FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34468

FusionGeneSummary for SLC39A8_RHEB

check button Fusion gene summary
Fusion gene informationFusion gene name: SLC39A8_RHEB
Fusion gene ID: 34468
HgeneTgene
Gene symbol

SLC39A8

RHEB

Gene ID

64116

6009

Gene namesolute carrier family 39 member 8Ras homolog, mTORC1 binding
SynonymsBIGM103|CDG2N|LZT-Hs6|PP3105|ZIP8RHEB2
Cytomap

4q24

7q36.1

Type of geneprotein-codingprotein-coding
Descriptionzinc transporter ZIP8BCG induced integral membrane protein BIGM103BCG-induced integral membrane protein in monocyte clone 103 proteinLIV-1 subfamily of ZIP zinc transporter 6ZIP-8Zrt- and Irt-like protein 8solute carrier family 39 (metal ion transpoGTP-binding protein RhebRas homolog enriched in brain 2
Modification date2018052320180527
UniProtAcc

Q9C0K1

Q15382

Ensembl transtripts involved in fusion geneENST00000424970, ENST00000394833, 
ENST00000356736, ENST00000510255, 
ENST00000262187, ENST00000472642, 
ENST00000496004, 
Fusion gene scores* DoF score3 X 3 X 3=275 X 5 X 4=100
# samples 35
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SLC39A8 [Title/Abstract] AND RHEB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-HC-7821-01ASLC39A8chr4

103265601

-RHEBchr7

151174501

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000424970ENST00000262187SLC39A8chr4

103265601

-RHEBchr7

151174501

-
5CDS-5UTRENST00000424970ENST00000472642SLC39A8chr4

103265601

-RHEBchr7

151174501

-
5CDS-5UTRENST00000424970ENST00000496004SLC39A8chr4

103265601

-RHEBchr7

151174501

-
In-frameENST00000394833ENST00000262187SLC39A8chr4

103265601

-RHEBchr7

151174501

-
5CDS-5UTRENST00000394833ENST00000472642SLC39A8chr4

103265601

-RHEBchr7

151174501

-
5CDS-5UTRENST00000394833ENST00000496004SLC39A8chr4

103265601

-RHEBchr7

151174501

-
In-frameENST00000356736ENST00000262187SLC39A8chr4

103265601

-RHEBchr7

151174501

-
5CDS-5UTRENST00000356736ENST00000472642SLC39A8chr4

103265601

-RHEBchr7

151174501

-
5CDS-5UTRENST00000356736ENST00000496004SLC39A8chr4

103265601

-RHEBchr7

151174501

-
intron-3CDSENST00000510255ENST00000262187SLC39A8chr4

103265601

-RHEBchr7

151174501

-
intron-5UTRENST00000510255ENST00000472642SLC39A8chr4

103265601

-RHEBchr7

151174501

-
intron-5UTRENST00000510255ENST00000496004SLC39A8chr4

103265601

-RHEBchr7

151174501

-

Top

FusionProtFeatures for SLC39A8_RHEB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SLC39A8

Q9C0K1

RHEB

Q15382

Acts as a manganese and zinc influx transporter(PubMed:12504855, PubMed:26637978). Plays a role in manganesereabsorption in the proximal tubule of the kidney and in manganeseuptake into the brain (PubMed:26637978).{ECO:0000269|PubMed:12504855, ECO:0000305|PubMed:26637978}. Activates the protein kinase activity of mTORC1, andthereby plays a role in the regulation of apoptosis. Stimulatesthe phosphorylation of S6K1 and EIF4EBP1 through activation ofmTORC1 signaling. Has low intrinsic GTPase activity.{ECO:0000269|PubMed:12271141, ECO:0000269|PubMed:12869586,ECO:0000269|PubMed:15340059, ECO:0000269|PubMed:15854902,ECO:0000269|PubMed:16098514, ECO:0000269|PubMed:20381137}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SLC39A8_RHEB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SLC39A8_ENST00000394833_chr4_103265601_-_RHEB_ENST00000262187_chr7_151174501_-_194aa
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQDEYSIFPQTYSIDINGY
ILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMD

