FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34728

FusionGeneSummary for SMAD2_C10orf90

check button Fusion gene summary
Fusion gene informationFusion gene name: SMAD2_C10orf90
Fusion gene ID: 34728
HgeneTgene
Gene symbol

SMAD2

C10orf90

Gene ID

4087

118611

Gene nameSMAD family member 2chromosome 10 open reading frame 90
SynonymsJV18|JV18-1|MADH2|MADR2|hMAD-2|hSMAD2FATS|bA422P15.2
Cytomap

18q21.1

10q26.2

Type of geneprotein-codingprotein-coding
Descriptionmothers against decapentaplegic homolog 2MAD homolog 2SMAD, mothers against DPP homolog 2Sma- and Mad-related protein 2mother against DPP homolog 2centrosomal protein C10orf90fragile-site associated tumor suppressor homolog
Modification date2018052220180523
UniProtAcc

Q15796

Q96M02

Ensembl transtripts involved in fusion geneENST00000262160, ENST00000402690, 
ENST00000356825, ENST00000586040, 
ENST00000591214, ENST00000587353, 
ENST00000454341, ENST00000284694, 
ENST00000544758, ENST00000356858, 
ENST00000480379, ENST00000368674, 
ENST00000392694, 
Fusion gene scores* DoF score6 X 4 X 6=1443 X 2 X 2=12
# samples 73
** MAII scorelog2(7/144*10)=-1.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SMAD2 [Title/Abstract] AND C10orf90 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSMAD2

GO:0007179

transforming growth factor beta receptor signaling pathway

8752209|9389648|9732876|18548003

HgeneSMAD2

GO:0007182

common-partner SMAD protein phosphorylation

16806156

HgeneSMAD2

GO:0007183

SMAD protein complex assembly

9111321

HgeneSMAD2

GO:0045893

positive regulation of transcription, DNA-templated

9311995|9389648|9732876

HgeneSMAD2

GO:0045944

positive regulation of transcription by RNA polymerase II

9389648

HgeneSMAD2

GO:0070723

response to cholesterol

17878231


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-97-7937-01ASMAD2chr18

45394694

-C10orf90chr10

128202508

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000262160ENST00000454341SMAD2chr18

45394694

-C10orf90chr10

128202508

-
Frame-shitENST00000262160ENST00000284694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
Frame-shitENST00000262160ENST00000544758SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000262160ENST00000356858SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-intronENST00000262160ENST00000480379SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000262160ENST00000368674SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000262160ENST00000392694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000402690ENST00000454341SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000402690ENST00000284694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000402690ENST00000544758SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000402690ENST00000356858SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-intronENST00000402690ENST00000480379SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000402690ENST00000368674SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000402690ENST00000392694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000356825ENST00000454341SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000356825ENST00000284694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000356825ENST00000544758SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000356825ENST00000356858SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-intronENST00000356825ENST00000480379SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000356825ENST00000368674SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000356825ENST00000392694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000586040ENST00000454341SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000586040ENST00000284694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000586040ENST00000544758SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000586040ENST00000356858SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-intronENST00000586040ENST00000480379SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000586040ENST00000368674SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000586040ENST00000392694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000591214ENST00000454341SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000591214ENST00000284694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
In-frameENST00000591214ENST00000544758SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000591214ENST00000356858SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-intronENST00000591214ENST00000480379SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000591214ENST00000368674SMAD2chr18

45394694

-C10orf90chr10

128202508

-
5CDS-5UTRENST00000591214ENST00000392694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-3CDSENST00000587353ENST00000454341SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-3CDSENST00000587353ENST00000284694SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-3CDSENST00000587353ENST00000544758SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-5UTRENST00000587353ENST00000356858SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-intronENST00000587353ENST00000480379SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-5UTRENST00000587353ENST00000368674SMAD2chr18

