FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34647

FusionGeneSummary for SLC9A9_KCNAB1

check button Fusion gene summary
Fusion gene informationFusion gene name: SLC9A9_KCNAB1
Fusion gene ID: 34647
HgeneTgene
Gene symbol

SLC9A9

KCNAB1

Gene ID

285195

7881

Gene namesolute carrier family 9 member A9potassium voltage-gated channel subfamily A member regulatory beta subunit 1
SynonymsAUTS16|NHE9AKR6A3|KCNA1B|KV-BETA-1|Kvb1.3|hKvBeta3|hKvb3
Cytomap

3q24

3q25.31

Type of geneprotein-codingprotein-coding
Descriptionsodium/hydrogen exchanger 9Na(+)/H(+) exchanger 9putative protein product of Nbla00118sodium/proton exchanger NHE9solute carrier family 9 (sodium/hydrogen exchanger)solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9voltage-gated potassium channel subunit beta-1K(+) channel subunit beta-1K+ channel Beta1a chainpotassium channel beta 3 chainpotassium channel beta3 subunitpotassium channel shaker chain beta 1apotassium channel, voltage gated subfamily A regulator
Modification date2018052320180522
UniProtAcc

Q8IVB4

Q14722

Ensembl transtripts involved in fusion geneENST00000316549, ENST00000498717, 
ENST00000490337, ENST00000389636, 
ENST00000471742, ENST00000302490, 
ENST00000389634, ENST00000497291, 
Fusion gene scores* DoF score3 X 2 X 3=186 X 5 X 6=180
# samples 37
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/180*10)=-1.36257007938471
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SLC9A9 [Title/Abstract] AND KCNAB1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneKCNAB1

GO:1901379

regulation of potassium ion transmembrane transport

7890032


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-22-4604-01ASLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000316549ENST00000490337SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
In-frameENST00000316549ENST00000389636SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
In-frameENST00000316549ENST00000471742SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
In-frameENST00000316549ENST00000302490SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
In-frameENST00000316549ENST00000389634SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
5CDS-intronENST00000316549ENST00000497291SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
intron-3CDSENST00000498717ENST00000490337SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
intron-3CDSENST00000498717ENST00000389636SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
intron-3CDSENST00000498717ENST00000471742SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
intron-3CDSENST00000498717ENST00000302490SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
intron-3CDSENST00000498717ENST00000389634SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+
intron-intronENST00000498717ENST00000497291SLC9A9chr3

143513843

-KCNAB1chr3

156139405

+

Top

FusionProtFeatures for SLC9A9_KCNAB1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SLC9A9

Q8IVB4

KCNAB1

Q14722

May act in electroneutral exchange of protons for Na(+)across membranes. Involved in the effusion of Golgi luminal H(+)in exchange for cytosolic cations. Involved in organelle ionhomeostasis by contributing to the maintenance of the uniqueacidic pH values of the Golgi and post-Golgi compartments in thecell. {ECO:0000269|PubMed:15522866}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416127_147177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-41621_41177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-41646_66177646TransmembraneHelical
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000302490+014108_10973402Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000302490+014240_24173402Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000302490+014295_30073402Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000302490+014375_38173402Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000471742+014108_10980409Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000471742+014240_24180409Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000471742+014295_30080409Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000471742+014375_38180409Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000490337+014108_10991420Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000490337+014240_24191420Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000490337+014295_30091420Nucleotide bindingNADP
TgeneKCNAB1chr3:143513843chr3:156139405ENST00000490337+014375_38191420Nucleotide bindingNADP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416165_185177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416204_224177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416236_256177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416278_298177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416302_322177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416323_343177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416365_385177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416387_407177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416430_450177646TransmembraneHelical
HgeneSLC9A9chr3:143513843chr3:156139405ENST00000316549-416466_486177646TransmembraneHelical


Top

FusionGeneSequence for SLC9A9_KCNAB1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000490337_chr3_156139405_+_506aa
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVYDCVKLTFSP
STLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGNL
GKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLS
RKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQR
EKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCL

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000389636_chr3_156139405_+_477aa
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVYDCVKLTFSP
STLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGNL
GKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLS
RKHIIEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGII
SGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLP

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000471742_chr3_156139405_+_506aa
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVYDCVKLTFSP
STLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGNL
GKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLS
RKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQR
EKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCL

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000302490_chr3_156139405_+_506aa
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVYDCVKLTFSP
STLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGNL
GKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLS
RKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQR
EKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCL

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000389634_chr3_156139405_+_477aa
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVYDCVKLTFSP
STLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGNL
GKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLS
RKHIIEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGII
SGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000490337_chr3_156139405_+_1518nt
ATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAGCGGTGGAGCTGCTTGTCTTCAATTTTTTG
CTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATGAAACTGGAGGAGCAATGGTGTATGGCCTT
ATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCTATGACTGTGTAAAACTAACTTTCAGTCCA
TCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAAGTCAGCACAACATCAATCCTCATCAAGGA
AATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCACCAATTATATTTCATGCAGGATATAGTCTA
AAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTGCCATCTCCTGCATCGTCATAGGGAATCTT
GGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTCAAATTTCAGATGAGGTTGCTGAACGGCTG
ATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTGGAAAGGCTGAAGTGATTCTGGGGAGCATC
ATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTGGAAAAGCTGAAACAGAAAGAGGGCTGTCA
AGAAAGCATATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGGATGTGGTCTTTGCAAATCGACCGGACAGT
AACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGATGTACTGGGGCACCTCGAGATGGAGTGCT
ATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTGAACAAGCTGAGTACCATCTTTTCCAGAGA
GAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACATGGTCTCCACTTGCCTGTGGAATCATCTCA
GGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGTTGAAAGAAAGAATTGTAAGTGAAGAAGGG
AGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACACTACCTCAGCTAGCTGTTGCGTGGTGCCTG
AGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAAACCTTGGTGCCATTCAGGTTCTCCCAAAG

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000389636_chr3_156139405_+_1431nt
ATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAGCGGTGGAGCTGCTTGTCTTCAATTTTTTG
CTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATGAAACTGGAGGAGCAATGGTGTATGGCCTT
ATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCTATGACTGTGTAAAACTAACTTTCAGTCCA
TCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAAGTCAGCACAACATCAATCCTCATCAAGGA
AATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCACCAATTATATTTCATGCAGGATATAGTCTA
AAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTGCCATCTCCTGCATCGTCATAGGGAATCTT
GGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTCAAATTTCAGATGAGGTTGCTGAACGGCTG
ATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTGGAAAGGCTGAAGTGATTCTGGGGAGCATC
ATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTGGAAAAGCTGAAACAGAAAGAGGGCTGTCA
AGAAAGCATATTATTGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGATGTACTGGGGCACCTCGAGATGGAGT
GCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTGAACAAGCTGAGTACCATCTTTTCCAG
AGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACATGGTCTCCACTTGCCTGTGGAATCATC
TCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGTTGAAAGAAAGAATTGTAAGTGAAGAA
GGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACACTACCTCAGCTAGCTGTTGCGTGGTGC
CTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAAACCTTGGTGCCATTCAGGTTCTCCCA

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000471742_chr3_156139405_+_1518nt
ATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAGCGGTGGAGCTGCTTGTCTTCAATTTTTTG
CTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATGAAACTGGAGGAGCAATGGTGTATGGCCTT
ATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCTATGACTGTGTAAAACTAACTTTCAGTCCA
TCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAAGTCAGCACAACATCAATCCTCATCAAGGA
AATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCACCAATTATATTTCATGCAGGATATAGTCTA
AAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTGCCATCTCCTGCATCGTCATAGGGAATCTT
GGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTCAAATTTCAGATGAGGTTGCTGAACGGCTG
ATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTGGAAAGGCTGAAGTGATTCTGGGGAGCATC
ATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTGGAAAAGCTGAAACAGAAAGAGGGCTGTCA
AGAAAGCATATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGGATGTGGTCTTTGCAAATCGACCGGACAGT
AACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGATGTACTGGGGCACCTCGAGATGGAGTGCT
ATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTGAACAAGCTGAGTACCATCTTTTCCAGAGA
GAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACATGGTCTCCACTTGCCTGTGGAATCATCTCA
GGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGTTGAAAGAAAGAATTGTAAGTGAAGAAGGG
AGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACACTACCTCAGCTAGCTGTTGCGTGGTGCCTG
AGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAAACCTTGGTGCCATTCAGGTTCTCCCAAAG

