FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34374

FusionGeneSummary for SLC35F2_PIWIL4

check button Fusion gene summary
Fusion gene informationFusion gene name: SLC35F2_PIWIL4
Fusion gene ID: 34374
HgeneTgene
Gene symbol

SLC35F2

PIWIL4

Gene ID

54733

143689

Gene namesolute carrier family 35 member F2piwi like RNA-mediated gene silencing 4
SynonymsHSNOV1HIWI2|MIWI2
Cytomap

11q22.3

11q21

Type of geneprotein-codingprotein-coding
Descriptionsolute carrier family 35 member F2lung squamous cell cancer related protein LSCC-3piwi-like protein 4piwi-like 4testis tissue sperm-binding protein Li 85P
Modification date2018051920180519
UniProtAcc

Q8IXU6

Q7Z3Z4

Ensembl transtripts involved in fusion geneENST00000525071, ENST00000429869, 
ENST00000525815, ENST00000265836, 
ENST00000375682, 
ENST00000299001, 
ENST00000537419, 
Fusion gene scores* DoF score3 X 2 X 3=182 X 1 X 2=4
# samples 32
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/4*10)=2.32192809488736
Context

PubMed: SLC35F2 [Title/Abstract] AND PIWIL4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-D9-A4Z3-01ASLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000525071ENST00000299001SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
5CDS-intronENST00000525071ENST00000537419SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
Frame-shitENST00000429869ENST00000299001SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
5CDS-intronENST00000429869ENST00000537419SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
In-frameENST00000525815ENST00000299001SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
5CDS-intronENST00000525815ENST00000537419SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
5UTR-3CDSENST00000265836ENST00000299001SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
5UTR-intronENST00000265836ENST00000537419SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
intron-3CDSENST00000375682ENST00000299001SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+
intron-intronENST00000375682ENST00000537419SLC35F2chr11

107729384

-PIWIL4chr11

94340605

+

Top

FusionProtFeatures for SLC35F2_PIWIL4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SLC35F2

