FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34770

FusionGeneSummary for SMAP1_NBEA

check button Fusion gene summary
Fusion gene informationFusion gene name: SMAP1_NBEA
Fusion gene ID: 34770
HgeneTgene
Gene symbol

SMAP1

NBEA

Gene ID

60682

26960

Gene namesmall ArfGAP 1neurobeachin
SynonymsSMAP-1BCL8B|LYST2
Cytomap

6q13

13q13.3

Type of geneprotein-codingprotein-coding
Descriptionstromal membrane-associated protein 1stromal membrane-associated GTPase-activating protein 1neurobeachinlysosomal-trafficking regulator 2
Modification date2018052320180519
UniProtAcc

Q8IYB5

Q8NFP9

Ensembl transtripts involved in fusion geneENST00000316999, ENST00000370452, 
ENST00000370455, ENST00000422334, 
ENST00000540320, ENST00000400445, 
ENST00000310336, ENST00000379939, 
ENST00000537702, ENST00000379922, 
ENST00000461581, 
Fusion gene scores* DoF score6 X 5 X 5=1506 X 6 X 3=108
# samples 66
** MAII scorelog2(6/150*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SMAP1 [Title/Abstract] AND NBEA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DR000261SMAP1chr6

71377845

+NBEAchr13

35864524

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000316999ENST00000540320SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000316999ENST00000400445SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000316999ENST00000310336SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000316999ENST00000379939SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000316999ENST00000537702SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000316999ENST00000379922SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000316999ENST00000461581SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370452ENST00000540320SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370452ENST00000400445SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370452ENST00000310336SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370452ENST00000379939SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000370452ENST00000537702SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000370452ENST00000379922SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000370452ENST00000461581SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370455ENST00000540320SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370455ENST00000400445SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370455ENST00000310336SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000370455ENST00000379939SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000370455ENST00000537702SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000370455ENST00000379922SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000370455ENST00000461581SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000422334ENST00000540320SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000422334ENST00000400445SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000422334ENST00000310336SMAP1chr6

71377845

+NBEAchr13

35864524

+
In-frameENST00000422334ENST00000379939SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000422334ENST00000537702SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000422334ENST00000379922SMAP1chr6

71377845

+NBEAchr13

35864524

+
5CDS-intronENST00000422334ENST00000461581SMAP1chr6

71377845

+NBEAchr13

35864524

+

Top

FusionProtFeatures for SMAP1_NBEA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMAP1

Q8IYB5

NBEA

Q8NFP9

GTPase activating protein that acts on ARF6. Plays arole in clathrin-dependent endocytosis. May play a role inerythropoiesis (By similarity). {ECO:0000250}. Binds to type II regulatory subunits of protein kinase Aand anchors/targets them to the membrane. May anchor the kinase tocytoskeletal and/or organelle-associated proteins (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0132147_2255-159525DomainBEACH-type PH
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0132274_2563-159525DomainBEACH
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33582147_225519252947DomainBEACH-type PH
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33582274_256319252947DomainBEACH
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0182147_2255-42740DomainBEACH-type PH
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0182274_2563-42740DomainBEACH
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0131326_1368-159525RepeatWD 1
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0132718_2761-159525RepeatWD 2
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0132778_2818-159525RepeatWD 3
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0132860_2899-159525RepeatWD 4
TgeneNBEAchr6:71377845chr13:35864524ENST00000379922+0132902_2941-159525RepeatWD 5
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33582718_276119252947RepeatWD 2
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33582778_281819252947RepeatWD 3
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33582860_289919252947RepeatWD 4
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33582902_294119252947RepeatWD 5
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0181326_1368-42740RepeatWD 1
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0182718_2761-42740RepeatWD 2
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0182778_2818-42740RepeatWD 3
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0182860_2899-42740RepeatWD 4
TgeneNBEAchr6:71377845chr13:35864524ENST00000537702+0182902_2941-42740RepeatWD 5