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000302490_chr3_156139405_+_1518nt
ATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAGCGGTGGAGCTGCTTGTCTTCAATTTTTTG
CTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATGAAACTGGAGGAGCAATGGTGTATGGCCTT
ATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCTATGACTGTGTAAAACTAACTTTCAGTCCA
TCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAAGTCAGCACAACATCAATCCTCATCAAGGA
AATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCACCAATTATATTTCATGCAGGATATAGTCTA
AAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTGCCATCTCCTGCATCGTCATAGGGAATCTT
GGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTCAAATTTCAGATGAGGTTGCTGAACGGCTG
ATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTGGAAAGGCTGAAGTGATTCTGGGGAGCATC
ATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTGGAAAAGCTGAAACAGAAAGAGGGCTGTCA
AGAAAGCATATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGGATGTGGTCTTTGCAAATCGACCGGACAGT
AACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGATGTACTGGGGCACCTCGAGATGGAGTGCT
ATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTGAACAAGCTGAGTACCATCTTTTCCAGAGA
GAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACATGGTCTCCACTTGCCTGTGGAATCATCTCA
GGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGTTGAAAGAAAGAATTGTAAGTGAAGAAGGG
AGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACACTACCTCAGCTAGCTGTTGCGTGGTGCCTG
AGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAAACCTTGGTGCCATTCAGGTTCTCCCAAAG

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000389634_chr3_156139405_+_1431nt
ATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAGCGGTGGAGCTGCTTGTCTTCAATTTTTTG
CTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATGAAACTGGAGGAGCAATGGTGTATGGCCTT
ATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCTATGACTGTGTAAAACTAACTTTCAGTCCA
TCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAAGTCAGCACAACATCAATCCTCATCAAGGA
AATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCACCAATTATATTTCATGCAGGATATAGTCTA
AAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTGCCATCTCCTGCATCGTCATAGGGAATCTT
GGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTCAAATTTCAGATGAGGTTGCTGAACGGCTG
ATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTGGAAAGGCTGAAGTGATTCTGGGGAGCATC
ATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTGGAAAAGCTGAAACAGAAAGAGGGCTGTCA
AGAAAGCATATTATTGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGATGTACTGGGGCACCTCGAGATGGAGT
GCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTGAACAAGCTGAGTACCATCTTTTCCAG
AGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACATGGTCTCCACTTGCCTGTGGAATCATC
TCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGTTGAAAGAAAGAATTGTAAGTGAAGAA
GGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACACTACCTCAGCTAGCTGTTGCGTGGTGC
CTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAAACCTTGGTGCCATTCAGGTTCTCCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000490337_chr3_156139405_+_3525nt
AAAAGAGACAGGGCTGCTTTAAGAGAGAAACAGGAAGTTGTAACTAGAAGCCATCTGAATACTAAGCCAGGGCAGAATGCTTGTGAAGTA
GCAACTAAAGTGGCAGTGTTTCTTCTGAAATTCTCAGGCAGTCAGACTGTCTTAGGCAAATCTTGATAAAATAGCCTTTATCCAGGTTTT
TATCTAAGGAATCCCAAGAAGACTGGGGAATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAG
CGGTGGAGCTGCTTGTCTTCAATTTTTTGCTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATG
AAACTGGAGGAGCAATGGTGTATGGCCTTATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCT
ATGACTGTGTAAAACTAACTTTCAGTCCATCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAA
GTCAGCACAACATCAATCCTCATCAAGGAAATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCAC
CAATTATATTTCATGCAGGATATAGTCTAAAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTG
CCATCTCCTGCATCGTCATAGGGAATCTTGGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTC
AAATTTCAGATGAGGTTGCTGAACGGCTGATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTG
GAAAGGCTGAAGTGATTCTGGGGAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTG
GAAAAGCTGAAACAGAAAGAGGGCTGTCAAGAAAGCATATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGG
ATGTGGTCTTTGCAAATCGACCGGACAGTAACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGA
TGTACTGGGGCACCTCGAGATGGAGTGCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTG
AACAAGCTGAGTACCATCTTTTCCAGAGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACAT
GGTCTCCACTTGCCTGTGGAATCATCTCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGT
TGAAAGAAAGAATTGTAAGTGAAGAAGGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACAC
TACCTCAGCTAGCTGTTGCGTGGTGCCTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAA
ACCTTGGTGCCATTCAGGTTCTCCCAAAGATGACATCACATGTGGTAAATGAGATTGATAACATACTGCGCAACAAGCCCTACAGCAAGA
AGGACTATAGATCATAAGGCAATGCATGAACCACAGAAGCTGCATGGTTAAAATAGCGGCCTGTGCCCAGTACAGAAAGGTGTTACTAAC
CAGTCTTTTGAATCACTTAGCAGCTTGCTGCTCAACCTCTAGTGTCCCTCCCTGGATTCTTTGAGGTGTCTGCTGTCGCTACCACTGTGC
ACATCTGAAAACTCACAACCAAGAAAATCCATTCTATTTTCTTATCTTGGACTGGAGTCACCTATTCTTGCATTGCTGTATACACCTCAT
GCTTATGCAATGGGAAGAATATGGGGGCCAGGGGGTGTGGTACTACCTTCAGGCATTTGGTAACTCAAAGAAGGCTGTACAGATATATTT
TTTCAAAAGAACAAAATCCACAGATGCAATGTGAGTTGCGTAAGAAACAGAGTAGATAGACTAAATTCAGTGAAGGAAAGGAATTGAGAG
ATTTTTCTTAGTAAATAGATTATTGTTAAGTAAATAGTTATTAAAAATATATCTCACTGCAAAAAAAAAAAAGCAGTATCTTCACTCAAA
AGTCTTGCTTGGAAGAATAAGCAGAAATAATTTTATATATTTTTTTTCTATTTTCACATTCATACTAACAAGTTTTGTTCCATTTGTTAT
TCAATAAAACAAAAATTTCTAGGTATTTGCTTTATTACCTTTCAAATATTTACTGTTGCTTGGCCCCAAGAATGGCCTTGTACAACTTAT
CCAGAATGTCTATTAGGATTCTAATGTTATGTCCACTTACAAGTAGAGACAGTAAAAGGATGAATACCCAATCTTTAGTGACAATGCAGC
TGATTTATGAAAGAGAGGGCTACACTGCTATGGAAACTTAGCTTCAAAGAAAATGCAATGTATCTGCAATTAGGTGTTCATTTTTTACTA
CATTTTATTAAAACCTGCTTTATACTTTCAACTGCTTGTAGGCACAACTTCTGCAAGTTTAAATATTTGAGCTTTACAAATAAACATACA
CATGCTCAGTTTTTTAAGTAAACCTGTAAAATACCCAGGAAGGCAAATGTTCATTGTTTAATTAGCACTGGGATTTTATAATATAATGTT
TGGTATTTTTGAGGCATTGTTAACATGAAAGTCAACCACTGGCTTTGTGAAAAATGCTATGTCACTATTCAGAATATGCTGGGTAAATTG
ACTTGCCTAGTGAAAAGCAAAATGTTAAAGAAAGAACTTCTGGTTCTATAATCATATTATATGCACTAAACTATATGCATGAAAGTTCTT
TGCATGGATTAATGGGGCTTACCCTTGTTGCACTCGAAATCTGAGGTGTATCTAGCCCTGCCACTATTGGCTACTTACCCTCATTAATAT
CCCACTTGAGAAAAATTGTGAGACTATACTGTGTCAATATCTGTAAAAAGAGAGAAAACATGTTTTGTTTTTTTTTGAAGGGGGTGGTGT
GGGAGTGGCCCTTTAACTCTATTTGGCTATCTGAGGATGTACAAAATTCTCATTTAATTTTCTGGTCAGCAAGTTCCCCACACAGAAATC
ACTCTGAGGTTTACAGAAGAACTGTAATATTATTTTAAAATGCGATTTTTCTGTCATTAGTTCTAGATATGTACTTCATGGTTAAATTCT
AAATCTGAAAATGCTAGTGGGAGATATCAAGAAATTTTCTTTTTGATTACTAGTACCTGTATTCTAACAGAGAGTTTGAATTTTTTGCCC
GTGTTATCAGAATGATGGAAATTGATCATTTTCAGTTGTTCATTGTGTATTCAATCCAGCGAACTGCTGTATGTATAGAGGAGCTGAGGT