>In-frame_SLC39A8_ENST00000356736_chr4_103265601_-_RHEB_ENST00000262187_chr7_151174501_-_194aa
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQDEYSIFPQTYSIDINGY
ILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SLC39A8_ENST00000394833_chr4_103265601_-_RHEB_ENST00000262187_chr7_151174501_-_582nt
ATGGCCCCGGGTCGCGCGGTGGCCGGGCTCCTGTTGCTGGCGGCCGCCGGCCTCGGAGGAGTGGCGGAGGGGCCAGGGCTAGCCTTCAGC
GAGGATGTGCTGAGCGTGTTCGGCGCGAATCTGAGCCTGTCGGCGGCGCAGCTCCAGCACTTGCTGGAGCAGATGGGAGCCGCCTCCCGC
GTGGGCGTCCCGGAGCCTGGCCAGCTGCACTTCAACCAGGATGAATATTCTATCTTTCCTCAGACATACTCCATAGATATTAATGGCTAT
ATTCTTGTGTATTCTGTTACATCAATCAAAAGTTTTGAAGTGATTAAAGTTATCCATGGCAAATTGTTGGATATGGTGGGGAAAGTACAA
ATACCTATTATGTTGGTTGGGAATAAGAAAGACCTGCATATGGAAAGGGTGATCAGTTATGAAGAAGGGAAAGCTTTGGCAGAATCTTGG
AATGCAGCTTTTTTGGAATCTTCTGCTAAAGAAAATCAGACTGCTGTGGATGTTTTTCGAAGGATAATTTTGGAGGCAGAAAAAATGGAC

>In-frame_SLC39A8_ENST00000356736_chr4_103265601_-_RHEB_ENST00000262187_chr7_151174501_-_582nt
ATGGCCCCGGGTCGCGCGGTGGCCGGGCTCCTGTTGCTGGCGGCCGCCGGCCTCGGAGGAGTGGCGGAGGGGCCAGGGCTAGCCTTCAGC
GAGGATGTGCTGAGCGTGTTCGGCGCGAATCTGAGCCTGTCGGCGGCGCAGCTCCAGCACTTGCTGGAGCAGATGGGAGCCGCCTCCCGC
GTGGGCGTCCCGGAGCCTGGCCAGCTGCACTTCAACCAGGATGAATATTCTATCTTTCCTCAGACATACTCCATAGATATTAATGGCTAT
ATTCTTGTGTATTCTGTTACATCAATCAAAAGTTTTGAAGTGATTAAAGTTATCCATGGCAAATTGTTGGATATGGTGGGGAAAGTACAA
ATACCTATTATGTTGGTTGGGAATAAGAAAGACCTGCATATGGAAAGGGTGATCAGTTATGAAGAAGGGAAAGCTTTGGCAGAATCTTGG
AATGCAGCTTTTTTGGAATCTTCTGCTAAAGAAAATCAGACTGCTGTGGATGTTTTTCGAAGGATAATTTTGGAGGCAGAAAAAATGGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SLC39A8_ENST00000394833_chr4_103265601_-_RHEB_ENST00000262187_chr7_151174501_-_2166nt
AGTGTGGTTTTAGTTTTTCCTAAGAAGTGGCGTGGTTTGGGGCTTTATATCCGGGAGGAGCATATGTACGCAAATCCTGGGGCGTTTGCA
AACCCGGATCCGGGGCGTCTGGCCCCATGCCCGGCCGGGCGTTTGAGGGCTACTGCCACGCAGCGTTTCTGGAGCCTGCCGGCTGGTGCC
CTGGTGGCCTTTATCTCTGTCCCCCTTTGTCCTCTTTATCTCAGGCTCTCCAGGAGGCCGGGGGGCCCACTCCGCCTATCGCTCCCCTCG
GCTACGCTGCCACTTCAATGCCCCGCAGGTCGCGAGCTGCTGTTCTTTCGAAGGCGTCGGAGAACCAGGGGCGTCCCGCGCCACCTCTGA
CTCGGAGCAGCGCCGAGCACTGACGCTCCCGCCCTTGGGCAAGGACGCCAGTGCGCCCGCGCGCGTCCCTCTGCGCGGCAGCCCGTCGCG
GGCCCTCAAGGGGAAGCCCAGGCCAGGATGGCCCCGGGTCGCGCGGTGGCCGGGCTCCTGTTGCTGGCGGCCGCCGGCCTCGGAGGAGTG
GCGGAGGGGCCAGGGCTAGCCTTCAGCGAGGATGTGCTGAGCGTGTTCGGCGCGAATCTGAGCCTGTCGGCGGCGCAGCTCCAGCACTTG
CTGGAGCAGATGGGAGCCGCCTCCCGCGTGGGCGTCCCGGAGCCTGGCCAGCTGCACTTCAACCAGGATGAATATTCTATCTTTCCTCAG
ACATACTCCATAGATATTAATGGCTATATTCTTGTGTATTCTGTTACATCAATCAAAAGTTTTGAAGTGATTAAAGTTATCCATGGCAAA
TTGTTGGATATGGTGGGGAAAGTACAAATACCTATTATGTTGGTTGGGAATAAGAAAGACCTGCATATGGAAAGGGTGATCAGTTATGAA
GAAGGGAAAGCTTTGGCAGAATCTTGGAATGCAGCTTTTTTGGAATCTTCTGCTAAAGAAAATCAGACTGCTGTGGATGTTTTTCGAAGG
ATAATTTTGGAGGCAGAAAAAATGGACGGGGCAGCTTCACAAGGCAAGTCTTCATGCTCGGTGATGTGATTCTGCTGCAAAGCCTGAGGA
CACTGGGAATATATTCTACCTGAAGAAGCAAACTGCCCGTTCTCCTTGAAGATAAACTATGCTTCTTTTTTCTTCTGTTAACCTGAAAGA
TATCATTTGGGTCAGAGCTCCCCTCCCTTCAGATTATGTTAACTCTGAGTCTGTCCAAATGAGTTCACTTCCATTTTCAAATTTTAAGCA
ATCATATTTTCAATTTATATATTGTATTTCTTAATATTATGACCAAGAATTTTATCGGCATTAATTTTTCAGTGTAGTTTGTTGTTTAAA
ATAATGTAATCATCAAAATGATGCATATTGTTACACTACTATTAACTAGGCTTCAGTATATCAGTGTTTATTTCATTGTGTTAAATGTAT
ACTTGTAAATAAAATAGCTGCAAACCTCAGTCCTTTGTGCTACTTGATGTGGCTTTCAAAGAAGAGAAGCCTTGTCCTGAGTTTCTCACT
TGGCTTCAGGAAGGCCCCAGGTTGGATTCCAGAAACCAGTGAAGATGTGGCCACAGGAGGAGGTGTGCTGAGGTGGCTGCTGACCGTGGA
CTCCCTGCGCAGTGGCCTGCAGATGTTGGGGCTGGGTTACAGCTGATTGAAGCTGAGTGGCCCTGGGGGGTCTGTGAGGGGAGTTCCTCC
CCAGTGATGAAATTCTCTCCTTCCACCCTCAAATCCCTAGACCTTGACTGAAATGCTCCGTGGTCGGGAGCCTGGTCAAGGAGGAGGAGC
TGCTGAGAGGCATTGTTCGCCCTTGCTCATAGCTTAGCTCGATGTCCGTGTCAGACAGGAGATGATTGAGAACAGCCTTGCCTGTCACTG
TCCTAGAACACCCTGGAGTTTAGTGTTCTGTGTCAGAGTCTTGGGAGCCTCCTTCAGACCCAGATGACGGGCCTCCCTCTGTCCAAGGAG
CAGCTGTAAAGGAGAAGAGGGATTTCATTTGTTTGGTGGCTGTTACCTTGTCTGTAAGTCAAACTTGGAGTTGAGCAGTGCTTTTTAAAC
GATTCCCTTTTGCAGCTAAAATTTCACAGGGCTATTTCTAATACGTAAGCAAATGTTACCATTGACTTTATTAATAAAATATAGTTTTGC

