTAGAGCCCCGCGGAAGAGC
AGAACGTTTGGGAGTGTGCAGCTCCTGGGCCCGGCTCAGGCCCGTCGCGGAGGCGCGGCGCAGGGGAGCGCTCGGGTGGGAGTCTCGCTC
CTCCACCAGTTTATTGCGACGTAGCATCCAGGCCTAGGCCTCCCCGTCCATCCCCGCCGGACTCGGGCCTCTGGCAGCAGCGGGTGACGC
AGACGGAACATCATGTCGTCCGCGGCCGAGCCTCCGCCACCCCCGCCTCCCGAGAGCGCGCCTTCCAAGCCCGCAGCCTCGATCGCCAGC
GGCGGGAGCAACAGCAGCAACAAAGGCGGCCCCGAAGGCGTCGCGGCGCAGGCGGTTGCGTCTGCGGCCAGCGCTGGTCCCGCAGACGCC
GAGATGGAGGAAATATTTGATGATGCGTCACCTGGAAAGCAAAAGGAAATCCAAGAACCAGATCCTACCTATGAAGAAAAAATGCAAACT
GACCGGGCAAATAGATTCGAGTATTTATTAAAGCAGACAGAACTTTTTGCACATTTCATTCAACCTGCTGCTCAGAAGACTCCAACTTCA
CCTTTGAAGATGAAACCAGGGCGCCCACGAATAAAAAAAGATGAGAAGCAGAACTTACTATCCGTTGGCGATTACCGACACCGTAGAACA
GAGCAAGAGGAGGATGAAGAGCTATTAACAGAAAGCTCCAAAGCAACCAATGTTTGCACTCGATTTGAAGACTCTCCATCGTATGTAAAA
TGGGGTAAACTGAGAGATTATCAGGTCCGAGGATTAAACTGGCTCATTTCTTTGTATGAGAATGGCATCAATGGTATCCTTGCAGATGAA
ATGGGCCTAGGAAAGACTCTTCAAACAATTTCTCTTCTTGGGTACATGAAACATTATAGAAACATTCCTGGGCCTCATATGGTTTTGGTT
CCTAAGTCTACATTACACAACTGGATGAGTGAATTCAAGAGATGGGTACCAACACTTAGATCTGTTTGTTTGATAGGAGATAAAGAACAA
AGAGCTGCTTTTGTCAGAGACGTTTTATTACCGGGAGAATGGGATGTATGTGTAACATCTTATGAAATGCTTATTAAAGAGAAGTCTGTG
TTCAAAAAATTTAATTGGAGATACTTAGTAATAGATGAAGCTCACAGGATCAAAAATGAAAAATCTAAGTTGTCAGAAATAGTGAGGGAA
TTCAAGACTACAAATAGACTATTATTAACTGGAACACCTCTTCAGAACAACTTGCATGAGCTGTGGTCACTTCTTAACTTTCTGTTGCCA
GATGTGTTTAATTCAGCAGATGACTTTGATTCCTGGTTTGATACAAACAACTGCCTTGGGGATCAAAAACTAGTTGAGAGGCTTCATATG
GTTTTGCGTCCATTCCTCCTTCGTCGAATTAAGGCTGATGTTGAAAAGAGTTTGCCTCCAAAGAAGGAAGTAAAAATCTATGTGGGCCTC
AGCAAAATGCAAAGGGAATGGTATACTCGGATATTAATGAAGGATATAGATATACTCAACTCAGCAGGCAAGATGGACAAAATGAGGTTA
TTGAACATCCTAATGCAGTTGAGAAAATGTTGTAATCATCCATATCTCTTTGATGGAGCAGAACCTGGTCCACCTTATACAACAGATATG
CATCTAGTAACCAACAGTGGCAAAATGGTGGTTTTAGACAAGCTGCTCCCTAAGTTAAAAGAACAAGGTTCACGAGTACTAATCTTCAGT
CAAATGACAAGGGTATTGGACATTTTGGAAGATTATTGCATGTGGAGAAATTATGAGTACTGCAGGTTGGATGGTCAGACACCCCATGAT
GAGAGACAAGACTCCATCAATGCATACAATGAACCAAACAGCACAAAGTTTGTTTTCATGTTAAGCACGCGTGCTGGTGGTCTTGGCATC
AATCTTGCGACTGCTGATGTAGTAATTTTGTATGATTCTGATTGGAATCCCCAAGTAGATCTTCAGGCTATGGACCGAGCACATAGAATT
GGGCAGACTAAGACAGTCAGAGTGTTCCGCTTTATAACTGATAACACTGTAGAAGAAAGAATAGTAGAACGTGCTGAGATGAAACTCAGA
CTGGATTCAATAGTCATTCAACAAGGGAGGCTTGTGGATCAGAATCTGAACAAAATTGGGAAAGATGAAATGCTTCAAATGATTAGACAT