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000389636_chr3_156139405_+_2239nt
AAAAGAGACAGGGCTGCTTTAAGAGAGAAACAGGAAGTTGTAACTAGAAGCCATCTGAATACTAAGCCAGGGCAGAATGCTTGTGAAGTA
GCAACTAAAGTGGCAGTGTTTCTTCTGAAATTCTCAGGCAGTCAGACTGTCTTAGGCAAATCTTGATAAAATAGCCTTTATCCAGGTTTT
TATCTAAGGAATCCCAAGAAGACTGGGGAATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAG
CGGTGGAGCTGCTTGTCTTCAATTTTTTGCTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATG
AAACTGGAGGAGCAATGGTGTATGGCCTTATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCT
ATGACTGTGTAAAACTAACTTTCAGTCCATCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAA
GTCAGCACAACATCAATCCTCATCAAGGAAATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCAC
CAATTATATTTCATGCAGGATATAGTCTAAAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTG
CCATCTCCTGCATCGTCATAGGGAATCTTGGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTC
AAATTTCAGATGAGGTTGCTGAACGGCTGATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTG
GAAAGGCTGAAGTGATTCTGGGGAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTG
GAAAAGCTGAAACAGAAAGAGGGCTGTCAAGAAAGCATATTATTGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGG
CGATGTACTGGGGCACCTCGAGATGGAGTGCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCT
GTGAACAAGCTGAGTACCATCTTTTCCAGAGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGA
CATGGTCTCCACTTGCCTGTGGAATCATCTCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGT
GGTTGAAAGAAAGAATTGTAAGTGAAGAAGGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCA
CACTACCTCAGCTAGCTGTTGCGTGGTGCCTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTG
AAAACCTTGGTGCCATTCAGGTTCTCCCAAAGATGACATCACATGTGGTAAATGAGATTGATAACATACTGCGCAACAAGCCCTACAGCA
AGAAGGACTATAGATCATAAGGCAATGCATGAACCACAGAAGCTGCATGGTTAAAATAGCGGCCTGTGCCCAGTACAGAAAGGTGTTACT
AACCAGTCTTTTGAATCACTTAGCAGCTTGCTGCTCAACCTCTAGTGTCCCTCCCTGGATTCTTTGAGGTGTCTGCTGTCGCTACCACTG
TGCACATCTGAAAACTCACAACCAAGAAAATCCATTCTATTTTCTTATCTTGGACTGGAGTCACCTATTCTTGCATTGCTGTATACACCT
CATGCTTATGCAATGGGAAGAATATGGGGGCCAGGGGGTGTGGTACTACCTTCAGGCATTTGGTAACTCAAAGAAGGCTGTACAGATATA
TTTTTTCAAAAGAACAAAATCCACAGATGCAATGTGAGTTGCGTAAGAAACAGAGTAGATAGACTAAATTCAGTGAAGGAAAGGAATTGA
GAGATTTTTCTTAGTAAATAGATTATTGTTAAGTAAATAGTTATTAAAAATATATCTCACTGCAAAAAAAAAAAAGCAGTATCTTCACTC