45394694

-C10orf90chr10

128202508

-
intron-5UTRENST00000587353ENST00000392694SMAD2chr18

45394694

-C10orf90chr10

128202508

-

Top

FusionProtFeatures for SMAD2_C10orf90


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMAD2

Q15796

C10orf90

Q96M02

Receptor-regulated SMAD (R-SMAD) that is anintracellular signal transducer and transcriptional modulatoractivated by TGF-beta (transforming growth factor) and activintype 1 receptor kinases. Binds the TRE element in the promoterregion of many genes that are regulated by TGF-beta and, onformation of the SMAD2/SMAD4 complex, activates transcription. Mayact as a tumor suppressor in colorectal carcinoma. Positivelyregulates PDPK1 kinase activity by stimulating its dissociationfrom the 14-3-3 protein YWHAQ which acts as a negative regulator.{ECO:0000269|PubMed:16751101, ECO:0000269|PubMed:16862174,ECO:0000269|PubMed:17327236, ECO:0000269|PubMed:19289081,ECO:0000269|PubMed:9892009}. Tumor suppressor that is required to sustain G2/Mcheckpoint after DNA damage. Mediates CDKN1A/p21 protein stabilityin a ubiquitin-independent manner (By similarity). May have a rolein the assembly of primary cilia. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SMAD2_C10orf90


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_814aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTP
NTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMID
ENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGP
PARALVWGTAGDSLCPKCRAEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTP
LSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQD
LVGQRWNPGLQESHLKETPSLRRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAGDYTC
CDLVVKIKECKKSEDPTTPEPSPAAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRK
EDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQR

>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_911aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTP
NTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMID
ENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGP
PARALVWGTAGDSLCPKCRAEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTP
LSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQD
LVGQRWNPGLQESHLKETPSLRRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKV
FSGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKF
PKGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQ
QRKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQL

>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_911aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTP
NTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMID
ENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGP
PARALVWGTAGDSLCPKCRAEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTP
LSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQD
LVGQRWNPGLQESHLKETPSLRRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKV
FSGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKF
PKGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQ
QRKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQL

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_784aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAP
RDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLF

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_881aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVFSGSSKRQQGEVCMTVSAPPVEQKPTRHFL
PIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSP
AAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPH

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_881aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVFSGSSKRQQGEVCMTVSAPPVEQKPTRHFL
PIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSP
AAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPH

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_784aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAP
RDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLF

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_881aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVFSGSSKRQQGEVCMTVSAPPVEQKPTRHFL
PIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSP
AAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPH

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_881aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVFSGSSKRQQGEVCMTVSAPPVEQKPTRHFL
PIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSP
AAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPH

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_784aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAP
RDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPHPLSDNLF

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_881aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVFSGSSKRQQGEVCMTVSAPPVEQKPTRHFL
PIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSP
AAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPH

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_881aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLA
NRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASITITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPA
LANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDK
SLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSLRRVHLGTGA
CPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVFSGSSKRQQGEVCMTVSAPPVEQKPTRHFL
PIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPLQDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSP
AAPSPAPRDGAGSPGLSEDCSESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_2442nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGCACTTGCTCTGAAATTTGGGGACTGAGTACACCA
AATACGATAGATCAGTGGGATACAACAGGCCTTTACAGCTTCTCTGAACAAACCAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGGAGATTACACATGC
TGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCC
CGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTG
GAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAG
GAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTC
AAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAA
GAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGG

>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_2733nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGCACTTGCTCTGAAATTTGGGGACTGAGTACACCA
AATACGATAGATCAGTGGGATACAACAGGCCTTTACAGCTTCTCTGAACAAACCAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_2733nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGCACTTGCTCTGAAATTTGGGGACTGAGTACACCA
AATACGATAGATCAGTGGGATACAACAGGCCTTTACAGCTTCTCTGAACAAACCAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_2352nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGGAGATTACACATGC
TGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCC
CGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTG
GAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAG
GAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTC
AAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAA
GAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGG

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_2643nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_2643nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_2352nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGGAGATTACACATGC
TGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCC
CGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTG
GAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAG
GAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTC
AAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAA
GAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGG

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_2643nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_2643nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_2352nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGGAGATTACACATGC
TGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCC
CGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTG
GAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAG
GAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTC
AAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAA
GAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGG

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_2643nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_2643nt
ATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGA
GGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAG
CTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGA
AAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAA
TATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTG
CCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATT
GAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTC
ACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGAT
GAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCT
AACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAG
GCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCC
CCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCT
CTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTT
CCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCA
CTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAG
TCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCAC
AGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGAC
CTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCT
TGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGAC
CATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTA
TTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTT
CCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCC
AGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTC
CCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCA
GCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCT
TTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAG
CAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCAT
CCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTG
CCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_3692nt
GGGAGGCGGGGCGGGCCGTAGGCAAAGGGAGGTGGGGAGGCGGTGGCCGGCGACTCCCCGCGCCCCGCTCGCCCCCCGGCCCTTCCCGCG
GTGCTCGGCCTCGTTCCTTTCCTCCTCCGCTCCCTCCGTCTTCCATACCCGCCCCGCGCGGCTTTCGGCCGGCGTGCCTCGCGCCCTAAC
GGGCGGCTGGAGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCCCAGGGTGGCA
GGCGGGTCTACCCGCGCGGCCGCGGCGGCGGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGGCTG
TTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGA
AGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGG
TGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAA
GCACTTGCTCTGAAATTTGGGGACTGAGTACACCAAATACGATAGATCAGTGGGATACAACAGGCCTTTACAGCTTCTCTGAACAAACCA
GGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACA
GTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGA
GAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACT
CCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAG
ATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAA
TGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTC
AGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAG
GAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTG
CATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCA
GGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGT
TCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAG
ACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTC
AGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGAT
CCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAG
CCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCC
CATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAG
CTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTC
CTGGCTGGAGTTACAGGGCAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACAC
CTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAA
CGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTG
AACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGT
TCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAA
TCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCT
TCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGAGGA
CTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAAAGG
AAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAACCAC
CTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGATTTCTTCTCCCCTGCTGTTTCC
TGCCCATCAGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGGAATCTTTTACATCAAACTTTTGGGATCCAAATCCATCTCCT
TTTAAATTTCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTGGGTCATCATATAGTATATTTGAAACCTTTCTGAACATGTAC
ACCACCCAATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCAGCCCATCTCTTTGTGACCTGGAGC
AGTCAGAGGGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAGCTCTGACGTAACTTCAGTGTTTTC
TACAATACTCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCAACTTTGCTGTCTGTTCTTCCAAAT
GTTTATAATACACATTATTTATAAATATGTCTGTTTGGGAAGCTAAGAACAAGCTAGTTTTTACAACACAAATGGAAATAAATGCAATTA

>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_3983nt
GGGAGGCGGGGCGGGCCGTAGGCAAAGGGAGGTGGGGAGGCGGTGGCCGGCGACTCCCCGCGCCCCGCTCGCCCCCCGGCCCTTCCCGCG
GTGCTCGGCCTCGTTCCTTTCCTCCTCCGCTCCCTCCGTCTTCCATACCCGCCCCGCGCGGCTTTCGGCCGGCGTGCCTCGCGCCCTAAC
GGGCGGCTGGAGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCCCAGGGTGGCA
GGCGGGTCTACCCGCGCGGCCGCGGCGGCGGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGGCTG
TTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGA
AGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGG
TGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAA
GCACTTGCTCTGAAATTTGGGGACTGAGTACACCAAATACGATAGATCAGTGGGATACAACAGGCCTTTACAGCTTCTCTGAACAAACCA
GGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACA
GTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGA
GAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACT
CCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAG
ATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAA
TGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTC
AGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAG
GAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTG
CATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCA
GGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGT
TCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAG
ACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTC
AGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGAT
CCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAG
CCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCC
CATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAG
CTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTC
CTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTC
CTCCAGTGGAACAGAAGCCCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGC
CCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGC
AGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGA
AGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAG
ACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCAC
AAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCA
TCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGA
TGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTA
ACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCA
CACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTC
GATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAAC
AATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGAT
TTCTTCTCCCCTGCTGTTTCCTGCCCATCAGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGGAATCTTTTACATCAAACTTT
TGGGATCCAAATCCATCTCCTTTTAAATTTCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTGGGTCATCATATAGTATATTT
GAAACCTTTCTGAACATGTACACCACCCAATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCAGCC
CATCTCTTTGTGACCTGGAGCAGTCAGAGGGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAGCTC
TGACGTAACTTCAGTGTTTTCTACAATACTCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCAACT
TTGCTGTCTGTTCTTCCAAATGTTTATAATACACATTATTTATAAATATGTCTGTTTGGGAAGCTAAGAACAAGCTAGTTTTTACAACAC