Q8IXU6

PIWIL4

Q7Z3Z4

Putative solute transporter. {ECO:0000305}. Plays a central role during spermatogenesis byrepressing transposable elements and preventing theirmobilization, which is essential for the germline integrity (Bysimilarity). Acts via the piRNA metabolic process, which mediatesthe repression of transposable elements during meiosis by formingcomplexes composed of piRNAs and Piwi proteins and governs themethylation and subsequent repression of transposons (Bysimilarity). Directly binds piRNAs, a class of 24 to 30 nucleotideRNAs that are generated by a Dicer-independent mechanism and areprimarily derived from transposons and other repeated sequenceelements (By similarity). Associates with secondary piRNAsantisense and PIWIL2/MILI is required for such association (Bysimilarity). The piRNA process acts upstream of known mediators ofDNA methylation (By similarity). Does not show endonucleaseactivity (By similarity). Plays a key role in the piRNAamplification loop, also named ping-pong amplification cycle, byacting as a 'slicer-incompetent' component that loads cleavedpiRNAs from the 'slicer-competent' component PIWIL2 and targetthem on genomic transposon loci in the nucleus (By similarity).May be involved in the chromatin-modifying pathway by inducing'Lys-9' methylation of histone H3 at some loci (PubMed:17544373).{ECO:0000250|UniProtKB:Q8CGT6, ECO:0000269|PubMed:17544373}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SLC35F2_PIWIL4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SLC35F2_ENST00000525815_chr11_107729384_-_PIWIL4_ENST00000299001_chr11_94340605_+_343aa
MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWXCAFCLLIRRPIMIPLKNIXAQTAQSQANVCLLGPXINRAXXXVSPPRSLCRX
LASSEASCGLWKYLXSPXWWSVLMSVKMHSARTXWLLDAWPVLTPESPGGFPAVSFREQXLMLQIAXKFSXLEHSTNGTSTIMICQHGXL
CTVLVXGMVSXKHLLNMKSHSCXAVWQNPAQIPAQDCRXLWSGRSACHDSLPKXTALYRTPHLALLWIQKQHVTNGMTFIXSARWPAGEL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SLC35F2_ENST00000525815_chr11_107729384_-_PIWIL4_ENST00000299001_chr11_94340605_+_1031nt
ATGGAGGCAGACTCGCCAGCGGGCCCCGGCGCCCCAGAGCCCCTCGCGGAGGGAGCGGCGGCCGAGTTCTCCAGCCTGCTGCGCAGGATA
AAAGGCAAACTCTTCACCTGGTAATGTGCATTCTGCCTTCTAATCAGAAGACCTATTATGATTCCATTAAAAAATATTTGAGCTCAGACT
GCCCAGTCCCAAGCCAATGTGTGCTTGCTCGGACCTTGAATAAACAGGGCATGATGATGAGTATCGCCACCAAGATCGCTATGCAGATGA
CTTGCAAGCTCGGAGGCGAGCTGTGGGCTGTGGAAATACCTTTAAAGTCCCTGATGGTGGTCGGTATTGATGTCTGTAAAGATGCACTCA
GCAAGGACGTGATGGTTGTTGGATGCGTGGCCAGTGTTAACCCCAGAATCACCAGGTGGTTTTCCCGCTGTATCCTTCAGAGAACAATGA
CTGATGTTGCAGATTGCTTGAAAGTTTTCATGACTGGAGCACTCAACAAATGGTACAAGTACAATCATGATTTGCCAGCACGGATAATTG
TGTACCGTGCTGGTGTAGGGGATGGTCAGCTGAAAACACTTATTGAATATGAAGTCCCACAGCTGCTGAGCAGTGTGGCAGAATCCAGCT
CAAATACCAGCTCAAGACTGTCGGTGATTGTGGTCAGGAAGAAGTGCATGCCACGATTCTTTACCGAAATGAACCGCACTGTACAGAACC
CCCCACTTGGCACTGTTGTGGATTCAGAAGCAACACGTAACGAATGGTATGACTTTTATCTGATCAGCCAGGTGGCCTGCCGGGGAACTG
TTAGTCCTACCTACTATAATGTCATCTATGATGACAACGGCTTGAAGCCCGACCATATGCAGAGACTTACATTCAAATTGTGCCACCTGT
ACTACAACTGGCCGGGCATAGTCAGTGTCCCAGCACCATGTCAGTATGCTCACAAGCTGACCTTTCTGGTGGCACAAAGCATTCATAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SLC35F2_ENST00000525815_chr11_107729384_-_PIWIL4_ENST00000299001_chr11_94340605_+_1881nt
ACTGCTTCTAACTCACTGCTCACTCACCGCTTCTTAGCTTAGGAATCACCTACAATAACCTCGTGTCACTGTATCTTGTGATTTCAAACA
AGGAACCCTAAAAACCTGAAGGCACACTGGGTGCCGCTCAACAATAAGGCTCGGCTGCCAAGACGAAAAAAAAATTGCCCTTTCTCCTCC
TGCCACCCTGGAGGTGCCAGGTTGTAATCTGCAAATGTATTGTCTGGCCCTTAGGGCTTGACAGTTAATGATTGGTCGCTGAAGGAGCCG
AGCGGAGGAGCGAGAGGGACGCGAGCAAGCGAGCGAGGGAGGGAGCGCAGGGCCAGAGCGGAGCCCCAGCCGGCCGCACAGGCACCGCCT
CCCGTCTTCCGGGACCCGGCACTTCGGGGGTTTTGGGCGCCGGAGACGCGCAAGGGCGCCGATGGAGGCAGACTCGCCAGCGGGCCCCGG
CGCCCCAGAGCCCCTCGCGGAGGGAGCGGCGGCCGAGTTCTCCAGCCTGCTGCGCAGGATAAAAGGCAAACTCTTCACCTGGTAATGTGC
ATTCTGCCTTCTAATCAGAAGACCTATTATGATTCCATTAAAAAATATTTGAGCTCAGACTGCCCAGTCCCAAGCCAATGTGTGCTTGCT
CGGACCTTGAATAAACAGGGCATGATGATGAGTATCGCCACCAAGATCGCTATGCAGATGACTTGCAAGCTCGGAGGCGAGCTGTGGGCT
GTGGAAATACCTTTAAAGTCCCTGATGGTGGTCGGTATTGATGTCTGTAAAGATGCACTCAGCAAGGACGTGATGGTTGTTGGATGCGTG
GCCAGTGTTAACCCCAGAATCACCAGGTGGTTTTCCCGCTGTATCCTTCAGAGAACAATGACTGATGTTGCAGATTGCTTGAAAGTTTTC
ATGACTGGAGCACTCAACAAATGGTACAAGTACAATCATGATTTGCCAGCACGGATAATTGTGTACCGTGCTGGTGTAGGGGATGGTCAG
CTGAAAACACTTATTGAATATGAAGTCCCACAGCTGCTGAGCAGTGTGGCAGAATCCAGCTCAAATACCAGCTCAAGACTGTCGGTGATT
GTGGTCAGGAAGAAGTGCATGCCACGATTCTTTACCGAAATGAACCGCACTGTACAGAACCCCCCACTTGGCACTGTTGTGGATTCAGAA
GCAACACGTAACGAATGGTATGACTTTTATCTGATCAGCCAGGTGGCCTGCCGGGGAACTGTTAGTCCTACCTACTATAATGTCATCTAT
GATGACAACGGCTTGAAGCCCGACCATATGCAGAGACTTACATTCAAATTGTGCCACCTGTACTACAACTGGCCGGGCATAGTCAGTGTC
CCAGCACCATGTCAGTATGCTCACAAGCTGACCTTTCTGGTGGCACAAAGCATTCATAAAGAACCCAGTCTGGAATTAGCCAACCATCTC
TTCTACCTGTGATGGCATGAACTACTGGCATCACTAGATGGACAATCCAAGAAGAAATTGGTATACTTTGTGCAAATCTGCCATAAGCTC
AAGGCTGTGACTGGGGAAAAAGATTGAGCTTAGTTTTCATGTCTAGGAAAAAAAGCAAAACAACTTAATCTGAAACAGTTTTAAAAAATG
TGTGTTATTTTGTTTTAAAGAGTTGTATGCTTGGGGTAAATTTTCATTGTCATATGTGGAATTTAAATATACCATCATCTACAAAGAATT
CCACAGAGTTAAATATCTTAAGTTAAACACTTAAAATAAGTGTTTGCGTGATATTTTGATGACAGATAAACAGAGTCTAATTCCCACCCC


Top

FusionGenePPI for SLC35F2_PIWIL4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SLC35F2ELAVL1, POMK, FAM134C, TMEM17, VIPR2, C3AR1, FPR2, SPPL2B, LPAR1, HTR2C, VSIG1, SNX1, TRIM25PIWIL4DICER1, RELA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SLC35F2_PIWIL4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SLC35F2_PIWIL4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePIWIL4C0028960Oligospermia1CTD_human