GGAGCAACACATGTGTTTGCTTCAAAGGAAAGTGAGATCACTGATGAAGATATCGATGGTATTTTGGAAAGAGGTGCAAAGAAGACTGCA
GAGATGAATGAAAAGCTCTCCAAGATGGGCGAAAGTTCACTTAGAAACTTTACAATGGATACAGAGTCAAGTGTTTATAACTTCGAAGGA
GAAGACTATAGAGAAAAACAAAAGATTGCATTCACAGAGTGGATTGAACCACCTAAACGAGAAAGAAAAGCCAACTATGCCGTTGATGCA
TATTTCAGGGAAGCTCTTCGTGTTAGTGAACCTAAAGCACCCAAGGCTCCTCGACCTCCAAAACAACCCAATGTTCAGGATTTCCAGTTC
TTTCCTCCACGTTTATTTGAATTACTGGAAAAAGAAATTCTGTTTTACAGAAAAACTATTGGGTACAAGGTACCTCGAAATCCTGAGCTG
CCTAATGCAGCACAGGCACAAAAAGAAGAACAGCTTAAAATTGATGAAGCTGAATCCCTTAATGATGAAGAGTTAGAGGAAAAAGAGAAG
CTTCTAACACAGGGATTTACCAATTGGAATAAGAGAGATTTTAACCAGTTTATCAAAGCTAATGAGAAGTGGGGTCGTGATGATATTGAA
AATATAGCAAGAGAAGTAGAAGGCAAAACTCCAGAAGAAGTCATTGAATATTCAGCTGTGTTTTGGGAAAGGTGCAACGAGCTCCAGGAC
ATAGAGAAGATTATGGCTCAGATTGAAAGGGGAGAGGCGAGAATTCAAAGAAGAATAAGCATCAAGAAAGCACTTGACACAAAGATTGGA
CGGTACAAAGCACCTTTTCATCAGCTGAGAATATCATATGGTACTAACAAAGGAAAAAACTATACTGAAGAAGAAGATCGTTTTCTGATT
TGTATGCTTCACAAACTTGGATTTGACAAAGAAAATGTTTATGATGAATTGCGACAGTGTATTCGCAACTCTCCTCAGTTCAGATTTGAC
TGGTTTCTTAAGTCCAGAACTGCAATGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGGGAA
GATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTTACA
ACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAGCGT
GATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTGATG
GATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTGGAG
AGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTCAAT
GTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATCCGA
AGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACAGAC
AAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTGGCA
ACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAAGAC
CAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGACCAA
AGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGAGTC
TATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATTGGG
GGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAACCCA
GGCAGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTG
TTGAGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAA
CCAAAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTC
CAGGCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTG
GTCGTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGAC
CAGAGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGC
TACTGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAA
CTTAAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATT
AGCAAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGG
AAACATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGAT
TTTCACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTC
TTCAGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAAT
ATTGTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATA
GCAAGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAAC
ATTTGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTT
TTGTTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTA
AACTATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGT
AGATTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCT
ATTTCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTC
AGTTTGACAGAAAAAGCTGAATAAAATGGCATCTGTAATTGAATTGTTGGAAATGCCTTTTTTGCTCCTAAATTTTAAACATCATTAATA

>In-frame_SMARCA5_ENST00000283131_chr4_144469293_+_LRBA_ENST00000510413_chr4_151358016_-_6414nt
GCGAGTGTTGAAAGTCGGTGGCGTAGGTCGTCGTCCTGGATGCTGGCGAGATAGATGTTATCTTCCAGAGGAAGAGGAGGAGGCGGCGAA
GCGTTTTCCCAGCCTCAGTCTCTCTTTCGTTTTCCTTTTCCCTTCCCCCAACCCTCCGCCCTTCTCTAAATCAGCCGGCCTTCCTTGACC
TCAGTGACCCGTCTGGCCCCGCCCACCCTCGTCGACGTGATTCCCGCCGTGAGGTAAGCGCCGGTGGAACCTAGAGCCCCGCGGAAGAGC
AGAACGTTTGGGAGTGTGCAGCTCCTGGGCCCGGCTCAGGCCCGTCGCGGAGGCGCGGCGCAGGGGAGCGCTCGGGTGGGAGTCTCGCTC
CTCCACCAGTTTATTGCGACGTAGCATCCAGGCCTAGGCCTCCCCGTCCATCCCCGCCGGACTCGGGCCTCTGGCAGCAGCGGGTGACGC
AGACGGAACATCATGTCGTCCGCGGCCGAGCCTCCGCCACCCCCGCCTCCCGAGAGCGCGCCTTCCAAGCCCGCAGCCTCGATCGCCAGC
GGCGGGAGCAACAGCAGCAACAAAGGCGGCCCCGAAGGCGTCGCGGCGCAGGCGGTTGCGTCTGCGGCCAGCGCTGGTCCCGCAGACGCC
GAGATGGAGGAAATATTTGATGATGCGTCACCTGGAAAGCAAAAGGAAATCCAAGAACCAGATCCTACCTATGAAGAAAAAATGCAAACT
GACCGGGCAAATAGATTCGAGTATTTATTAAAGCAGACAGAACTTTTTGCACATTTCATTCAACCTGCTGCTCAGAAGACTCCAACTTCA
CCTTTGAAGATGAAACCAGGGCGCCCACGAATAAAAAAAGATGAGAAGCAGAACTTACTATCCGTTGGCGATTACCGACACCGTAGAACA
GAGCAAGAGGAGGATGAAGAGCTATTAACAGAAAGCTCCAAAGCAACCAATGTTTGCACTCGATTTGAAGACTCTCCATCGTATGTAAAA
TGGGGTAAACTGAGAGATTATCAGGTCCGAGGATTAAACTGGCTCATTTCTTTGTATGAGAATGGCATCAATGGTATCCTTGCAGATGAA
ATGGGCCTAGGAAAGACTCTTCAAACAATTTCTCTTCTTGGGTACATGAAACATTATAGAAACATTCCTGGGCCTCATATGGTTTTGGTT