>In-frame_SMAD2_ENST00000402690_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_3427nt
GGGAGGCGGGGCGGGCCGTAGGCAAAGGGAGGTGGGGAGGCGGTGGCCGGCGACTCCCCGCGCCCCGCTCGCCCCCCGGCCCTTCCCGCG
GTGCTCGGCCTCGTTCCTTTCCTCCTCCGCTCCCTCCGTCTTCCATACCCGCCCCGCGCGGCTTTCGGCCGGCGTGCCTCGCGCCCTAAC
GGGCGGCTGGAGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCCCAGGGTGGCA
GGCGGGTCTACCCGCGCGGCCGCGGCGGCGGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGGCTG
TTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGA
AGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGG
TGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAA
GCACTTGCTCTGAAATTTGGGGACTGAGTACACCAAATACGATAGATCAGTGGGATACAACAGGCCTTTACAGCTTCTCTGAACAAACCA
GGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACA
GTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGA
GAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACT
CCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAG
ATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAA
TGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTC
AGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAG
GAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTG
CATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCA
GGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGT
TCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAG
ACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTC
AGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGAT
CCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAG
CCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCC
CATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAG
CTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTC
CTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTC
CTCCAGTGGAACAGAAGCCCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGC
CCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGC
AGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGA
AGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAG
ACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCAC
AAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCA
TCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGA
TGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTA
ACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCA
CACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTC
GATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAAC
AATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGAT

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_3605nt
GCCGGGAGGCGGGGCGGGCCGTAGGCAAAGGGAGGTGGGGAGGCGGTGGCCGGCGACTCCCCGCGCCCCGCTCGCCCCCCGGCCCTTCCC
GCGGTGCTCGGCCTCGTTCCTTTCCTCCTCCGCTCCCTCCGTCTTCCATACCCGCCCCGCGCGGCTTTCGGCCGGCGTGCCTCGCGCCCT
AACGGGCGGCTGGAGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCCCAGGGTG
GCAGGCGGGTCTACCCGCGCGGCCGCGGCGGCGGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGG
CTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGAT
GGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTC
TGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATAC
CAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTC
ACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATC
AGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTC
ACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAA
GAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAA
AAATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTG
CTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGAT
TAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGT
TTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGT
GCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAG
AGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATG
CAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGT
CTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACA
GATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCG
AAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAA
CCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGG
GAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACA
TTCCTGGCTGGAGTTACAGGGCAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCA
CACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGC
AAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGC
TTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGC
AGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGA
GAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAG
TCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGA
GGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAA
AGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAAC
CACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGATTTCTTCTCCCCTGCTGTT
TCCTGCCCATCAGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGGAATCTTTTACATCAAACTTTTGGGATCCAAATCCATCT
CCTTTTAAATTTCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTGGGTCATCATATAGTATATTTGAAACCTTTCTGAACATG
TACACCACCCAATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCAGCCCATCTCTTTGTGACCTGG
AGCAGTCAGAGGGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAGCTCTGACGTAACTTCAGTGTT
TTCTACAATACTCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCAACTTTGCTGTCTGTTCTTCCA
AATGTTTATAATACACATTATTTATAAATATGTCTGTTTGGGAAGCTAAGAACAAGCTAGTTTTTACAACACAAATGGAAATAAATGCAA