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSMAP1chr6:71377845chr13:35864524ENST00000316999+11018_13639441DomainArf-GAP
HgeneSMAP1chr6:71377845chr13:35864524ENST00000370452+11118_13639437DomainArf-GAP
HgeneSMAP1chr6:71377845chr13:35864524ENST00000370455+11118_13639468DomainArf-GAP
HgeneSMAP1chr6:71377845chr13:35864524ENST00000316999+11033_5639441Zinc fingerC4-type
HgeneSMAP1chr6:71377845chr13:35864524ENST00000370452+11133_5639437Zinc fingerC4-type
HgeneSMAP1chr6:71377845chr13:35864524ENST00000370455+11133_5639468Zinc fingerC4-type
TgeneNBEAchr6:71377845chr13:35864524ENST00000400445+33581326_136819252947RepeatWD 1


Top

FusionGeneSequence for SMAP1_NBEA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_1061aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKD
HIVRVANEAEFILNRQRAEDVHKHAEFESQCAQTAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFW
RLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIETGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLST
PAQLIAPVVVAKGTLSITTTEIYFEVDEDDSAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQAT
VKKVVTSLPRVGVGTSTGLPQARRISLATPRQLTKSSNMTQRWQRREISNFETLMFLNTIAGRTTNDLNQTPVFPWVLTNTESEELDLTL
PGNFRDLSKPIGALNPKRAVFTAERTETWEDDQSPPYHTNTHTSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQR
DTSDVKELIPEFYYLPEMFVNSNGTNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGTKQRGPEAVRALN
VFHYLTTEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANT
LPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRTILICG
FWDKSFRVTSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDTPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYTERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_3183nt
ATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAAC
AAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAG
GAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGAC
CATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAG
TGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCA
AATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGG
CGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAA
GCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACA
GAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACC
CCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGAT
TCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTT
TCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACA
GTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCT
CGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATT
GCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTT
CCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAA
GATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACA
ACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGA
GATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGA
GAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAA
AGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAAT
GTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAG
AACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCG
CTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACT
CTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGA
GGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGG
CAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGA
TTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTG
GCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGG
CACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTT
TCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCC
CTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTC
AGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAAC
CTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGC
ATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000316999_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_5176nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370452_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_5176nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_5175nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000370455_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_5176nt
AGTCCCCCTCCCCCTCCCCTCGCCGGCTAGGGTGGTGCGTGCCGGCAGGCCGGTCAAGGAGGCGGGACACGTCGGCGCTACCACCGCCAC
CGCCGCCGCCGCCCCTCCTCCCGTTCCAGCTGCCGCTGCCGCTTCCTGGGCTGAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCA
CTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCCCCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGG
AGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCTGAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGG
CCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTATGCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGA
AGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTGCCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATG
AAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGCAGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATA
GAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCGAGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTC
TCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCAATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATG
ATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGCTGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGG
AAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAACCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACG
ATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCCAGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCG
TGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGAGGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACA
CGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGAGATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAA
ACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTTCCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCT
TGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGATATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCA
ATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGATGTTCCTTAATACTATTGCAGGACGGACATATAATGATC
TGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGAGTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTAT
CAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCGTTATGAGACATGGGAAGATGATCAAAGCCCACCCTACC
ATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCGAATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATG
ATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTGGAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAAC
TAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATATAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATG
ATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAACAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAAC
TTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGCAGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATG
AAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCATGGAGGCACAGATACAGAACTTTGGACAGACGCCATCTC
AGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTTCCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGC
AACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCATGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCG
CAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAACACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGG
ATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTCAGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACC
AGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTATATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAG
TTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGATGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTG
GTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTGGTACTGGAGTGGGCGGCACCATATCATAGGAGACAACC
CTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCATGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGC
TTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGGAGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCT
TATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTATGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGA
AACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAGCAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATG
GGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCCTGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCC
ATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTTTAATATAGATTTTAATCGGTGGCATTATGAGCATCAGA
ACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCACAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAA
AACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGCTGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTT
TTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATTATATGAATTAGGAGATGTTTTGGTAATTATTTCATATA
TTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACAATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTA
AGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAAAAAAAAAAAAAACACGTTTGATACTTTGTACATCAGAT
GCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAACAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTG
CATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAAACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAG
GGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGTTTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAA
ATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTACTTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTT
GAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTATAAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACT
TCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTATACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTT
CTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATTACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGA
AATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGATATAAAATGATGGCTATCAAATGATTTTCCATACATTGT
ACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCTTTGTATATTTGGTGACTGTATCGTCATAGATGTACATA
TTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAATTTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAA
CAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTATTTATTGATGTGATTACTTATTTGTTATCCACCTTGTAC
TAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAATTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTA
TTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAGGATACTTAACATCTGGAAGACAAGTTCATTTCATCTTG
AGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCATGTTTTATTGCAAAGATGTAAAATATGCCAGATGTGTG

