FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34340

FusionGeneSummary for SLC34A2_ROS1

check button Fusion gene summary
Fusion gene informationFusion gene name: SLC34A2_ROS1
Fusion gene ID: 34340
HgeneTgene
Gene symbol

SLC34A2

ROS1

Gene ID

10568

6098

Gene namesolute carrier family 34 member 2ROS proto-oncogene 1, receptor tyrosine kinase
SynonymsNAPI-3B|NAPI-IIb|NPTIIbMCF3|ROS|c-ros-1
Cytomap

4p15.2

6q22.1

Type of geneprotein-codingprotein-coding
Descriptionsodium-dependent phosphate transport protein 2Bsodium/phosphate cotransporter 2Bsolute carrier family 34 (sodium phosphate), member 2solute carrier family 34 (type II sodium/phosphate cotransporter), member 2type II sodium-dependent phosphate transporproto-oncogene tyrosine-protein kinase ROSROS proto-oncogene 1 , receptor tyrosine kinasec-ros oncogene 1 , receptor tyrosine kinaseproto-oncogene c-Ros-1transmembrane tyrosine-specific protein kinasev-ros avian UR2 sarcoma virus oncogene homolog 1
Modification date2018052320180523
UniProtAcc

O95436

P08922

Ensembl transtripts involved in fusion geneENST00000504570, ENST00000382051, 
ENST00000503434, ENST00000510033, 
ENST00000368508, ENST00000368507, 
Fusion gene scores* DoF score6 X 5 X 3=905 X 6 X 3=90
# samples 1112
** MAII scorelog2(11/90*10)=0.289506617194985
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(12/90*10)=0.415037499278844
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SLC34A2 [Title/Abstract] AND ROS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSLC34A2

GO:0006817

phosphate ion transport

10329428|10610722|12488042

HgeneSLC34A2

GO:0030643

cellular phosphate ion homeostasis

10610722

TgeneROS1

GO:0001558

regulation of cell growth

16885344

TgeneROS1

GO:0006468

protein phosphorylation

16885344

TgeneROS1

GO:0032006

regulation of TOR signaling

16885344


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-05-4426-01ASLC34A2chr4

25678324

+ROS1chr6

117645578

-
TCGALDLUADTCGA-62-A46Y-01ASLC34A2chr4

25678324

+ROS1chr6

117650609

-
ChiTaRS3.1EU236946SLC34A2chr4

25665952

+ROS1chr6

117650611

-
ChiTaRS3.1EU236947SLC34A2chr4

25665952

+ROS1chr6

117645580

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000504570ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117645578

-
Frame-shitENST00000504570ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117645578

-
In-frameENST00000382051ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117645578

-
In-frameENST00000382051ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117645578

-
Frame-shitENST00000503434ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117645578

-
Frame-shitENST00000503434ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117645578

-
intron-3CDSENST00000510033ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117645578

-
intron-3CDSENST00000510033ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117645578

-
Frame-shitENST00000504570ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117650609

-
Frame-shitENST00000504570ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117650609

-
In-frameENST00000382051ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117650609

-
In-frameENST00000382051ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117650609

-
Frame-shitENST00000503434ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117650609

-
Frame-shitENST00000503434ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117650609

-
intron-3CDSENST00000510033ENST00000368508SLC34A2chr4

25678324

+ROS1chr6

117650609

-
intron-3CDSENST00000510033ENST00000368507SLC34A2chr4

25678324

+ROS1chr6

117650609

-
In-frameENST00000504570ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117650611

-
In-frameENST00000504570ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117650611

-
In-frameENST00000382051ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117650611

-
In-frameENST00000382051ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117650611

-
In-frameENST00000503434ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117650611

-
In-frameENST00000503434ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117650611

-
intron-3CDSENST00000510033ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117650611

-
intron-3CDSENST00000510033ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117650611

-
In-frameENST00000504570ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117645580

-
In-frameENST00000504570ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117645580

-
In-frameENST00000382051ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117645580

-
In-frameENST00000382051ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117645580

-
In-frameENST00000503434ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117645580

-
In-frameENST00000503434ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117645580

-
intron-3CDSENST00000510033ENST00000368508SLC34A2chr4

25665952

+ROS1chr6

117645580

-
intron-3CDSENST00000510033ENST00000368507SLC34A2chr4

25665952

+ROS1chr6

117645580

-

Top

FusionProtFeatures for SLC34A2_ROS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SLC34A2