CCTAAGTCTACATTACACAACTGGATGAGTGAATTCAAGAGATGGGTACCAACACTTAGATCTGTTTGTTTGATAGGAGATAAAGAACAA
AGAGCTGCTTTTGTCAGAGACGTTTTATTACCGGGAGAATGGGATGTATGTGTAACATCTTATGAAATGCTTATTAAAGAGAAGTCTGTG
TTCAAAAAATTTAATTGGAGATACTTAGTAATAGATGAAGCTCACAGGATCAAAAATGAAAAATCTAAGTTGTCAGAAATAGTGAGGGAA
TTCAAGACTACAAATAGACTATTATTAACTGGAACACCTCTTCAGAACAACTTGCATGAGCTGTGGTCACTTCTTAACTTTCTGTTGCCA
GATGTGTTTAATTCAGCAGATGACTTTGATTCCTGGTTTGATACAAACAACTGCCTTGGGGATCAAAAACTAGTTGAGAGGCTTCATATG
GTTTTGCGTCCATTCCTCCTTCGTCGAATTAAGGCTGATGTTGAAAAGAGTTTGCCTCCAAAGAAGGAAGTAAAAATCTATGTGGGCCTC
AGCAAAATGCAAAGGGAATGGTATACTCGGATATTAATGAAGGATATAGATATACTCAACTCAGCAGGCAAGATGGACAAAATGAGGTTA
TTGAACATCCTAATGCAGTTGAGAAAATGTTGTAATCATCCATATCTCTTTGATGGAGCAGAACCTGGTCCACCTTATACAACAGATATG
CATCTAGTAACCAACAGTGGCAAAATGGTGGTTTTAGACAAGCTGCTCCCTAAGTTAAAAGAACAAGGTTCACGAGTACTAATCTTCAGT
CAAATGACAAGGGTATTGGACATTTTGGAAGATTATTGCATGTGGAGAAATTATGAGTACTGCAGGTTGGATGGTCAGACACCCCATGAT
GAGAGACAAGACTCCATCAATGCATACAATGAACCAAACAGCACAAAGTTTGTTTTCATGTTAAGCACGCGTGCTGGTGGTCTTGGCATC
AATCTTGCGACTGCTGATGTAGTAATTTTGTATGATTCTGATTGGAATCCCCAAGTAGATCTTCAGGCTATGGACCGAGCACATAGAATT
GGGCAGACTAAGACAGTCAGAGTGTTCCGCTTTATAACTGATAACACTGTAGAAGAAAGAATAGTAGAACGTGCTGAGATGAAACTCAGA
CTGGATTCAATAGTCATTCAACAAGGGAGGCTTGTGGATCAGAATCTGAACAAAATTGGGAAAGATGAAATGCTTCAAATGATTAGACAT
GGAGCAACACATGTGTTTGCTTCAAAGGAAAGTGAGATCACTGATGAAGATATCGATGGTATTTTGGAAAGAGGTGCAAAGAAGACTGCA
GAGATGAATGAAAAGCTCTCCAAGATGGGCGAAAGTTCACTTAGAAACTTTACAATGGATACAGAGTCAAGTGTTTATAACTTCGAAGGA
GAAGACTATAGAGAAAAACAAAAGATTGCATTCACAGAGTGGATTGAACCACCTAAACGAGAAAGAAAAGCCAACTATGCCGTTGATGCA
TATTTCAGGGAAGCTCTTCGTGTTAGTGAACCTAAAGCACCCAAGGCTCCTCGACCTCCAAAACAACCCAATGTTCAGGATTTCCAGTTC
TTTCCTCCACGTTTATTTGAATTACTGGAAAAAGAAATTCTGTTTTACAGAAAAACTATTGGGTACAAGGTACCTCGAAATCCTGAGCTG
CCTAATGCAGCACAGGCACAAAAAGAAGAACAGCTTAAAATTGATGAAGCTGAATCCCTTAATGATGAAGAGTTAGAGGAAAAAGAGAAG
CTTCTAACACAGGGATTTACCAATTGGAATAAGAGAGATTTTAACCAGTTTATCAAAGCTAATGAGAAGTGGGGTCGTGATGATATTGAA
AATATAGCAAGAGAAGTAGAAGGCAAAACTCCAGAAGAAGTCATTGAATATTCAGCTGTGTTTTGGGAAAGGTGCAACGAGCTCCAGGAC
ATAGAGAAGATTATGGCTCAGATTGAAAGGGGAGAGGCGAGAATTCAAAGAAGAATAAGCATCAAGAAAGCACTTGACACAAAGATTGGA
CGGTACAAAGCACCTTTTCATCAGCTGAGAATATCATATGGTACTAACAAAGGAAAAAACTATACTGAAGAAGAAGATCGTTTTCTGATT
TGTATGCTTCACAAACTTGGATTTGACAAAGAAAATGTTTATGATGAATTGCGACAGTGTATTCGCAACTCTCCTCAGTTCAGATTTGAC