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000471742_chr3_156139405_+_3584nt
AAAAGAGACAGGGCTGCTTTAAGAGAGAAACAGGAAGTTGTAACTAGAAGCCATCTGAATACTAAGCCAGGGCAGAATGCTTGTGAAGTA
GCAACTAAAGTGGCAGTGTTTCTTCTGAAATTCTCAGGCAGTCAGACTGTCTTAGGCAAATCTTGATAAAATAGCCTTTATCCAGGTTTT
TATCTAAGGAATCCCAAGAAGACTGGGGAATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAG
CGGTGGAGCTGCTTGTCTTCAATTTTTTGCTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATG
AAACTGGAGGAGCAATGGTGTATGGCCTTATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCT
ATGACTGTGTAAAACTAACTTTCAGTCCATCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAA
GTCAGCACAACATCAATCCTCATCAAGGAAATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCAC
CAATTATATTTCATGCAGGATATAGTCTAAAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTG
CCATCTCCTGCATCGTCATAGGGAATCTTGGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTC
AAATTTCAGATGAGGTTGCTGAACGGCTGATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTG
GAAAGGCTGAAGTGATTCTGGGGAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTG
GAAAAGCTGAAACAGAAAGAGGGCTGTCAAGAAAGCATATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGG
ATGTGGTCTTTGCAAATCGACCGGACAGTAACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGA
TGTACTGGGGCACCTCGAGATGGAGTGCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTG
AACAAGCTGAGTACCATCTTTTCCAGAGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACAT
GGTCTCCACTTGCCTGTGGAATCATCTCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGT
TGAAAGAAAGAATTGTAAGTGAAGAAGGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACAC
TACCTCAGCTAGCTGTTGCGTGGTGCCTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAA
ACCTTGGTGCCATTCAGGTTCTCCCAAAGATGACATCACATGTGGTAAATGAGATTGATAACATACTGCGCAACAAGCCCTACAGCAAGA
AGGACTATAGATCATAAGGCAATGCATGAACCACAGAAGCTGCATGGTTAAAATAGCGGCCTGTGCCCAGTACAGAAAGGTGTTACTAAC
CAGTCTTTTGAATCACTTAGCAGCTTGCTGCTCAACCTCTAGTGTCCCTCCCTGGATTCTTTGAGGTGTCTGCTGTCGCTACCACTGTGC
ACATCTGAAAACTCACAACCAAGAAAATCCATTCTATTTTCTTATCTTGGACTGGAGTCACCTATTCTTGCATTGCTGTATACACCTCAT
GCTTATGCAATGGGAAGAATATGGGGGCCAGGGGGTGTGGTACTACCTTCAGGCATTTGGTAACTCAAAGAAGGCTGTACAGATATATTT
TTTCAAAAGAACAAAATCCACAGATGCAATGTGAGTTGCGTAAGAAACAGAGTAGATAGACTAAATTCAGTGAAGGAAAGGAATTGAGAG
ATTTTTCTTAGTAAATAGATTATTGTTAAGTAAATAGTTATTAAAAATATATCTCACTGCAAAAAAAAAAAAGCAGTATCTTCACTCAAA
AGTCTTGCTTGGAAGAATAAGCAGAAATAATTTTATATATTTTTTTTCTATTTTCACATTCATACTAACAAGTTTTGTTCCATTTGTTAT
TCAATAAAACAAAAATTTCTAGGTATTTGCTTTATTACCTTTCAAATATTTACTGTTGCTTGGCCCCAAGAATGGCCTTGTACAACTTAT
CCAGAATGTCTATTAGGATTCTAATGTTATGTCCACTTACAAGTAGAGACAGTAAAAGGATGAATACCCAATCTTTAGTGACAATGCAGC
TGATTTATGAAAGAGAGGGCTACACTGCTATGGAAACTTAGCTTCAAAGAAAATGCAATGTATCTGCAATTAGGTGTTCATTTTTTACTA
CATTTTATTAAAACCTGCTTTATACTTTCAACTGCTTGTAGGCACAACTTCTGCAAGTTTAAATATTTGAGCTTTACAAATAAACATACA
CATGCTCAGTTTTTTAAGTAAACCTGTAAAATACCCAGGAAGGCAAATGTTCATTGTTTAATTAGCACTGGGATTTTATAATATAATGTT
TGGTATTTTTGAGGCATTGTTAACATGAAAGTCAACCACTGGCTTTGTGAAAAATGCTATGTCACTATTCAGAATATGCTGGGTAAATTG
ACTTGCCTAGTGAAAAGCAAAATGTTAAAGAAAGAACTTCTGGTTCTATAATCATATTATATGCACTAAACTATATGCATGAAAGTTCTT
TGCATGGATTAATGGGGCTTACCCTTGTTGCACTCGAAATCTGAGGTGTATCTAGCCCTGCCACTATTGGCTACTTACCCTCATTAATAT
CCCACTTGAGAAAAATTGTGAGACTATACTGTGTCAATATCTGTAAAAAGAGAGAAAACATGTTTTGTTTTTTTTTGAAGGGGGTGGTGT
GGGAGTGGCCCTTTAACTCTATTTGGCTATCTGAGGATGTACAAAATTCTCATTTAATTTTCTGGTCAGCAAGTTCCCCACACAGAAATC
ACTCTGAGGTTTACAGAAGAACTGTAATATTATTTTAAAATGCGATTTTTCTGTCATTAGTTCTAGATATGTACTTCATGGTTAAATTCT
AAATCTGAAAATGCTAGTGGGAGATATCAAGAAATTTTCTTTTTGATTACTAGTACCTGTATTCTAACAGAGAGTTTGAATTTTTTGCCC
GTGTTATCAGAATGATGGAAATTGATCATTTTCAGTTGTTCATTGTGTATTCAATCCAGCGAACTGCTGTATGTATAGAGGAGCTGAGGT