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000540320_chr13_35864524_+_5033nt
GAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCACTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCC
CCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCT
GAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTAT
GCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTG
CCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGC
AGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCG
AGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCA
ATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGC
TGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAA
CCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCC
AGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGA
GGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGA
GATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTT
CCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGAT
ATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGAT
GTTCCTTAATACTATTGCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGA
GTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCG
TTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCG
AATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTG
GAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATA
TAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAA
CAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGC
AGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCAT
GGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTT
CCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCA
TGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAA
CACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTC
AGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTA
TATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGA
TGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTG
GTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCA
TGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGG
AGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTA
TGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAG
CAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCC
TGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTT
TAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCA
CAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGC
TGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATT
ATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACA
ATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAA
AAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAA
CAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAA
ACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGT
TTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTAC
TTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTAT
AAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTAT
ACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATT
ACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGAT
ATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCT
TTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAAT
TTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTAT
TTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAA
TTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAG
GATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCA

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000400445_chr13_35864524_+_5033nt
GAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCACTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCC
CCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCT
GAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTAT
GCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTG
CCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGC
AGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCG
AGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCA
ATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGC
TGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAA
CCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCC
AGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGA
GGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGA
GATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTT
CCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGAT
ATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGAT
GTTCCTTAATACTATTGCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGA
GTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCG
TTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCG
AATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTG
GAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATA
TAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAA
CAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGC
AGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCAT
GGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTT
CCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCA
TGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAA
CACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTC
AGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTA
TATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGA
TGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTG
GTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCA
TGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGG
AGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTA
TGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAG
CAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCC
TGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTT
TAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCA
CAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGC
TGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATT
ATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACA
ATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAA
AAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAA
CAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAA
ACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGT
TTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTAC
TTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTAT
AAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTAT
ACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATT
ACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGAT
ATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCT
TTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAAT
TTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTAT
TTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAA
TTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAG
GATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCA

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000310336_chr13_35864524_+_5033nt
GAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCACTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCC
CCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCT
GAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTAT
GCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTG
CCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGC
AGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCG
AGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCA
ATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGC
TGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAA
CCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCC
AGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGA
GGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGA
GATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTT
CCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGAT
ATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGAT
GTTCCTTAATACTATTGCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGA
GTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCG
TTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCG
AATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTG
GAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATA
TAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAA
CAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGC
AGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCAT
GGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTT
CCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCA
TGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAA
CACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTC
AGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTA
TATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGA
TGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTG
GTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCA
TGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGG
AGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTA
TGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAG
CAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCC
TGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTT
TAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCA
CAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGC
TGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATT
ATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACA
ATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAA
AAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAA
CAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAA
ACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGT
TTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTAC
TTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTAT
AAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTAT
ACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATT
ACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGAT
ATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCT
TTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAAT
TTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTAT
TTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAA
TTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAG
GATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCA

>In-frame_SMAP1_ENST00000422334_chr6_71377845_+_NBEA_ENST00000379939_chr13_35864524_+_5034nt
GAGTCCGCCCGCGGTCCCGGCGGCGCCAGGTGCGTTCACTCTGCCCGGCTCCAGCCAGCGTCCGCCGCCGCCGTAGCTGCCCCAGGCTCC
CCGCCCCGCTGCCGAGATGGCGACGCGCTCCTGTCGGGAGAAGGCTCAGAAGCTGAACGAGCAGCACCAGCTCATCCTATCCAAGCTTCT
GAGGGAGGAGGACAACAAGTACTGCGCCGACTGCGAGGCCAAAGGCCTTGTTTGTATGAAGTCCAGCACATCTGTGGTTGAGCTTGTTAT
GCTGCTTTGTTCTCAGGAATGGCAAAACTCTATTCAGAAGAATGCAGGACTTGCATTTATTGAGCTCATCAATGAAGGAAGATTACTGTG
CCATGCTATGAAGGACCATATAGTCCGTGTTGCAAATGAAGCTGAGTTTATTTTGAACAGACAAAGAGCCGAGGATGTACATAAACATGC
AGAGTTTGAGTCACAGTGTGCCCAATATGCTGCTGATAGAAGAGAGGAAGAAAAGATGTGTGACCATCTTATCAGTGCTGCTAAACATCG
AGATCATGTAACAGCAAATCAGCTGAAACAGAAGATTCTCAATATTCTCACAAATAAACATGGTGCTTGGGGAGCAGTTTCTCATAGCCA
ATTGCATGATTTCTGGCGTTTGGATTACTGGGAAGATGATCTTCGTCGAAGGAGACGATTTGTTCGCAATGCATTTGGCTCCACTCATGC
TGAAGCATTGCTGAAAGCTGCAATAGAATATGGCACGGAAGAAGATGTAGTAAAGTCAAAGAAAACATTCAGAAGTCAAGCAATAGTGAA
CCAAAATGCAGAGACAGAACTTATGCTGGAAGGAGACGATGATGCAGTCAGTCTGCTACAGGAGAAAGAAATTGACAACCTTGCAGGCCC
AGTGGTTCTCAGCACCCCTGCCCAGCTCATCGCTCCCGTGGTGGTGGCCAAGGGGACTCTCTCCATCACCACGACAGAAATCTACTTCGA
GGTAGATGAGGATGATTCTGCCTTCAAGAAGATCGACACGAAAGTTCTTGCATACACTGAGGGACTTCACGGAAAATGGATGTTCAGCGA
GATACGAGCTGTATTTTCAAGACGTTACCTTCTACAAAACACTGCTTTGGAAGTATTTATGGCAAACCGAACCTCAGTTATGTTTAATTT
CCCTGATCAAGCAACAGTAAAAAAAGTTGTCTATAGCTTGCCTCGGGTTGGAGTAGGGACCAGCTATGGTCTGCCACAAGCCAGGAGGAT
ATCATTGGCCACTCCTCGACAGCTTTATAAATCTTCCAATATGACTCAGCGCTGGCAAAGAAGGGAAATTTCAAACTTCGAATATTTGAT
GTTCCTTAATACTATTGCAGGACGGACATATAATGATCTGAACCAATATCCAGTGTTTCCGTGGGTGTTAACCAACTATGAATCAGAAGA
GTTGGACCTGACTCTTCCAGGAAACTTCAGGGATCTATCAAAGCCAATTGGTGCTTTGAACCCCAAGAGAGCTGTGTTTTATGCAGAGCG
TTATGAGACATGGGAAGATGATCAAAGCCCACCCTACCATTATAATACCCATTATTCAACAGCAACATCTACTTTATCCTGGCTTGTTCG
AATTGAACCTTTCACAACCTTCTTCCTCAATGCAAATGATGGAAAATTTGATCATCCAGATCGAACCTTCTCATCCGTTGCAAGGTCTTG
GAGAACTAGTCAGAGAGATACTTCTGATGTAAAGGAACTAATTCCAGAGTTCTACTACCTACCAGAGATGTTTGTCAACAGTAATGGATA