TGGTTTCTTAAGTCCAGAACTGCAATGCCAATAGGAGCTCTGAACCCAAAAAGAGCAGCATTCTTCGCTGAGCGTTATGAATCATGGGAA
GATGATCAAGTTCCAAAGTTTCACTATGGTACTCATTACTCAACTGCAAGTTTTGTTCTTGCATGGCTGCTAAGAATAGAACCCTTTACA
ACTTATTTCCTAAATTTGCAAGGAGGCAAATTTGATCATGCAGATCGAACTTTTTCATCAATTTCCAGAGCTTGGCGAAACAGTCAGCGT
GATACCTCTGATATTAAGGAGTTGATCCCTGAATTTTATTATCTCCCTGAGATGTTTGTCAACTTCAATAATTATAATCTTGGAGTGATG
GATGATGGGACAGTAGTGTCTGATGTCGAACTTCCTCCTTGGGCCAAAACCTCAGAAGAATTTGTTCACATAAACAGATTGGCCCTGGAG
AGTGAATTTGTTTCCTGCCAGCTTCACCAATGGATTGATCTCATTTTTGGCTATAAACAGCAAGGACCAGAAGCTGTCCGAGCCCTCAAT
GTGTTCTATTACTTGACCTATGAAGGAGCTGTCAATCTGAATTCAATAACTGATCCTGTGTTGAGAGAGGCTGTTGAAGCTCAAATCCGA
AGTTTTGGACAGACTCCTTCTCAACTACTCATAGAGCCCCATCCTCCCAGAGGTTCTGCCATGCAAGTGAGTCCATTGATGTTCACAGAC
AAAGCCCAGCAGGATGTTATCATGGTCCTCAAGTTTCCCTCCAACTCCCCTGTTACTCACGTGGCAGCCAACACCCAGCCTGGTTTGGCA
ACTCCCGCTGTGATCACAGTCACTGCTAACAGGTTATTTGCGGTGAACAAATGGCACAACCTTCCTGCTCATCAAGGTGCTGTACAAGAC
CAGCCATACCAGCTGCCAGTGGAAATCGATCCTCTCATAGCCAGCAATACAGGAATGCACAGGAGGCAAATCACTGACCTTTTAGACCAA
AGTATTCAAGTGCATTCCCAGTGCTTTGTCATCACTTCAGACAACCGCTATATTCTCGTCTGTGGCTTCTGGGATAAAAGTTTCAGAGTC
TATTCTACAGACACAGGAAGATTGATCCAAGTGGTGTTTGGCCATTGGGATGTCGTCACTTGCCTTGCTCGTTCTGAGTCATATATTGGG
GGAAATTGCTACATTCTCTCAGGGTCACGTGATGCAACTCTTTTGCTGTGGTATTGGAATGGAAAATGCAGTGGGATTGGAGATAACCCA
GGTGAGACTGCTGCTCCTCGGGCCATTTTGACCGGCCATGACTATGAGGTCACATGTGCTGCGGTGTGTGCGGAGCTAGGCCTGGTGTTG
AGTGGTTCACAAGAAGGACCATGTCTCATACATTCCATGAATGGAGACTTGTTGAGGACCTTGGAGGGTCCTGAAAACTGCCTGAAACCA
AAACTCATTCAGGCTTCAAGAGAGGGTCATTGTGTCATATTCTATGAAAACGGCCTCTTCTGTACATTCAGTGTGAATGGAAAACTCCAG
GCCACGATGGAAACAGATGATAACATAAGAGCCATCCAGCTGAGCCGAGATGGGCAGTACCTGCTCACAGGAGGAGACAGAGGAGTGGTC
GTGGTCCGGCAGGTGTCGGACCTCAAGCAGCTCTTTGCCTATCCAGGATGTGACGCTGGAATCCGGGCCATGGCGCTGTCTTACGACCAG
AGGTGCATCATTTCTGGCATGGCTTCAGGAAGCATTGTGCTATTTTACAACGACTTTAACCGGTGGCATCATGAATACCAAACCCGCTAC
TGATGGTGACAGCTGTACATCAACTCTGCCCCTAGGATGAGCAGAAGTACCTGGAGCATCATTCTCTTCTACCACATCTGAATGTAACTT
AAATTTGCTCAAAGAAGCAAAATATTTTTTAAAGTTATTAATAATTGCTATTTTTGTAGTCTTTGCTTGACTTTTTTGGGGGGGATTAGC
AAAGCAGAAAACTGGCTGCTGGGTTCTGTAGTTTTAAAAAATCTATATTTTTAGTCATAATGAGAAGTCTATTTTCACCAATTATGGAAA
CATACAGTGGAGCAAGTAAACCACTTATTCCAGCTATAATATTATGAAGAACATTTCCCATGCATCTACAAGCTTGAGAAATAGGATTTT