>In-frame_SLC39A8_ENST00000356736_chr4_103265601_-_RHEB_ENST00000262187_chr7_151174501_-_2072nt
CCGCGGACCTGTCAGAGATACAGAGGTTGTGGGGGCGGGAGACAGAAAGAGAGAGAGATCCAGAGACCGAGTCTTACGTTGACACGCAGA
GAGAAAGACGCAGAGACAGACAAACAAACAGATAGGAGAGGCTCTCCAGGAGGCCGGGGGGCCCACTCCGCCTATCGCTCCCCTCGGCTA
CGCTGCCACTTCAATGCCCCGCAGGTCGCGAGCTGCTGTTCTTTCGAAGGCGTCGGAGAACCAGGGGCGTCCCGCGCCACCTCTGACTCG
GAGCAGCGCCGAGCACTGACGCTCCCGCCCTTGGGCAAGGACGCCAGTGCGCCCGCGCGCGTCCCTCTGCGCGGCAGCCCGTCGCGGGCC
CTCAAGGGGAAGCCCAGGCCAGGATGGCCCCGGGTCGCGCGGTGGCCGGGCTCCTGTTGCTGGCGGCCGCCGGCCTCGGAGGAGTGGCGG
AGGGGCCAGGGCTAGCCTTCAGCGAGGATGTGCTGAGCGTGTTCGGCGCGAATCTGAGCCTGTCGGCGGCGCAGCTCCAGCACTTGCTGG
AGCAGATGGGAGCCGCCTCCCGCGTGGGCGTCCCGGAGCCTGGCCAGCTGCACTTCAACCAGGATGAATATTCTATCTTTCCTCAGACAT
ACTCCATAGATATTAATGGCTATATTCTTGTGTATTCTGTTACATCAATCAAAAGTTTTGAAGTGATTAAAGTTATCCATGGCAAATTGT
TGGATATGGTGGGGAAAGTACAAATACCTATTATGTTGGTTGGGAATAAGAAAGACCTGCATATGGAAAGGGTGATCAGTTATGAAGAAG
GGAAAGCTTTGGCAGAATCTTGGAATGCAGCTTTTTTGGAATCTTCTGCTAAAGAAAATCAGACTGCTGTGGATGTTTTTCGAAGGATAA
TTTTGGAGGCAGAAAAAATGGACGGGGCAGCTTCACAAGGCAAGTCTTCATGCTCGGTGATGTGATTCTGCTGCAAAGCCTGAGGACACT
GGGAATATATTCTACCTGAAGAAGCAAACTGCCCGTTCTCCTTGAAGATAAACTATGCTTCTTTTTTCTTCTGTTAACCTGAAAGATATC
ATTTGGGTCAGAGCTCCCCTCCCTTCAGATTATGTTAACTCTGAGTCTGTCCAAATGAGTTCACTTCCATTTTCAAATTTTAAGCAATCA
TATTTTCAATTTATATATTGTATTTCTTAATATTATGACCAAGAATTTTATCGGCATTAATTTTTCAGTGTAGTTTGTTGTTTAAAATAA
TGTAATCATCAAAATGATGCATATTGTTACACTACTATTAACTAGGCTTCAGTATATCAGTGTTTATTTCATTGTGTTAAATGTATACTT
GTAAATAAAATAGCTGCAAACCTCAGTCCTTTGTGCTACTTGATGTGGCTTTCAAAGAAGAGAAGCCTTGTCCTGAGTTTCTCACTTGGC
TTCAGGAAGGCCCCAGGTTGGATTCCAGAAACCAGTGAAGATGTGGCCACAGGAGGAGGTGTGCTGAGGTGGCTGCTGACCGTGGACTCC
CTGCGCAGTGGCCTGCAGATGTTGGGGCTGGGTTACAGCTGATTGAAGCTGAGTGGCCCTGGGGGGTCTGTGAGGGGAGTTCCTCCCCAG
TGATGAAATTCTCTCCTTCCACCCTCAAATCCCTAGACCTTGACTGAAATGCTCCGTGGTCGGGAGCCTGGTCAAGGAGGAGGAGCTGCT
GAGAGGCATTGTTCGCCCTTGCTCATAGCTTAGCTCGATGTCCGTGTCAGACAGGAGATGATTGAGAACAGCCTTGCCTGTCACTGTCCT
AGAACACCCTGGAGTTTAGTGTTCTGTGTCAGAGTCTTGGGAGCCTCCTTCAGACCCAGATGACGGGCCTCCCTCTGTCCAAGGAGCAGC
TGTAAAGGAGAAGAGGGATTTCATTTGTTTGGTGGCTGTTACCTTGTCTGTAAGTCAAACTTGGAGTTGAGCAGTGCTTTTTAAACGATT
CCCTTTTGCAGCTAAAATTTCACAGGGCTATTTCTAATACGTAAGCAAATGTTACCATTGACTTTATTAATAAAATATAGTTTTGCTTTG