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_3896nt
GCCGGGAGGCGGGGCGGGCCGTAGGCAAAGGGAGGTGGGGAGGCGGTGGCCGGCGACTCCCCGCGCCCCGCTCGCCCCCCGGCCCTTCCC
GCGGTGCTCGGCCTCGTTCCTTTCCTCCTCCGCTCCCTCCGTCTTCCATACCCGCCCCGCGCGGCTTTCGGCCGGCGTGCCTCGCGCCCT
AACGGGCGGCTGGAGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCCCAGGGTG
GCAGGCGGGTCTACCCGCGCGGCCGCGGCGGCGGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGG
CTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGAT
GGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTC
TGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATAC
CAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTC
ACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATC
AGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTC
ACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAA
GAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAA
AAATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTG
CTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGAT
TAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGT
TTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGT
GCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAG
AGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATG
CAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGT
CTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACA
GATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCG
AAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAA
CCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGG
GAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACA
TTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTG
CTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTG
AGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTC
TGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTA
AGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCG
AAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCT
CACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTC
CCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGG
AGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAA
GTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGA
CCACACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACT
TTCGATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTC
AACAATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCT
GATTTCTTCTCCCCTGCTGTTTCCTGCCCATCAGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGGAATCTTTTACATCAAAC
TTTTGGGATCCAAATCCATCTCCTTTTAAATTTCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTGGGTCATCATATAGTATA
TTTGAAACCTTTCTGAACATGTACACCACCCAATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCA
GCCCATCTCTTTGTGACCTGGAGCAGTCAGAGGGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAG
CTCTGACGTAACTTCAGTGTTTTCTACAATACTCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCA
ACTTTGCTGTCTGTTCTTCCAAATGTTTATAATACACATTATTTATAAATATGTCTGTTTGGGAAGCTAAGAACAAGCTAGTTTTTACAA

>In-frame_SMAD2_ENST00000356825_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_3340nt
GCCGGGAGGCGGGGCGGGCCGTAGGCAAAGGGAGGTGGGGAGGCGGTGGCCGGCGACTCCCCGCGCCCCGCTCGCCCCCCGGCCCTTCCC
GCGGTGCTCGGCCTCGTTCCTTTCCTCCTCCGCTCCCTCCGTCTTCCATACCCGCCCCGCGCGGCTTTCGGCCGGCGTGCCTCGCGCCCT
AACGGGCGGCTGGAGGCGCCAATCAGCGGGCGGCAGGGTGCCAGCCCCGGGGCTGCGCCGGCGAATCGGCGGGGCCCGCGGCCCAGGGTG
GCAGGCGGGTCTACCCGCGCGGCCGCGGCGGCGGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGG
CTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGAT
GGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTC
TGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATAC
CAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTC
ACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATC
AGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTC
ACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAA
GAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAA
AAATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTG
CTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGAT
TAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGT
TTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGT
GCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAG
AGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATG
CAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGT
CTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACA
GATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCG
AAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAA
CCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGG
GAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACA
TTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTG
CTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTG
AGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTC
TGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTA
AGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCG
AAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCT
CACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTC
CCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGG
AGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAA
GTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGA
CCACACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACT
TTCGATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTC
AACAATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCT

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_3262nt
AGGTTCGATACAAGAGGCTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGT
GAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGA
GAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATAC
TAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATG
GCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGT
AAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCC
TCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGA
CAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCT
GGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCC
CCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGC
GTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGG
GGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGA
CTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAG
ATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAA
GTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTG
TGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGC
CAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAA
CAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGA
AAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACAC
AGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAA
CCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAA
GAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGA
CTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACA
AGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCAT
CCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGAT
GCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAA
CAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCAC
ACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTCG
ATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAACA
ATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGATT
TCTTCTCCCCTGCTGTTTCCTGCCCATCAGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGGAATCTTTTACATCAAACTTTT
GGGATCCAAATCCATCTCCTTTTAAATTTCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTGGGTCATCATATAGTATATTTG
AAACCTTTCTGAACATGTACACCACCCAATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCAGCCC
ATCTCTTTGTGACCTGGAGCAGTCAGAGGGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAGCTCT
GACGTAACTTCAGTGTTTTCTACAATACTCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCAACTT
TGCTGTCTGTTCTTCCAAATGTTTATAATACACATTATTTATAAATATGTCTGTTTGGGAAGCTAAGAACAAGCTAGTTTTTACAACACA