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000302490_chr3_156139405_+_3736nt
AAAAGAGACAGGGCTGCTTTAAGAGAGAAACAGGAAGTTGTAACTAGAAGCCATCTGAATACTAAGCCAGGGCAGAATGCTTGTGAAGTA
GCAACTAAAGTGGCAGTGTTTCTTCTGAAATTCTCAGGCAGTCAGACTGTCTTAGGCAAATCTTGATAAAATAGCCTTTATCCAGGTTTT
TATCTAAGGAATCCCAAGAAGACTGGGGAATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAG
CGGTGGAGCTGCTTGTCTTCAATTTTTTGCTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATG
AAACTGGAGGAGCAATGGTGTATGGCCTTATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCT
ATGACTGTGTAAAACTAACTTTCAGTCCATCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAA
GTCAGCACAACATCAATCCTCATCAAGGAAATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCAC
CAATTATATTTCATGCAGGATATAGTCTAAAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTG
CCATCTCCTGCATCGTCATAGGGAATCTTGGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTC
AAATTTCAGATGAGGTTGCTGAACGGCTGATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTG
GAAAGGCTGAAGTGATTCTGGGGAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTG
GAAAAGCTGAAACAGAAAGAGGGCTGTCAAGAAAGCATATTATTGAAGGATTGAAGGGCTCCCTCCAGAGGCTGCAGCTCGAGTATGTGG
ATGTGGTCTTTGCAAATCGACCGGACAGTAACACTCCCATGGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGGCGA
TGTACTGGGGCACCTCGAGATGGAGTGCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCTGTG
AACAAGCTGAGTACCATCTTTTCCAGAGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGACAT
GGTCTCCACTTGCCTGTGGAATCATCTCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGTGGT
TGAAAGAAAGAATTGTAAGTGAAGAAGGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCACAC
TACCTCAGCTAGCTGTTGCGTGGTGCCTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTGAAA
ACCTTGGTGCCATTCAGGTTCTCCCAAAGATGACATCACATGTGGTAAATGAGATTGATAACATACTGCGCAACAAGCCCTACAGCAAGA
AGGACTATAGATCATAAGGCAATGCATGAACCACAGAAGCTGCATGGTTAAAATAGCGGCCTGTGCCCAGTACAGAAAGGTGTTACTAAC
CAGTCTTTTGAATCACTTAGCAGCTTGCTGCTCAACCTCTAGTGTCCCTCCCTGGATTCTTTGAGGTGTCTGCTGTCGCTACCACTGTGC
ACATCTGAAAACTCACAACCAAGAAAATCCATTCTATTTTCTTATCTTGGACTGGAGTCACCTATTCTTGCATTGCTGTATACACCTCAT
GCTTATGCAATGGGAAGAATATGGGGGCCAGGGGGTGTGGTACTACCTTCAGGCATTTGGTAACTCAAAGAAGGCTGTACAGATATATTT
TTTCAAAAGAACAAAATCCACAGATGCAATGTGAGTTGCGTAAGAAACAGAGTAGATAGACTAAATTCAGTGAAGGAAAGGAATTGAGAG
ATTTTTCTTAGTAAATAGATTATTGTTAAGTAAATAGTTATTAAAAATATATCTCACTGCAAAAAAAAAAAAGCAGTATCTTCACTCAAA
AGTCTTGCTTGGAAGAATAAGCAGAAATAATTTTATATATTTTTTTTCTATTTTCACATTCATACTAACAAGTTTTGTTCCATTTGTTAT
TCAATAAAACAAAAATTTCTAGGTATTTGCTTTATTACCTTTCAAATATTTACTGTTGCTTGGCCCCAAGAATGGCCTTGTACAACTTAT
CCAGAATGTCTATTAGGATTCTAATGTTATGTCCACTTACAAGTAGAGACAGTAAAAGGATGAATACCCAATCTTTAGTGACAATGCAGC
TGATTTATGAAAGAGAGGGCTACACTGCTATGGAAACTTAGCTTCAAAGAAAATGCAATGTATCTGCAATTAGGTGTTCATTTTTTACTA
CATTTTATTAAAACCTGCTTTATACTTTCAACTGCTTGTAGGCACAACTTCTGCAAGTTTAAATATTTGAGCTTTACAAATAAACATACA
CATGCTCAGTTTTTTAAGTAAACCTGTAAAATACCCAGGAAGGCAAATGTTCATTGTTTAATTAGCACTGGGATTTTATAATATAATGTT
TGGTATTTTTGAGGCATTGTTAACATGAAAGTCAACCACTGGCTTTGTGAAAAATGCTATGTCACTATTCAGAATATGCTGGGTAAATTG
ACTTGCCTAGTGAAAAGCAAAATGTTAAAGAAAGAACTTCTGGTTCTATAATCATATTATATGCACTAAACTATATGCATGAAAGTTCTT
TGCATGGATTAATGGGGCTTACCCTTGTTGCACTCGAAATCTGAGGTGTATCTAGCCCTGCCACTATTGGCTACTTACCCTCATTAATAT
CCCACTTGAGAAAAATTGTGAGACTATACTGTGTCAATATCTGTAAAAAGAGAGAAAACATGTTTTGTTTTTTTTTGAAGGGGGTGGTGT
GGGAGTGGCCCTTTAACTCTATTTGGCTATCTGAGGATGTACAAAATTCTCATTTAATTTTCTGGTCAGCAAGTTCCCCACACAGAAATC
ACTCTGAGGTTTACAGAAGAACTGTAATATTATTTTAAAATGCGATTTTTCTGTCATTAGTTCTAGATATGTACTTCATGGTTAAATTCT
AAATCTGAAAATGCTAGTGGGAGATATCAAGAAATTTTCTTTTTGATTACTAGTACCTGTATTCTAACAGAGAGTTTGAATTTTTTGCCC
GTGTTATCAGAATGATGGAAATTGATCATTTTCAGTTGTTCATTGTGTATTCAATCCAGCGAACTGCTGTATGTATAGAGGAGCTGAGGT
GCTGTCTAATGGGAAATGTGATTTGATTGATTTATTTGCTTAGAGTAATAAAAGCATTTTGTGCATTCAATCTTACAATAGATTTTATCT
GATCTTTCACTGTAAGGCTTATGTGTATTTTCCATATATGTAAAACATACACATGTAAAATATATGTGGCCATAAATTAGGCAATAATCA