O95436

ROS1

P08922

May be involved in actively transporting phosphate intocells via Na(+) cotransport. It may be the main phosphatetransport protein in the intestinal brush border membrane. Mayhave a role in the synthesis of surfactant in lungs' alveoli. Orphan receptor tyrosine kinase (RTK) that plays a rolein epithelial cell differentiation and regionalization of theproximal epididymal epithelium. May activate several downstreamsignaling pathways related to cell differentiation, proliferation,growth and survival including the PI3 kinase-mTOR signalingpathway. Mediates the phosphorylation of PTPN11, an activator ofthis pathway. May also phosphorylate and activate thetranscription factor STAT3 to control anchorage-independent cellgrowth. Mediates the phosphorylation and the activation of VAV3, aguanine nucleotide exchange factor regulating cell morphology. Mayactivate other downstream signaling proteins including AKT1,MAPK1, MAPK3, IRS1 and PLCG2. {ECO:0000269|PubMed:11094073,ECO:0000269|PubMed:16885344}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+4131_100126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+4131_100125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+4131_100125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+4131_100126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+4131_100125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+4131_100125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413101_121126691TransmembraneHelical%3B Name%3DM1
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413101_121125690TransmembraneHelical%3B Name%3DM1
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413101_121125690TransmembraneHelical%3B Name%3DM1
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413101_121126691TransmembraneHelical%3B Name%3DM1
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413101_121125690TransmembraneHelical%3B Name%3DM1
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413101_121125690TransmembraneHelical%3B Name%3DM1
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431945_222218522348DomainProtein kinase
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431752_185417492348DomainFibronectin type-III 9
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431945_222217492348DomainProtein kinase
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431951_195918522348Nucleotide bindingATP
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431951_195917492348Nucleotide bindingATP
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431883_234718522348Topological domainCytoplasmic
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431883_234717492348Topological domainCytoplasmic
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431860_188218522348TransmembraneHelical
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431860_188217492348TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413464_467126691Compositional biasNote=Poly-Thr
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413612_644126691Compositional biasNote=Cys-rich
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413464_467125690Compositional biasNote=Poly-Thr
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413612_644125690Compositional biasNote=Cys-rich
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413464_467125690Compositional biasNote=Poly-Thr
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413612_644125690Compositional biasNote=Cys-rich
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413464_467126691Compositional biasNote=Poly-Thr
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413612_644126691Compositional biasNote=Cys-rich
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413464_467125690Compositional biasNote=Poly-Thr
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413612_644125690Compositional biasNote=Cys-rich
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413464_467125690Compositional biasNote=Poly-Thr
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413612_644125690Compositional biasNote=Cys-rich
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413122_135126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413157_212126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413234_362126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413384_407126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413429_485126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413507_525126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413547_552126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413574_689126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413122_135125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413157_212125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413234_362125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413384_407125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413429_485125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413507_525125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413547_552125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413574_689125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413122_135125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413157_212125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413234_362125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413384_407125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413429_485125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413507_525125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413547_552125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413574_689125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413122_135126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413157_212126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413234_362126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413384_407126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413429_485126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413507_525126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413547_552126691Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413574_689126691Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413122_135125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413157_212125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413234_362125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413384_407125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413429_485125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413507_525125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413547_552125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413574_689125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413122_135125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413157_212125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413234_362125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413384_407125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413429_485125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413507_525125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413547_552125690Topological domainExtracellular
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413574_689125690Topological domainCytoplasmic
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413136_156126691TransmembraneHelical%3B Name%3DM2
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413213_233126691TransmembraneHelical%3B Name%3DM3
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413363_383126691TransmembraneHelical%3B Name%3DM4
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413408_428126691TransmembraneHelical%3B Name%3DM5
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413486_506126691TransmembraneHelical%3B Name%3DM6
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413526_546126691TransmembraneHelical%3B Name%3DM7
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000382051+413553_573126691TransmembraneHelical%3B Name%3DM8
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413136_156125690TransmembraneHelical%3B Name%3DM2
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413213_233125690TransmembraneHelical%3B Name%3DM3
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413363_383125690TransmembraneHelical%3B Name%3DM4
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413408_428125690TransmembraneHelical%3B Name%3DM5
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413486_506125690TransmembraneHelical%3B Name%3DM6
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413526_546125690TransmembraneHelical%3B Name%3DM7
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000503434+413553_573125690TransmembraneHelical%3B Name%3DM8
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413136_156125690TransmembraneHelical%3B Name%3DM2
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413213_233125690TransmembraneHelical%3B Name%3DM3
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413363_383125690TransmembraneHelical%3B Name%3DM4
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413408_428125690TransmembraneHelical%3B Name%3DM5
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413486_506125690TransmembraneHelical%3B Name%3DM6
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413526_546125690TransmembraneHelical%3B Name%3DM7
HgeneSLC34A2chr4:25665952chr6:117645580ENST00000504570+413553_573125690TransmembraneHelical%3B Name%3DM8
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413136_156126691TransmembraneHelical%3B Name%3DM2
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413213_233126691TransmembraneHelical%3B Name%3DM3
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413363_383126691TransmembraneHelical%3B Name%3DM4
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413408_428126691TransmembraneHelical%3B Name%3DM5
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413486_506126691TransmembraneHelical%3B Name%3DM6
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413526_546126691TransmembraneHelical%3B Name%3DM7
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000382051+413553_573126691TransmembraneHelical%3B Name%3DM8
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413136_156125690TransmembraneHelical%3B Name%3DM2
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413213_233125690TransmembraneHelical%3B Name%3DM3
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413363_383125690TransmembraneHelical%3B Name%3DM4
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413408_428125690TransmembraneHelical%3B Name%3DM5
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413486_506125690TransmembraneHelical%3B Name%3DM6
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413526_546125690TransmembraneHelical%3B Name%3DM7
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000503434+413553_573125690TransmembraneHelical%3B Name%3DM8
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413136_156125690TransmembraneHelical%3B Name%3DM2
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413213_233125690TransmembraneHelical%3B Name%3DM3
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413363_383125690TransmembraneHelical%3B Name%3DM4
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413408_428125690TransmembraneHelical%3B Name%3DM5
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413486_506125690TransmembraneHelical%3B Name%3DM6
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413526_546125690TransmembraneHelical%3B Name%3DM7
HgeneSLC34A2chr4:25665952chr6:117650611ENST00000504570+413553_573125690TransmembraneHelical%3B Name%3DM8
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-3243101_19618522348DomainFibronectin type-III 1
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431043_115018522348DomainFibronectin type-III 5
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431450_155618522348DomainFibronectin type-III 6
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431557_165618522348DomainFibronectin type-III 7
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431658_175118522348DomainFibronectin type-III 8
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-32431752_185418522348DomainFibronectin type-III 9
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-3243197_28518522348DomainFibronectin type-III 2
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-3243557_67118522348DomainFibronectin type-III 3
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-3243947_104218522348DomainFibronectin type-III 4
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-3043101_19617492348DomainFibronectin type-III 1
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431043_115017492348DomainFibronectin type-III 5
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431450_155617492348DomainFibronectin type-III 6
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431557_165617492348DomainFibronectin type-III 7
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-30431658_175117492348DomainFibronectin type-III 8
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-3043197_28517492348DomainFibronectin type-III 2
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-3043557_67117492348DomainFibronectin type-III 3
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-3043947_104217492348DomainFibronectin type-III 4
TgeneROS1chr4:25665952chr6:117645580ENST00000368508-324328_185918522348Topological domainExtracellular
TgeneROS1chr4:25665952chr6:117650611ENST00000368508-304328_185917492348Topological domainExtracellular