CACAGTGGGGAAGTGGGTTACAATATTGGAATAGGAAAATTTGATGCTGTAATTTGGGTCCTGTATTTTTCCAAACAACTGTGCTTCTTC
AGCACTAATATTTCTGGGATTTAAATAGTAATGTTTAAATTATGGTAAATGTAATTTAAAACATCTCAATTAAGTCTGTCTATCAATATT
GTTCTTCAAGCATGTTTTAGACCTAGAAAAGTATGGTTTGGGGGAGGCTATTTTATTGTGTGGTTAGCACAAGGAATCTAATTTATAGCA
AGTGTGAAATAGTTACCATTTTTTCCTGATCTGTCATCTTCATAGCACAACAAAACGAAATGATGGAAATGCTCTTGAGCTCACAACATT
TGTTTTTCTTTTAAAGTAAATGCAAGTACCAAAGCTCACTACTGCGGTTTGCCTGTGCCTGGACAATGAGGCGGAGCCACTGTTGTTTTG
TTGGGGCACCCCCTTCCCTCCCCGGGTTTGCAAATAGAGGCTACCGGGTGCTGTATTCAGCAACACCTGTTTTACTATTTGTTATTAAAC
TATCATCTCCACCTTCCTTTTGATTAGCAATTTGTACTAAGAAACGAAACAATGTTATTTGGTGGTGTATAATTCTACTTTTCTAGTAGA
TTACTGTGTGGAATTCTGTGAAAAATATTTGAGAAAAGGCCTGTATTGCATAAATAAATTCTTTGTATGTTGTGAACTTTGATCTCTATT
TCTCTTGCAACAGACTTCAAGTGGTCCCTCTTTTTTTCCTACACACTCAGCTCTTCTCTAAAAGCAAGGATTTGGAATGAACAATTCAGT


Top

FusionGenePPI for SMARCA5_LRBA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMARCA5DNMT3B, BAZ2A, BAZ1A, POLE3, CHRAC1, BAZ1B, SATB1, RAD21, HDAC2, RBBP4, CHD3, SMC1A, SMC3, CDT1, CTNNB1, HIST1H4A, MAF, CREB1, MYO1C, SIN3A, RSF1, MCM3, HIST2H2AB, HIST1H3A, DNMT1, CENPA, USF1, XRCC5, MYC, SMARCAD1, SOX2, CECR2, UBTF, POLR1A, MYBBP1A, HDGF, CEBPB, CUL5, CDK2, SAP18, SMARCC2, HDAC1, SMARCC1, MBD3, SMARCA1, RUVBL1, RUVBL2, POLR3A, MSH2, S100A9, IK, SEPT2, EIF4A3, PHGDH, SEPT7, NCSTN, PRKDC, RBM14, HNRNPM, SFPQ, HNRNPR, PPP1CA, NOTCH1, RNF168, VCP, SS18, SSX2, SMARCA5, LMNA, RPA3, RPA2, RPA1, BRCA1, C17orf49, CUL7, OBSL1, CCDC8, SUZ12, EED, RNF2, BMI1, ABCE1, RBBP7, NTRK1, COPS3, INO80, IPO9, POLR1C, POLR3B, SCARNA22, IFI16, DAXX, HNRNPU, NPM1, RPL10, NLRP3, MAX, NFATC1, RBPJ, TEAD2, TP53, FOXB1, FOXC1, FOXC2, FOXE1, FOXG1, FOXJ2, FOXJ3, FOXK2, FOXL1, BEND3, FOXM1, FOXQ1, FOXR1, FOXS1, SNW1, CDC5L, NFATC2, RPL30, NCL, COX15, DLST, PDHA1, MTF1LRBATUSC2, NOTCH1, FN1, BAG3, CAST, KIF15, DCAF11, INPPL1, MLF2, VCP, MOV10, RIC3, CT55, PARP16, RD3, TMEM52B, MED4, TMEM17, TMEM216, NCR3LG1, PVR, FAM196A, EPHA1, GYPB, DLK2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMARCA5_LRBA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SMARCA5_LRBA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLRBAC3553512IMMUNODEFICIENCY, COMMON VARIABLE, 8, WITH AUTOIMMUNITY1ORPHANET;UNIPROT