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_3553nt
AGGTTCGATACAAGAGGCTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGT
GAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGA
GAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATAC
TAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATG
GCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGT
AAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCC
TCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGA
CAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCT
GGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCC
CCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGC
GTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGG
GGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGA
CTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAG
ATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAA
GTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTG
TGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGC
CAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAA
CAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGA
AAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACAC
AGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAA
CCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGT
ATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCT
GTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACA
AGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGT
AAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGG
GAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCC
TCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCA
GAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACG
GTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAA
AAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACC
ACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGG
AAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAAC
CCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAA
TTGTACCTTTTGCTTCTGATTTCTTCTCCCCTGCTGTTTCCTGCCCATCAGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGG
AATCTTTTACATCAAACTTTTGGGATCCAAATCCATCTCCTTTTAAATTTCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTG
GGTCATCATATAGTATATTTGAAACCTTTCTGAACATGTACACCACCCAATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCG
AGGCTGTGGAACAATCAGCCCATCTCTTTGTGACCTGGAGCAGTCAGAGGGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGA
ATCCATTTCTATGGAAGCTCTGACGTAACTTCAGTGTTTTCTACAATACTCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGA
AATAGCCTAATGGTCCAACTTTGCTGTCTGTTCTTCCAAATGTTTATAATACACATTATTTATAAATATGTCTGTTTGGGAAGCTAAGAA

>In-frame_SMAD2_ENST00000586040_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_2997nt
AGGTTCGATACAAGAGGCTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGTAAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGT
GAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCAGGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGA
GAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTAGATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATAC
TAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCCCATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATG
GCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAACTGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGT
AAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTATTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCC
TCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCAGGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGA
CAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCT
GGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCC
CCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGC
GTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGG
GGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGA
CTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAG
ATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAA
GTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTG
TGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGC
CAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAA
CAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGACCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGA
AAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACAC
AGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAA
CCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGT
ATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCT
GTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACA
AGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGT
AAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGG
GAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCC
TCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCA
GAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACG
GTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAA
AAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACC
ACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGG
AAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAAC
CCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAA

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000454341_chr10_128202508_-_3303nt
GGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGGCTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGT
AAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCA
GGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTA
GATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCC
CATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAAC
TGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTA
TTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCA
GGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCT
GATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATG
ATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCT
CTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGA
CCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTG
GGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCC
CCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTG
AAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGAC
ACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTA
GACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGT
TCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGAC
CAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACC
GGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAA
AAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGGAGATTAC
ACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCCTCCCCAGCAGCACCCTCGCCA
GCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAA
GCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAG
CGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCTCTGAGTGATAAC
TTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGATAACTTGCCGGAAGTTAAAAAG
AAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTT
CAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGAGGACTTCGAATGCTGGATAAGCCATTAAACTT
AGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAAAGGAAAACATCACTTCCTGAATTACTGACCCA
AGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAACCACCTCCATGTAACCCACTGGATACAGTCCCC
TTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGATTTCTTCTCCCCTGCTGTTTCCTGCCCATCAGAGAGGCCTGATACAAGCAA
GTTTGTTTACATCCCTGGGGAATCTTTTACATCAAACTTTTGGGATCCAAATCCATCTCCTTTTAAATTTCAATCTCAGCACCTGCCAGT
TATGCAAATGCCAAAATGTGGGTCATCATATAGTATATTTGAAACCTTTCTGAACATGTACACCACCCAATGCTAGAGGCTGACTTGGAA
ACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCAGCCCATCTCTTTGTGACCTGGAGCAGTCAGAGGGCCCTCAGTCACCCCGCCCC
ATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAGCTCTGACGTAACTTCAGTGTTTTCTACAATACTCCTCCTGCCCCGCCCCATTA
AAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCAACTTTGCTGTCTGTTCTTCCAAATGTTTATAATACACATTATTTATAAATATG