TAATCTTGGAGTCAGAGAAGATGAAGTAGTGGTAAATGATGTTGATCTTCCCCCTTGGGCAAAAAAACCTGAAGACTTTGTGCGGATCAA
CAGGATGGCCCTAGAAAGTGAATTTGTTTCTTGCCAACTTCATCAGTGGATCGACCTTATATTTGGCTATAAGCAGCGAGGACCAGAAGC
AGTTCGTGCTCTGAATGTTTTTCACTACTTGACTTATGAAGGCTCTGTGAACCTGGATAGTATCACTGATCCTGTGCTCAGGGAGGCCAT
GGAGGCACAGATACAGAACTTTGGACAGACGCCATCTCAGTTGCTTATTGAGCCACATCCGCCTCGGAGCTCTGCCATGCACCTGTGTTT
CCTTCCACAGAGTCCGCTCATGTTTAAAGATCAGATGCAACAGGATGTGATAATGGTGCTGAAGTTTCCTTCAAATTCTCCAGTAACCCA
TGTGGCAGCCAACACTCTGCCCCACTTGACCATCCCCGCAGTGGTGACAGTGACTTGCAGCCGACTCTTTGCAGTGAATAGATGGCACAA
CACAGTAGGCCTCAGAGGAGCTCCAGGATACTCCTTGGATCAAGCCCACCATCTTCCCATTGAAATGGATCCATTAATAGCCAATAATTC
AGGTGTAAACAAACGGCAGATCACAGACCTCGTTGACCAGAGTATACAAATCAATGCACATTGTTTTGTGGTAACAGCAGATAATCGCTA
TATTCTTATCTGTGGATTCTGGGATAAGAGCTTCAGAGTTTATTCTACAGAAACAGGGAAATTGACTCAGATTGTATTTGGCCATTGGGA
TGTGGTCACTTGCTTGGCCAGGTCCGAGTCATACATTGGTGGGGACTGCTACATCGTGTCCGGATCTCGAGATGCCACCCTGCTGCTCTG
GTACTGGAGTGGGCGGCACCATATCATAGGAGACAACCCTAACAGCAGTGACTATCCGGCACCAAGAGCCGTCCTCACAGGCCATGACCA
TGAAGTTGTCTGTGTTTCTGTCTGTGCAGAACTTGGGCTTGTTATCAGTGGTGCTAAAGAGGGCCCTTGCCTTGTCCACACCATCACTGG
AGATTTGCTGAGAGCCCTTGAAGGACCAGAAAACTGCTTATTCCCACGCTTGATATCTGTCTCCAGCGAAGGCCACTGTATCATATACTA
TGAACGAGGGCGATTCAGTAATTTCAGCATTAATGGGAAACTTTTGGCTCAAATGGAGATCAATGATTCAACACGGGCCATTCTCCTGAG
CAGTGACGGCCAGAACCTGGTCACCGGAGGGGACAATGGGGTAGTAGAGGTCTGGCAGGCCTGTGACTTCAAGCAACTGTACATTTACCC
TGGATGTGATGCTGGCATTAGAGCAATGGACTTGTCCCATGACCAGAGGACTCTGATCACTGGCATGGCTTCTGGTAGCATTGTAGCTTT
TAATATAGATTTTAATCGGTGGCATTATGAGCATCAGAACAGATACTGAAGATAAAGGAAGAACCAAAAGCCAAGTTAAAGCTGAGAGCA
CAAGTGCTGCATGGAAAGGCAATATCTCTGGTGGAAAAAACTCGTCTACATCGACCTCCGTTTGTACATTCCATCACACCCAGCAATAGC
TGTACATTGTAGTCAGCAACCATTTTACTTTGTGTGTTTTTTCACGACTGAACACCAGCTGCTATCAAGCAAGCTTATATCATGTAAATT
ATATGAATTAGGAGATGTTTTGGTAATTATTTCATATATTGTTGTTTATTGAGAAAAGGTTGTAGGATGTGTCACAAGAGACTTTTGACA