Top

FusionGenePPI for SLC39A8_RHEB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SLC39A8TAOK2, GPD2, RMDN2, SLC9A6, LEMD2, C1GALT1C1, C1orf43, ERGIC2, ZDHHC17, EXTL2, VAPB, EDA, ST7L, SGPP1, MGAT5, HMOX1, SPPL3, STX4, SLC22A18, ERGIC3, TMEM179B, TMPPE, VANGL2, TMX2, SLC4A2, GP1BB, TRIM25RHEBTSC2, PDE6D, ATM, ATR, MTOR, HRAS, RAF1, RAP1A, TSC1, RAB7A, RAB9A, RPTOR, A2M, ECSIT, PSEN2, APOE, PSEN1, BNIP3, BNIP3L, RABAC1, TRAF2, ARIH2, NCAM1, FKBP8, PLD1, RPS6KB1, VPS4A, ITGB8, TNF, LDHB, CREB3, DUSP19, SPATA19, NEDD9, NFATC2IP, RAC1, UBB, IL20RA, LAMP2, SRPRB, SLC15A1, ENPP7, LGALS7, TMEM52B, RELL2, HTT, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SLC39A8_RHEB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SLC39A8_RHEB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSLC39A8C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneSLC39A8C4225234CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIn1ORPHANET;UNIPROT
TgeneRHEBC0007131Non-Small Cell Lung Carcinoma1CTD_human