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000284694_chr10_128202508_-_3594nt
GGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGGCTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGT
AAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCA
GGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTA
GATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCC
CATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAAC
TGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTA
TTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCA
GGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCT
GATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATG
ATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCT
CTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGA
CCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTG
GGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCC
CCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTG
AAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGAC
ACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTA
GACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGT
TCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGAC
CAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACC
GGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAA
AAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACA
AAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACAT
TTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTG
AAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGC
AAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCC
TCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCA
AGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATG
GTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATT
CCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGAT
AACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAG
CAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGAGGACTTCGAAT
GCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAAAGGAAAACATC
ACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAACCACCTCCATGT
AACCCACTGGATACAGTCCCCTTAATGTTTTTGCTTCTAAATTGTACCTTTTGCTTCTGATTTCTTCTCCCCTGCTGTTTCCTGCCCATC
AGAGAGGCCTGATACAAGCAAGTTTGTTTACATCCCTGGGGAATCTTTTACATCAAACTTTTGGGATCCAAATCCATCTCCTTTTAAATT
TCAATCTCAGCACCTGCCAGTTATGCAAATGCCAAAATGTGGGTCATCATATAGTATATTTGAAACCTTTCTGAACATGTACACCACCCA
ATGCTAGAGGCTGACTTGGAAACCGGTGGGTGCAATGCCCGAGGCTGTGGAACAATCAGCCCATCTCTTTGTGACCTGGAGCAGTCAGAG
GGCCCTCAGTCACCCCGCCCCATTCCTCACCAGAGAAAAGAATCCATTTCTATGGAAGCTCTGACGTAACTTCAGTGTTTTCTACAATAC
TCCTCCTGCCCCGCCCCATTAAAACAGTTCTTTTGTTAAGAAATAGCCTAATGGTCCAACTTTGCTGTCTGTTCTTCCAAATGTTTATAA

>In-frame_SMAD2_ENST00000591214_chr18_45394694_-_C10orf90_ENST00000544758_chr10_128202508_-_3038nt
GGAGAAGCAGCTCGCCAGCCAGCAGCCCGCCAGCCGCCGGGAGGTTCGATACAAGAGGCTGTTTTCCTAGCGTGGCTTGCTGCCTTTGGT
AAGAACATGTCGTCCATCTTGCCATTCACGCCGCCAGTTGTGAAGAGACTGCTGGGATGGAAGAAGTCAGCTGGTGGGTCTGGAGGAGCA
GGCGGAGGAGAGCAGAATGGGCAGGAAGAAAAGTGGTGTGAGAAAGCAGTGAAAAGTCTGGTGAAGAAGCTAAAGAAAACAGGACGATTA
GATGAGCTTGAGAAAGCCATCACCACTCAAAACTGTAATACTAAATGTGTTACCATACCAAGGTCTCTTGATGGTCGTCTCCAGGTATCC
CATCGAAAAGGATTGCCACATGTTATATATTGCCGATTATGGCGCTGGCCTGATCTTCACAGTCATCATGAACTCAAGGCAATTGAAAAC
TGCGAATATGCTTTTAATCTTAAAAAGGATGAAGTATGTGTAAACCCTTACCACTATCAGAGAGTTGAGACACCAGTTTTGCCTCCAGTA
TTAGTGCCCCGACACACCGAGATCCTAACAGAACTTCCGCCTCTGGATGACTATACTCACTCCATTCCAGAAAACACTAACTTCCCAGCA
GGAATTGAGCCACAGAGTAATTATATTCCAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAAATCTCCAGTCT
GATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAAAATGATTTCATCCATAGTCATCTCCCAGATG
ATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTGCCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCT
CTGGCTAACCGCAGCGGAGTCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGGA
CCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATCACCATCACGGCCAGACGCGTG
GGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGTGCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCC
CCGGCTCTGGCCAATGGCGCCCATCCAGGTCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTG
AAGGTTCCCGAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTTTTTCTCCAGAC
ACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTCTCAGCAGTGTCCAGATTCAATCTATTACGTA
GACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATTGCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGT
TCCCACAGATTAACAGCAGATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGAC
CAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTGAGGCGGGTGCATTTGGGGACC
GGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGGCAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAA
AAGGACCATACAACTCATTGTCACGCCAGCGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACA
AAAGTATTTTCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGCCCACTAGACAT
TTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGAGCCCACAGAGAGACGACATCAAAGCTTCCTG
AAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTACAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGC
AAGTTCCCCAAAGGAGATTACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCCC
TCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCTGAGTCTCAGCAAACGCCTGCA
AGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCATTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATG
GTCCAGCAGAGGAAAGCCCAGCGGAAGGAGGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATT
CCCCATCCTCTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGAGAATCTATGAT
AACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAGTAACAGACTCCGTGCCGAAGTCTTCAAAAAG
CAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTCTAACCACAGGCTGCCCTGCTGACCACACTACCTGGACCTGGGAGGACTTCGAAT
GCTGGATAAGCCATTAAACTTAGCATTATCTTCATCATGGGAAAACACTTATTTTACTTTCGATTTTTTTTTTCCATAAAGGAAAACATC
ACTTCCTGAATTACTGACCCAAGCCAAACAGAAACAATAACCCTCGAGAAAATAGGTCAACAATCTGTTGTGGGGAAACCACCTCCATGT