ATTCTGAGGAACCTTGTGTCCAGTTGTTACAAAGTTTAAGCTTTGAACCTAACCTGCATCCCATTTCCAGCCTCTTTTCAAGCTGAGAAA
AAAAAAAAAAAACACGTTTGATACTTTGTACATCAGATGCATCTTATTTAAAAGGGATACTTTTGTAAAAGTAAAACCTTGTATAAAGAA
CAAAATGTTTCTTAATTTTATTGTGGAGTTACAACTTGCATGTTCCTTACTCCTGTTGGCTTGATGGAACAGGTGCATTCACACTATGAA
ACAGAAAGATCTGTCCAAGGACACAGCTTGTATGAAAGGGTTGAATTTGGGCTCCATCAGTAATTTTTGACATTTTCACCAAAATATAGT
TTGCACTTTTTAATCTAAAGTCATCCCTTCTGAGTGAAATTTGCTCATAAAGCATTTGGATACTAAGCCATTATTTGCCATTTTGGGTAC
TTTATACAAAGAAAATTCAGCCCTACCCTGCATAATTTGAAGACACAGCAGAAAGGGGGCTTAGGGATGAGGTCCTGGTTTTTCTTGTAT
AAATAGGAGTCATGGGCGTTAGTTCTGTAGTAATAACTTCCCAGCACCTGGACATCTCTTCCAGAGTTATCCCACTGGCTTGGTGTGTAT
ACATTAGGGGAGGATAATCTGATGCTAACTTTTTTTTTCTCTTTGGTTCTTGAATAGCTTAGTTTCTTTAATAACAAGTCAAACTTTATT
ACAACAATAACTGAAGTTATTCTTTTAGGTTCTCGTGAAATTCTCACTGAAAGCCACATTCTTAGCCTAAGGCATTTCATCTTTTATGAT
ATAAAATGATGGCTATCAAATGATTTTCCATACATTGTACTGATCAAGTTATACACCCAGGGGTATATACACTTTCTTCATGTTTCTTCT
TTGTATATTTGGTGACTGTATCGTCATAGATGTACATATTGTGTCGGTAGGGCTATGAGGCATGTTACAGGAATGTAATTTTCTCAGAAT
TTACACTCACTCGCAGTCATTTATTTAAAAAGATAAAACAAGATAATGGGTTCTTTGTATTGGCACTTTGCACCAGAAACATATCATTAT
TTATTGATGTGATTACTTATTTGTTATCCACCTTGTACTAGTAAGTTTTAGCACTGAATTCCTTCTTCACTGTTGTTTGTATTTATGAAA
TTCTGAAATTATGGGGAATCAGCGTAATGATTAAGTTATTCATCACCAGGCTGTAAGCAATATCTTGAGTTTGTAGCTTAGAATTGGGAG
GATACTTAACATCTGGAAGACAAGTTCATTTCATCTTGAGATCATGGTGAAATATTTTGGATATATAAATTCCTTAAGCTATTGTAACCA


Top

FusionGenePPI for SMAP1_NBEA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMAP1BRF2, PHLDA3, PTP4A3, WRAP73, APP, MICU2, HSPA1L, KLHL18, XPO1NBEASTRN4, DTNBP1, NOTCH1, VCP, FOSL2, RD3, TMEM17, PTPRH, ALOXE3, SHC4, RBM48, MRPL21, NAB2, STRADB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMAP1_NBEA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SMAP1_NBEA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNBEAC0004352Autistic Disorder2CTD_human
TgeneNBEAC0023893Liver Cirrhosis, Experimental1CTD_human