>In-frame_SLC9A9_ENST00000316549_chr3_143513843_-_KCNAB1_ENST00000389634_chr3_156139405_+_1640nt
AAAAGAGACAGGGCTGCTTTAAGAGAGAAACAGGAAGTTGTAACTAGAAGCCATCTGAATACTAAGCCAGGGCAGAATGCTTGTGAAGTA
GCAACTAAAGTGGCAGTGTTTCTTCTGAAATTCTCAGGCAGTCAGACTGTCTTAGGCAAATCTTGATAAAATAGCCTTTATCCAGGTTTT
TATCTAAGGAATCCCAAGAAGACTGGGGAATGGAGAGACAGTCAAGGGTTATGTCAGAAAAGGATGAGTATCAGTTTCAACATCAGGGAG
CGGTGGAGCTGCTTGTCTTCAATTTTTTGCTCATCCTTACCATTTTGACAATCTGGTTATTTAAAAATCATCGATTCCGCTTCTTGCATG
AAACTGGAGGAGCAATGGTGTATGGCCTTATAATGGGACTAATTTTACGATATGCTACAGCACCAACTGATATTGAAAGTGGAACTGTCT
ATGACTGTGTAAAACTAACTTTCAGTCCATCAACTCTGCTGGTTAATATCACTGACCAAGTTTATGAATATAAATACAAAAGAGAAATAA
GTCAGCACAACATCAATCCTCATCAAGGAAATGCTATACTTGAAAAGATGACATTTGATCCAGAAATCTTCTTCAATGTTTTACTGCCAC
CAATTATATTTCATGCAGGATATAGTCTAAAGAAGAGACACTTTTTTCAAAACTTAGGATCTATTTTAACGTATGCCTTCTTGGGAACTG
CCATCTCCTGCATCGTCATAGGGAATCTTGGAAAATCAGGACTCAGAGTTTCTTGCTTGGGTCTTGGAACATGGGTGACATTTGGAGGTC
AAATTTCAGATGAGGTTGCTGAACGGCTGATGACCATCGCCTATGAAAGTGGTGTTAACCTCTTTGATACTGCCGAAGTCTATGCTGCTG
GAAAGGCTGAAGTGATTCTGGGGAGCATCATCAAGAAGAAAGGCTGGAGGAGGTCCAGTCTGGTCATAACAACCAAACTCTACTGGGGTG
GAAAAGCTGAAACAGAAAGAGGGCTGTCAAGAAAGCATATTATTGAAGAAATTGTCCGAGCCATGACACATGTGATAAACCAAGGCATGG
CGATGTACTGGGGCACCTCGAGATGGAGTGCTATGGAGATCATGGAAGCCTATTCTGTAGCAAGACAGTTCAATATGATCCCACCGGTCT
GTGAACAAGCTGAGTACCATCTTTTCCAGAGAGAGAAAGTGGAGGTCCAGCTGCCAGAGCTCTACCACAAAATAGGTGTTGGCGCAATGA
CATGGTCTCCACTTGCCTGTGGAATCATCTCAGGAAAATACGGAAACGGGGTGCCTGAAAGTTCCAGGGCTTCACTGAAGTGCTACCAGT
GGTTGAAAGAAAGAATTGTAAGTGAAGAAGGGAGAAAACAGCAAAACAAGCTAAAAGACCTTTCCCCAATTGCGGAGCGTCTGGGATGCA
CACTACCTCAGCTAGCTGTTGCGTGGTGCCTGAGAAATGAAGGTGTGAGTTCTGTGCTCCTGGGATCATCCACTCCTGAACAACTCATTG
AAAACCTTGGTGCCATTCAGGTTCTCCCAAAGATGACATCACATGTGGTAAATGAGATTGATAACATACTGCGCAACAAGCCCTACAGCA


Top

FusionGenePPI for SLC9A9_KCNAB1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SLC9A9ZDHHC17, TP53KCNAB1KCNA2, NEDD4L, NEDD4, ELAVL1, ARRB2, KCNA5, GNB2L1, APP, SRPK1, KCNAB2, ATIC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SLC9A9_KCNAB1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SLC9A9_KCNAB1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSLC9A9C0004352Autistic Disorder1CTD_human