Top

FusionGenePPI for SMAD2_C10orf90


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMAD2BRCA2, PML, ZFYVE9, ANAPC10, PIAS3, EID2, HIPK2, SKI, PIAS4, SMAD4, ZEB1, DVL1, ERBB2IP, TGIF1, HDAC1, FOXH1, EP300, SNIP1, JUN, SKIL, CDC27, CDC16, DAB2, CTNNB1, MEF2A, MEF2C, SMURF2, AKT1, SMAD3, NFYC, CAMK2G, MYC, INSR, RUNX1, RUNX2, RUNX3, SNW1, STRAP, ACVR1B, SMAD7, NEDD9, SP1, ESR1, TGFBR1, CAV1, LEF1, SMAD6, PIN1, RNF111, UCHL5, PRDM16, BPTF, POU2AF1, NEDD4, CITED2, WWP1, SMURF1, MYOCD, YY1, MED15, MED24, MED6, GTF2I, GTF2IRD1, MECOM, SMAD2, SOX9, ING2, KAT2B, KAT2A, CREBBP, SMARCC2, ARID1A, SMARCC1, SMARCA4, TRIM33, NCOA3, KDM6B, ATF3, ARID1B, STUB1, WWP2, USP9X, TP53, NUP214, USP15, CDK8, CDK9, ITCH, ELAVL1, RGCC, TCF12, ETV4, NEDD4L, HGS, ACVR2B, CSNK1D, DDX3Y, HSPA4, LEMD3, OPA1, DCAF7, SLC25A5, SLC25A6, SQRDL, BUB3, RIN1, KLF5, SMAD5, SMAD1, SLC25A3, ITGB4, CCT6A, C1orf116, DHX8, U2AF2, SIK3, DNAJA2, ATAD3B, PCID2, WRNIP1, PSPC1, DOCK9, EPB41L5, CAD, DGKA, FAM83G, CPSF7, S100A4, CHUK, CDK4, CDK2, ELAC2, NOTCH4, SMAD9, PSMD11, LAMA5, ZEB2, RANBP6, PLIN3, UBR5, SNAPIN, CSH1, CSH2, CYP11A1, PSAP, SNRNP70, PRKAR1A, RARB, RXRA, TGM2, PPP2R1A, SRI, PEX19, PSMD8, ST13, PAPOLA, ZNF41, MLLT4, ANTXR2, RPS14, UBA52, EEF1A1, ST5, KHDRBS1, PAPPA, OS9, ROCK1, ANK3, NCOA6, KPNB1, PSG9, ZMYND11, KIAA1033, RPS27A, RNF123, PAXIP1, TBC1D1, DOCK8, GATAD2B, COPS5, CUL5, ABTB1, DCUN1D1, RNPC3, FAM161B, RANBP9, DNAJC7, TRIM62, BTBD2, C22orf46, DYNC1H1, BAZ1A, CISH, ZNHIT6, NAGK, ANAPC2, EIF3L, SPTBN1, SH2D2A, LCK, PIK3CA, IRF7, IRF3, TSC2, FHL1, FHL2, FHL3, GFER, OTUB1, PPARG, NEFM, ANP32E, ANP32B, TUBA1B, PTMS, SOD1, SYT1, ATP5I, HDAC2, RHOA, GLI1, LDLRAD4, NFIA, PARD3, CAMK2A, YAP1, MAPTC10orf90UBC, TP53, MTNR1A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMAD2_C10orf90


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SMAD2_C10orf90


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSMAD2C0376634Craniofacial Abnormalities2CTD_human
HgeneSMAD2C0019189Hepatitis, Chronic1CTD_human
HgeneSMAD2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneSMAD2C0265287Acromicric Dysplasia1CTD_human
HgeneSMAD2C0600519Ventricular Remodeling1CTD_human
HgeneSMAD2C1876165Copper-Overload Cirrhosis1CTD_human