Top

FusionGeneSequence for SLC34A2_ROS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368508_chr6_117645578_-_1853aa
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPWNLPTLQDSGIKWSERDTKGK
ILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKP
FTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSALTPLIGIGVIT
IERATPLTLGSNIGTTTTAILAALASPGNALRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKTRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL_GTPQIVRDGGMVLEFCMLSSLPLLHPFTT
SRRFAPH_RMKLMQSYLTRFPLAWW_ACRALLFQPLVTQ_SFTPGRHRMVPKEN_RMNLAGRMSNPAPSWVGQ_NLFSDSKTIFRKKRPR
EGMTERLSQMRKCTLTDTQAQASPFF_TKVWQPRAAAPWPPCPRSAWVRGHSVIVWKLQTTRCGSIPLPSAPHIPHQGFLTWTGVLVQAV
HLQFPCPHASGMGATPELEFRLDTCAHLLLLSS_ETESGADGGEESEE_VA_HSAKRAPDS_FSKLRSPIQKHCG_SLTLLSWSDNKSPP
CWIF_NKTCKLSRLVACMLPP_IPGSICTWNSSPPLSASLLSVQDDFLG_LPSFHPPTHWNLFPNIFPFSHRWALISCPLSMPAKLQIFG
ESCTQLDCPVNWDH_VQSSTRVCMGQRGVFLLILDAFSVPSTASCLITPLPPPHPQPSQFFLASALQPTLGKEEWV_PCSKIGASPIPAS
PPSQQVRISDSPPLTLPLVDINSQTEPNTLTL_SQPCTAFFISTIVNGLHDLCF_CSHLEMRQASSMKCKERNHFVTFVIPPLWPCLPRP
LCITVS_TRAGAVAVFVLW_FLKIESLYLH_LTNNFETRSRCVAQAGLKLLRSSNPPTSASQSAEITGVSHHQA_L_FFFFFFYWLWEGR
NKIIKPKNDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACTAIHTLPTQEEIE
NLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYII
LELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYT
RKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQR
PTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQ

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368507_chr6_117645578_-_1853aa
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPWNLPTLQDSGIKWSERDTKGK
ILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKP
FTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSALTPLIGIGVIT
IERATPLTLGSNIGTTTTAILAALASPGNALRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKTRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL_GTPQIVRDGGMVLEFCMLSSLPLLHPFTT
SRRFAPH_RMKLMQSYLTRFPLAWW_ACRALLFQPLVTQ_SFTPGRHRMVPKEN_RMNLAGRMSNPAPSWVGQ_NLFSDSKTIFRKKRPR
EGMTERLSQMRKCTLTDTQAQASPFF_TKVWQPRAAAPWPPCPRSAWVRGHSVIVWKLQTTRCGSIPLPSAPHIPHQGFLTWTGVLVQAV
HLQFPCPHASGMGATPELEFRLDTCAHLLLLSS_ETESGADGGEESEE_VA_HSAKRAPDS_FSKLRSPIQKHCG_SLTLLSWSDNKSPP
CWIF_NKTCKLSRLVACMLPP_IPGSICTWNSSPPLSASLLSVQDDFLG_LPSFHPPTHWNLFPNIFPFSHRWALISCPLSMPAKLQIFG
ESCTQLDCPVNWDH_VQSSTRVCMGQRGVFLLILDAFSVPSTASCLITPLPPPHPQPSQFFLASALQPTLGKEEWV_PCSKIGASPIPAS
PPSQQVRISDSPPLTLPLVDINSQTEPNTLTL_SQPCTAFFISTIVNGLHDLCF_CSHLEMRQASSMKCKERNHFVTFVIPPLWPCLPRP
LCITVS_TRAGAVAVFVLW_FLKIESLYLH_LTNNFETRSRCVAQAGLKLLRSSNPPTSASQSAEITGVSHHQA_L_FFFFFFYWLWEGR
NKIIKPKNDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACTAIHTLPTQEEIE
NLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYII
LELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYT
RKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQR
PTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQ

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368508_chr6_117650609_-_1956aa
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPWNLPTLQDSGIKWSERDTKGK
ILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKP
FTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSALTPLIGIGVIT
IERATPLTLGSNIGTTTTAILAALASPGNALRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKTRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL_GTPQIVRDGGMVLEFCMLSSLPLLHPFTT
SRRFAPH_RMKLMQSYLTRFPLAWW_ACRALLFQPLVTQ_SFTPGRHRMVPKEN_RMNLAGRMSNPAPSWVGQ_NLFSDSKTIFRKKRPR
EGMTERLSQMRKCTLTDTQAQASPFF_TKVWQPRAAAPWPPCPRSAWVRGHSVIVWKLQTTRCGSIPLPSAPHIPHQGFLTWTGVLVQAV
HLQFPCPHASGMGATPELEFRLDTCAHLLLLSS_ETESGADGGEESEE_VA_HSAKRAPDS_FSKLRSPIQKHCG_SLTLLSWSDNKSPP
CWIF_NKTCKLSRLVACMLPP_IPGSICTWNSSPPLSASLLSVQDDFLG_LPSFHPPTHWNLFPNIFPFSHRWALISCPLSMPAKLQIFG
ESCTQLDCPVNWDH_VQSSTRVCMGQRGVFLLILDAFSVPSTASCLITPLPPPHPQPSQFFLASALQPTLGKEEWV_PCSKIGASPIPAS
PPSQQVRISDSPPLTLPLVDINSQTEPNTLTL_SQPCTAFFISTIVNGLHDLCF_CSHLEMRQASSMKCKERNHFVTFVIPPLWPCLPRP
LCITVS_TRAGAVAVFVLW_FLKIESLYLH_LTNNFETRSRCVAQAGLKLLRSSNPPTSASQSAEITGVSHHQA_L_FFFFFFYWLWEGR
NKIIKPKTGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYTILEIRKSTSNNLQNQNLRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVA
ANNLGFGETSGISENIILVGDDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANAC
TAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQ
LGVCLLNEPQYIILELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGD
FGLARDITKNDYTRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWN
LMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECG

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368507_chr6_117650609_-_1956aa
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLIDEPTEVDDPWNLPTLQDSGIKWSERDTKGK
ILCFFQGIGRLILLLGFLYFFVCSLDILSSAFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKP
FTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSALTPLIGIGVIT
IERATPLTLGSNIGTTTTAILAALASPGNALRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKTRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACC
LLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTAL_GTPQIVRDGGMVLEFCMLSSLPLLHPFTT
SRRFAPH_RMKLMQSYLTRFPLAWW_ACRALLFQPLVTQ_SFTPGRHRMVPKEN_RMNLAGRMSNPAPSWVGQ_NLFSDSKTIFRKKRPR
EGMTERLSQMRKCTLTDTQAQASPFF_TKVWQPRAAAPWPPCPRSAWVRGHSVIVWKLQTTRCGSIPLPSAPHIPHQGFLTWTGVLVQAV
HLQFPCPHASGMGATPELEFRLDTCAHLLLLSS_ETESGADGGEESEE_VA_HSAKRAPDS_FSKLRSPIQKHCG_SLTLLSWSDNKSPP
CWIF_NKTCKLSRLVACMLPP_IPGSICTWNSSPPLSASLLSVQDDFLG_LPSFHPPTHWNLFPNIFPFSHRWALISCPLSMPAKLQIFG
ESCTQLDCPVNWDH_VQSSTRVCMGQRGVFLLILDAFSVPSTASCLITPLPPPHPQPSQFFLASALQPTLGKEEWV_PCSKIGASPIPAS
PPSQQVRISDSPPLTLPLVDINSQTEPNTLTL_SQPCTAFFISTIVNGLHDLCF_CSHLEMRQASSMKCKERNHFVTFVIPPLWPCLPRP
LCITVS_TRAGAVAVFVLW_FLKIESLYLH_LTNNFETRSRCVAQAGLKLLRSSNPPTSASQSAEITGVSHHQA_L_FFFFFFYWLWEGR
NKIIKPKTGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYTILEIRKSTSNNLQNQNLRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVA
ANNLGFGETSGISENIILVGDDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANAC
TAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQ
LGVCLLNEPQYIILELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGD
FGLARDITKNDYTRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWN
LMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368508_chr6_117645578_-_5559nt
ATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGAT
AAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATA
GATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAG
ATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGC
GCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTCAGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGG
GTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACGTCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCT
GCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATCACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTC
AGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAACTGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTAC
CTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTCAAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCC
TTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGCCAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAG
ATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTCACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACG
GATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAGGAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCG
GATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTGGTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTG
CTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAACACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATC
CTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCTGTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACC
ATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGCACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCA
TTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTCAACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTG
CCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAGTATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATC
CCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTGCTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTG
TGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCGAAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTG
AAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTCCAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGC
TTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGCTGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAG
GCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCTCAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTG
TAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTTGAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACC
TCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAGTCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCA
CTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCAGGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCG
GGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAGAACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGG
GAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACTCTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTC
TGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGATCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACC
ACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATTCCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTT
CACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCCACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTC
TTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAAGAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGAT
TCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGTGGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCC
TGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTCGTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGG
AATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAAGATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGG
AATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCTTTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGG
GAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCATTAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTC
CTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCCTGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTC
TTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAGTGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCT
CCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTGACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTA
TATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTATATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAA
ATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCACTTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCA
CTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCCGTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCAT
TGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCTCAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCC
TCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCCTGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGA
AATAAAATCATCAAACCCAAAAATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACA
ATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAG
TTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAA
AATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTG
GACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTG
AAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATC
CTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGAC
CTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGC
CTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTAT
AGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGG
TCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAA
ACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGA
CCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAAC
AGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAA
ACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAG
GAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCT

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368507_chr6_117645578_-_5559nt
ATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGAT
AAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATA
GATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAG
ATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGC
GCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTCAGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGG
GTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACGTCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCT
GCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATCACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTC
AGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAACTGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTAC
CTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTCAAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCC
TTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGCCAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAG
ATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTCACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACG
GATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAGGAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCG
GATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTGGTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTG
CTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAACACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATC
CTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCTGTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACC
ATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGCACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCA
TTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTCAACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTG
CCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAGTATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATC
CCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTGCTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTG
TGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCGAAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTG
AAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTCCAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGC
TTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGCTGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAG
GCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCTCAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTG
TAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTTGAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACC
TCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAGTCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCA
CTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCAGGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCG
GGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAGAACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGG
GAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACTCTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTC
TGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGATCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACC
ACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATTCCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTT
CACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCCACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTC
TTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAAGAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGAT
TCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGTGGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCC
TGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTCGTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGG
AATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAAGATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGG
AATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCTTTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGG
GAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCATTAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTC
CTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCCTGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTC
TTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAGTGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCT
CCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTGACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTA
TATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTATATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAA
ATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCACTTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCA
CTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCCGTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCAT
TGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCTCAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCC
TCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCCTGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGA
AATAAAATCATCAAACCCAAAAATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACA
ATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAG
TTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAA
AATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTG
GACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTG
AAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATC
CTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGAC
CTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGC
CTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTAT
AGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGG
TCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAA
ACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGA
CCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAAC
AGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAA
ACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAG
GAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCT

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368508_chr6_117650609_-_5868nt
ATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGAT
AAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATA
GATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAG
ATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGC
GCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTCAGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGG
GTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACGTCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCT
GCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATCACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTC
AGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAACTGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTAC
CTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTCAAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCC
TTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGCCAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAG
ATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTCACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACG
GATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAGGAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCG
GATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTGGTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTG
CTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAACACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATC
CTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCTGTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACC
ATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGCACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCA
TTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTCAACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTG
CCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAGTATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATC
CCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTGCTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTG
TGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCGAAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTG
AAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTCCAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGC
TTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGCTGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAG
GCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCTCAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTG
TAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTTGAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACC
TCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAGTCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCA
CTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCAGGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCG
GGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAGAACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGG
GAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACTCTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTC
TGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGATCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACC
ACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATTCCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTT
CACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCCACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTC
TTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAAGAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGAT
TCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGTGGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCC
TGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTCGTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGG
AATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAAGATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGG
AATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCTTTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGG
GAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCATTAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTC
CTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCCTGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTC
TTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAGTGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCT
CCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTGACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTA
TATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTATATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAA
ATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCACTTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCA
CTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCCGTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCAT
TGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCTCAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCC
TCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCCTGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGA
AATAAAATCATCAAACCCAAAACTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAG
AAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGG
TGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCT
GCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTC
ATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCC
AAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGC
TATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGA
AGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTG
AAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAG
CTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGG
ATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGG
ATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGAC
TTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGT
TTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTAT
CCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAAT
TTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTC
TTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGT
TTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGC
CAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGAC
AAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATAT

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368507_chr6_117650609_-_5868nt
ATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGAT
AAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATA
GATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAG
ATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGC
GCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTCAGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGG
GTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACGTCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCT
GCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATCACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTC
AGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAACTGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTAC
CTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTCAAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCC
TTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGCCAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAG
ATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTCACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACG
GATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAGGAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCG
GATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTGGTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTG
CTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAACACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATC
CTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCTGTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACC
ATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGCACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCA
TTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTCAACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTG
CCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAGTATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATC
CCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTGCTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTG
TGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCGAAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTG
AAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTCCAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGC
TTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGCTGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAG
GCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCTCAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTG
TAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTTGAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACC
TCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAGTCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCA
CTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCAGGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCG
GGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAGAACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGG
GAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACTCTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTC
TGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGATCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACC
ACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATTCCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTT
CACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCCACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTC
TTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAAGAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGAT
TCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGTGGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCC
TGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTCGTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGG
AATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAAGATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGG
AATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCTTTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGG
GAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCATTAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTC
CTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCCTGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTC
TTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAGTGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCT
CCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTGACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTA
TATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTATATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAA
ATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCACTTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCA
CTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCCGTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCAT
TGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCTCAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCC
TCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCCTGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGA
AATAAAATCATCAAACCCAAAACTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAG
AAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGG
TGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCT
GCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTC
ATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCC
AAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGC
TATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGA
AGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTG
AAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAG
CTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGG
ATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGG
ATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGAC
TTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGT
TTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTAT
CCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAAT
TTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTC
TTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGT
TTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGC
CAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGAC
AAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368508_chr6_117645578_-_5889nt
GGCGGCGCCCGGCCTTGCTCAACGCCCAGCAGTCCCCACCGTCGCTGCCGCCGCCACCGCCCTCGGCCGCTGCCGAGGCCTCCTGCAGCC
ATCATGTCCGCCAGCGCCGTCTACGTGCTGGACCTGAAGGGCAAGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCC
GATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCT
GTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACT
CTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTT
CTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTC
AGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGGGTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACG
TCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCTGCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATC
ACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTCAGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAAC
TGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTACCTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTC
AAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCCTTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGC
CAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAGATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTC
ACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACGGATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAG
GAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCGGATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTG
GTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTGCTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAAC
ACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATCCTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCT
GTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACCATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGC
ACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCATTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTC
AACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTGCCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAG
TATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATCCCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTG
CTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTGTGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCG
AAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTGAAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTC
CAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGCTTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGC
TGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAGGCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCT
CAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTGTAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTT
GAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACCTCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAG
TCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCACTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCA
GGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCGGGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAG
AACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGGGAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACT
CTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTCTGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGA
TCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACCACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATT
CCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTTCACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCC
ACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTCTTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAA
GAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGATTCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGT
GGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCCTGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTC
GTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGGAATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAA
GATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGGAATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCT
TTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGGGAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCAT
TAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTCCTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCC
TGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTCTTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAG
TGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCTCCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTG
ACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTATATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTAT
ATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAAATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCAC
TTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCACTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCC
GTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCATTGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCT
CAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCCTCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCC
TGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGAAATAAAATCATCAAACCCAAAAATGATTTTTGGATACCAGAA
ACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAA
AAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCT
AATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTC
TTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTG
AAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATT
CTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGT
AAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTAC
TTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAG
ATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCT
CCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCAT
CAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGAT
CTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGA
AATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGAT
GTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACA
GAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCA
CATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCAC
AGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAA
ACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCA

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368507_chr6_117645578_-_5889nt
GGCGGCGCCCGGCCTTGCTCAACGCCCAGCAGTCCCCACCGTCGCTGCCGCCGCCACCGCCCTCGGCCGCTGCCGAGGCCTCCTGCAGCC
ATCATGTCCGCCAGCGCCGTCTACGTGCTGGACCTGAAGGGCAAGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCC
GATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCT
GTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACT
CTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTT
CTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTC
AGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGGGTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACG
TCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCTGCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATC
ACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTCAGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAAC
TGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTACCTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTC
AAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCCTTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGC
CAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAGATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTC
ACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACGGATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAG
GAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCGGATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTG
GTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTGCTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAAC
ACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATCCTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCT
GTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACCATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGC
ACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCATTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTC
AACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTGCCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAG
TATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATCCCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTG
CTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTGTGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCG
AAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTGAAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTC
CAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGCTTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGC
TGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAGGCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCT
CAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTGTAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTT
GAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACCTCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAG
TCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCACTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCA
GGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCGGGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAG
AACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGGGAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACT
CTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTCTGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGA
TCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACCACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATT
CCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTTCACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCC
ACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTCTTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAA
GAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGATTCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGT
GGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCCTGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTC
GTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGGAATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAA
GATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGGAATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCT
TTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGGGAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCAT
TAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTCCTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCC
TGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTCTTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAG
TGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCTCCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTG
ACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTATATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTAT
ATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAAATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCAC
TTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCACTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCC
GTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCATTGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCT
CAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCCTCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCC
TGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGAAATAAAATCATCAAACCCAAAAATGATTTTTGGATACCAGAA
ACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAA
AAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCT
AATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTC
TTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTG
AAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATT
CTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGT
AAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTAC
TTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAG
ATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCT
CCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCAT
CAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGAT
CTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGA
AATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGAT
GTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACA
GAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCA
CATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCAC
AGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAA
ACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCA

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368508_chr6_117650609_-_6150nt
ACCCAGGCTGCAGAGGTGCCATGGCTGAGTCACACCTGCTGCAGTGGCTGCTGCTGCTGCTGCCCACGCTCTGTGGCCCAGGCACTGACC
ATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGAT
AAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATA
GATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAG
ATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGC
GCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTCAGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGG
GTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACGTCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCT
GCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATCACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTC
AGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAACTGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTAC
CTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTCAAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCC
TTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGCCAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAG
ATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTCACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACG
GATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAGGAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCG
GATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTGGTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTG
CTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAACACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATC
CTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCTGTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACC
ATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGCACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCA
TTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTCAACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTG
CCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAGTATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATC
CCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTGCTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTG
TGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCGAAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTG
AAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTCCAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGC
TTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGCTGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAG
GCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCTCAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTG
TAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTTGAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACC
TCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAGTCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCA
CTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCAGGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCG
GGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAGAACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGG
GAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACTCTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTC
TGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGATCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACC
ACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATTCCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTT
CACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCCACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTC
TTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAAGAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGAT
TCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGTGGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCC
TGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTCGTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGG
AATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAAGATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGG
AATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCTTTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGG
GAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCATTAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTC
CTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCCTGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTC
TTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAGTGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCT
CCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTGACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTA
TATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTATATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAA
ATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCACTTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCA
CTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCCGTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCAT
TGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCTCAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCC
TCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCCTGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGA
AATAAAATCATCAAACCCAAAACTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAG
AAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGG
TGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCT
GCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTC
ATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCC
AAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGC
TATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGA
AGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTG
AAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAG
CTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGG
ATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGG
ATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGAC
TTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGT
TTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTAT
CCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAAT
TTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTC
TTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGT
TTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGC
CAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGAC
AAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATAT
GGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTA
GAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTC

>In-frame_SLC34A2_ENST00000382051_chr4_25678324_+_ROS1_ENST00000368507_chr6_117650609_-_6150nt
ACCCAGGCTGCAGAGGTGCCATGGCTGAGTCACACCTGCTGCAGTGGCTGCTGCTGCTGCTGCCCACGCTCTGTGGCCCAGGCACTGACC
ATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGAT
AAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATA
GATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAG
ATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGC
GCCTTCCAGCTGGTTGGAGGAAAAATGGCAGGACAGTTCTTCAGCAACAGCTCTATTATGTCCAACCCTTTGTTGGGGCTGGTGATCGGG
GTGCTGGTGACCGTCTTGGTGCAGAGCTCCAGCACCTCAACGTCCATCGTTGTCAGCATGGTGTCCTCTTCATTGCTCACTGTTCGGGCT
GCCATCCCCATTATCATGGGGGCCAACATTGGAACGTCAATCACCAACACTATTGTTGCGCTCATGCAGGTGGGAGATCGGAGTGAGTTC
AGAAGAGCTTTTGCAGGAGCCACTGTCCATGACTTCTTCAACTGGCTGTCCGTGTTGGTGCTCTTGCCCGTGGAGGTGGCCACCCATTAC
CTCGAGATCATAACCCAGCTTATAGTGGAGAGCTTCCACTTCAAGAATGGAGAAGATGCCCCAGATCTTCTGAAAGTCATCACTAAGCCC
TTCACAAAGCTCATTGTCCAGCTGGATAAAAAAGTTATCAGCCAAATTGCAATGAACGATGAAAAAGCGAAAAACAAGAGTCTTGTCAAG
ATTTGGTGCAAAACTTTTACCAACAAGACCCAGATTAACGTCACTGTTCCCTCGACTGCTAACTGCACCTCCCCTTCCCTCTGTTGGACG
GATGGCATCCAAAACTGGACCATGAAGAATGTGACCTACAAGGAGAACATCGCCAAATGCCAGCATATCTTTGTGAATTTCCACCTCCCG
GATCTTGCTGTGGGCACCATCTTGCTCATACTCTCCCTGCTGGTCCTCTGTGGTTGCCTGATCATGATTGTCAAGATCCTGGGCTCTGTG
CTCAAGGGGCAGGTCGCCACTGTCATCAAGAAGACCATCAACACTGATTTCCCCTTTCCCTTTGCATGGTTGACTGGCTACCTGGCCATC
CTCGTCGGGGCAGGCATGACCTTCATCGTACAGAGCAGCTCTGTGTTCACGTCGGCCTTGACCCCCCTGATTGGAATCGGCGTGATAACC
ATTGAGAGGGCTTATCCACTCACGCTGGGCTCCAACATCGGCACCACCACCACCGCCATCCTGGCCGCCTTAGCCAGCCCTGGCAATGCA
TTGAGGAGTTCACTCCAGATCGCCCTGTGCCACTTTTTCTTCAACATCTCCGGCATCTTGCTGTGGTACCCGATCCCGTTCACTCGCCTG
CCCATCCGCATGGCCAAGGGGCTGGGCAACATCTCTGCCAAGTATCGCTGGTTCGCCGTCTTCTACCTGATCATCTTCTTCTTCCTGATC
CCGCTGACGGTGTTTGGCCTCTCGCTGGCCGGCTGGCGGGTGCTGGTTGGTGTCGGGGTTCCCGTCGTCTTCATCATCATCCTGGTACTG
TGCCTCCGACTCCTGCAGTCTCGCTGCCCACGCGTCCTGCCGAAGAAACTCCAGAACTGGAACTTCCTGCCGCTGTGGATGCGCTCGCTG
AAGCCCTGGGATGCCGTCGTCTCCAAGTTCACCGGCTGCTTCCAGATGCGCTGCTGCTGCTGCTGCCGCGTGTGCTGCCGCGCGTGCTGC
TTGCTGTGTGACTGCCCCAAGTGCTGCCGCTGCAGCAAGTGCTGCGAGGACTTGGAGGAGGCGCAGGAGGGGCAGGATGTCCCTGTCAAG
GCTCCTGAGACCTTTGATAACATAACCATTAGCAGAGAGGCTCAGGGTGAGGTCCCTGCCTCGGACTCAAAGACCGAATGCACGGCCTTG
TAGGGGACGCCCCAGATTGTCAGGGATGGGGGGATGGTCCTTGAGTTTTGCATGCTCTCCTCCCTCCCACTTCTGCACCCTTTCACCACC
TCGAGGAGATTTGCTCCCCATTAGCGAATGAAATTGATGCAGTCCTACCTAACTCGATTCCCTTTGGCTTGGTGGTAGGCCTGCAGGGCA
CTTTTATTCCAACCCCTGGTCACTCAGTAATCTTTTACTCCAGGAAGGCACAGGATGGTACCTAAAGAGAATTAGAGAATGAACCTGGCG
GGACGGATGTCTAATCCTGCGCCTAGCTGGGTTGGTCAGTAGAACCTATTTTCAGACTCAAAAACCATCTTCAGAAAGAAAAGGCCCAGG
GAAGGAATGTATGAGAGGCTCTCCCAGATGAGGAAGTGTACTCTCTATGACTATCAAGCTCAGGCCTCTCCCTTTTTTTAAACCAAAGTC
TGGCAACCAAGAGCAGCAGCTCCATGGCCTCCTTGCCCCAGATCAGCCTGGGTCAGGGGACATAGTGTCATTGTTTGGAAACTGCAGACC
ACAAGGTGTGGGTCTATCCCACTTCCTAGTGCTCCCCACATTCCCCATCAGGGCTTCCTCACGTGGACAGGTGTGCTAGTCCAGGCAGTT
CACTTGCAGTTTCCTTGTCCTCATGCTTCGGGGATGGGAGCCACGCCTGAACTAGAGTTCAGGCTGGATACATGTGCTCACCTGCTGCTC
TTGTCTTCCTAAGAGACAGAGAGTGGGGCAGATGGAGGAGAAGAAAGTGAGGAATGAGTAGCATAGCATTCTGCCAAAAGGGCCCCAGAT
TCTTAATTTAGCAAACTAAGAAGCCCAATTCAAAAGCATTGTGGCTAAAGTCTAACGCTCCTCTCTTGGTCAGATAACAAAAGCCCTCCC
TGTTGGATCTTTTGAAATAAAACGTGCAAGTTATCCAGGCTCGTAGCCTGCATGCTGCCACCTTGAATCCCAGGGAGTATCTGCACCTGG
AATAGCTCTCCACCCCTCTCTGCCTCCTTACTTTCTGTGCAAGATGACTTCCTGGGTTAACTTCCTTCTTTCCATCCACCCACCCACTGG
AATCTCTTTCCAAACATTTTTCCATTTTCCCACAGATGGGCTTTGATTAGCTGTCCTCTCTCCATGCCTGCAAAGCTCCAGATTTTTGGG
GAAAGCTGTACCCAACTGGACTGCCCAGTGAACTGGGATCATTAAGTACAGTCGAGCACACGTGTGTGCATGGGTCAAAGGGGTGTGTTC
CTTCTCATCCTAGATGCCTTCTCTGTGCCTTCCACAGCCTCCTGCCTGATTACACCACTGCCCCCGCCCCACCCTCAGCCATCCCAATTC
TTCCTGGCCAGTGCGCTCCAGCCTTATCTAGGAAAGGAGGAGTGGGTGTAGCCGTGCAGCAAGATTGGGGCCTCCCCCATCCCAGCTTCT
CCACCATCCCAGCAAGTCAGGATATCAGACAGTCCTCCCCTGACCCTCCCCCTTGTAGATATCAATTCCCAAACAGAGCCAAATACTCTA
TATCTATAGTCACAGCCCTGTACAGCATTTTTCATAAGTTATATAGTAAATGGTCTGCATGATTTGTGCTTCTAGTGCTCTCATTTGGAA
ATGAGGCAGGCTTCTTCTATGAAATGTAAAGAAAGAAACCACTTTGTATATTTTGTAATACCACCTCTGTGGCCATGCCTGCCCCGCCCA
CTCTGTATATATGTAAGTTAAACCCGGGCAGGGGCTGTGGCCGTCTTTGTACTCTGGTGATTTTTAAAAATTGAATCTTTGTACTTGCAT
TGATTGTATAATAATTTTGAGACCAGGTCTCGCTGTGTTGCTCAGGCTGGTCTCAAACTCCTGAGATCAAGCAATCCGCCCACCTCAGCC
TCCCAAAGTGCTGAGATCACAGGCGTGAGCCACCACCAGGCCTGATTGTAATTTTTTTTTTTTTTTTTTTACTGGTTATGGGAAGGGAGA
AATAAAATCATCAAACCCAAAACTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAG
AAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGG
TGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCT
GCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTC
ATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCC
AAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGC
TATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGA
AGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTG
AAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAG
CTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGG
ATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGG
ATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGAC
TTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGT
TTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTAT
CCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAAT
TTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTC
TTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGT
TTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGC
CAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGAC
AAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATAT
GGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTA
GAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTC

>In-frame_SLC34A2_ENST00000504570_chr4_25665952_+_ROS1_ENST00000368508_chr6_117650611_-_2436nt
ATATATACCCGGGGCGCTGCGCTCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAA
TTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAAC
AAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGAT
GACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGG
ATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGCT
GGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAGAAAGCTGAAGATAATGGATGTAGA
ATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGGTGGAAGATGACATTTAATGGATCC
TGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCTGCAAATAATCTAGGGTTTGGTGAA
TATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATA
TTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATA
AACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACC
CAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTAT
GAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAG
AAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAA
CCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTA
CTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTG
GCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTAT
AAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACT
CAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTG
TTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAA
GAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGA
GATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCA
GTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGT
CCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAA
GTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGT
TGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCT
ATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAGTTGTAGCAATCCCCATACCAGC

>In-frame_SLC34A2_ENST00000504570_chr4_25665952_+_ROS1_ENST00000368507_chr6_117650611_-_2436nt
ATATATACCCGGGGCGCTGCGCTCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAA
TTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAAC
AAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGAT
GACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGG
ATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGCT
GGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAGAAAGCTGAAGATAATGGATGTAGA
ATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGGTGGAAGATGACATTTAATGGATCC
TGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCTGCAAATAATCTAGGGTTTGGTGAA
TATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATA
TTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATA
AACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACC
CAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTAT
GAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAG
AAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAA
CCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTA
CTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTG
GCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTAT
AAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACT
CAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTG
TTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAA
GAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGA
GATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCA
GTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGT
CCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAA
GTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGT
TGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCT
ATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAGTTGTAGCAATCCCCATACCAGC

>In-frame_SLC34A2_ENST00000382051_chr4_25665952_+_ROS1_ENST00000368508_chr6_117650611_-_2417nt
TCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACC
CCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCAC
CTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCA
CTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTAC
TTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGCTGGAGTCCCAAATAAACCAG
GCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAGAAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTG
AGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGGTGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACAT
GGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCTGCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGA
ATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCC
CACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGG
CTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATC
TTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACA
TCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGG
AGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGG
AACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTG
TAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTG
TTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAA
AGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTT
TTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAG
GAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTA
CTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTG
GAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGA
AGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAAT
CTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTG
GCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGT
TGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAAT

>In-frame_SLC34A2_ENST00000382051_chr4_25665952_+_ROS1_ENST00000368507_chr6_117650611_-_2417nt
TCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACC
CCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCAC
CTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCA
CTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTAC
TTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGCTGGAGTCCCAAATAAACCAG
GCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATACAGTGGGAGAAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTG
AGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGGTGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACAT
GGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAGTAGTAGCTGCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGA
ATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCC
CACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGG
CTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATC
TTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACA
TCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGG
AGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGG
AACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTG
TAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTG
TTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAA
AGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTT
TTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAG
GAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTA
CTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTG
GAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGA
AGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAAT
CTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTG
GCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGT
TGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAAT

>In-frame_SLC34A2_ENST00000503434_chr4_25665952_+_ROS1_ENST00000368508_chr6_117650611_-_2468nt
AGTTTGTTTCTATTAGGGCCCGTGGCCATCAGCGAAGGGTCCGTCCTTCAGCCGTCTTGGGGAGCAAAGCCCGCAATTTATGTTTTCCAA
GCCACAAATGGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGC
CCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGG
CTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACA
CCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATA
TTCTTAGTAGCGCCTTCCAGCTGGTTGGAGCTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATAC
AGTGGGAGAAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGA
ATTTAAGGTGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAG
TAGTAGCTGCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAA
CAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAA
AAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTA
ATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCT
TGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGA
AGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTC
TGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTA
AAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACT
TGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGA
TTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTC
CAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATC
AGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATC
TGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAA
ATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATG
TGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAG
AATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCAC
ATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACA
GTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAA
CTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCAT

>In-frame_SLC34A2_ENST00000503434_chr4_25665952_+_ROS1_ENST00000368507_chr6_117650611_-_2468nt
AGTTTGTTTCTATTAGGGCCCGTGGCCATCAGCGAAGGGTCCGTCCTTCAGCCGTCTTGGGGAGCAAAGCCCGCAATTTATGTTTTCCAA
GCCACAAATGGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGC
CCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGG
CTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACA
CCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATA
TTCTTAGTAGCGCCTTCCAGCTGGTTGGAGCTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGAAGGGAGTAAAAATTCAATAC
AGTGGGAGAAAGCTGAAGATAATGGATGTAGAATTACATACTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGA
ATTTAAGGTGGAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAAAGGAATATTTCAGTTCAGAG
TAGTAGCTGCAAATAATCTAGGGTTTGGTGAATATAGTGGAATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAA
CAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAA
AAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTA
ATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCT
TGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGA
AGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTC
TGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTA
AAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACT
TGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGA
TTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTC
CAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATC
AGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATC
TGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAA
ATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATG
TGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAG
AATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCAC
ATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACA
GTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAA
CTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCAT

>In-frame_SLC34A2_ENST00000504570_chr4_25665952_+_ROS1_ENST00000368508_chr6_117645580_-_2127nt
ATATATACCCGGGGCGCTGCGCTCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAA
TTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAAC
AAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGAT
GACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGG
ATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGAT
GATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCAT
AGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCA
GCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAA
AAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGA
GAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAA
TTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGAC
CTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATT
TCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACC
AGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTC
CCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAG
ATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCA
AGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGAC
CAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTT
GAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAAC
TATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGG
AAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAAC
TATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTC
AGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAA

>In-frame_SLC34A2_ENST00000504570_chr4_25665952_+_ROS1_ENST00000368507_chr6_117645580_-_2127nt
ATATATACCCGGGGCGCTGCGCTCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAA
TTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAAC
AAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGAT
GACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGG
ATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGAT
GATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCAT
AGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCA
GCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAA
AAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGA
GAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAA
TTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGAC
CTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATT
TCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACC
AGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTC
CCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAG
ATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCA
AGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGAC
CAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTT
GAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAAC
TATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGG
AAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAAC
TATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTC
AGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAA

>In-frame_SLC34A2_ENST00000382051_chr4_25665952_+_ROS1_ENST00000368508_chr6_117645580_-_2108nt
TCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACC
CCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCAC
CTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCA
CTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTAC
TTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGATGATTTTTGGATACCAGAAA
CAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAA
AAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTA
ATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCT
TGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGA
AGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTC
TGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTA
AAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACT
TGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGA
TTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTC
CAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATC
AGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATC
TGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAA
ATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATG
TGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAG
AATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCAC
ATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACA
GTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAA
CTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCAT

>In-frame_SLC34A2_ENST00000382051_chr4_25665952_+_ROS1_ENST00000368507_chr6_117645580_-_2108nt
TCCACCTGGCCGCCGCCTCCAGCCCAGCACCTGCGGAGGGAGCGCTGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACC
CCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGCCCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAACAGATAACACTGAGGCAC
CTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGGCTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCA
CTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACACCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTAC
TTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATATTCTTAGTAGCGCCTTCCAGCTGGTTGGAGATGATTTTTGGATACCAGAAA
CAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAA
AAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTA
ATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCT
TGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGA
AGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTC
TGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTA
AAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACT
TGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGA
TTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTC
CAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATC
AGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATC
TGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAA
ATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATG
TGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAG
AATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCAC
ATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACA
GTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAA
CTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCAT

>In-frame_SLC34A2_ENST00000503434_chr4_25665952_+_ROS1_ENST00000368508_chr6_117645580_-_2159nt
AGTTTGTTTCTATTAGGGCCCGTGGCCATCAGCGAAGGGTCCGTCCTTCAGCCGTCTTGGGGAGCAAAGCCCGCAATTTATGTTTTCCAA
GCCACAAATGGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGC
CCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGG
CTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACA
CCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATA
TTCTTAGTAGCGCCTTCCAGCTGGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGG
TTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAG
ACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGG
AGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAA
CAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTG
AATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAAT
ACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCT
TGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTA
GAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATG
ATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTG
ATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACT
ATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCG
ACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAG
CAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTT
TAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAG
GCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTT
ACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGG
GAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTC

>In-frame_SLC34A2_ENST00000503434_chr4_25665952_+_ROS1_ENST00000368507_chr6_117645580_-_2159nt
AGTTTGTTTCTATTAGGGCCCGTGGCCATCAGCGAAGGGTCCGTCCTTCAGCCGTCTTGGGGAGCAAAGCCCGCAATTTATGTTTTCCAA
GCCACAAATGGACCATGGCTCCCTGGCCTGAATTGGGAGATGCCCAGCCCAACCCCGATAAGTACCTCGAAGGGGCCGCAGGTCAGCAGC
CCACTGCCCCTGATAAAAGCAAAGAGACCAACAAAAATAACACTGAGGCACCTGTAACCAAGATTGAACTTCTGCCGTCCTACTCCACGG
CTACACTGATAGATGAGCCCACTGAGGTGGATGACCCCTGGAACCTACCCACTCTTCAGGACTCGGGGATCAAGTGGTCAGAGAGAGACA
CCAAAGGGAAGATTCTCTGTTTCTTCCAAGGGATTGGGAGATTGATTTTACTTCTCGGATTTCTCTACTTTTTCGTGTGCTCCCTGGATA
TTCTTAGTAGCGCCTTCCAGCTGGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGG
TTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAG
ACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGG
AGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAA
CAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTG
AATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAAT
ACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCT
TGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTA
GAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATG
ATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTG
ATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACT
ATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCG
ACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAG
CAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTT
TAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAG
GCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTT
ACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGG
GAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTC


Top

FusionGenePPI for SLC34A2_ROS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SLC34A2NUDCD1, PCDH10, KRIT1, ENDOD1, ZDHHC18, LMTK2, LINGO2, ATP6V0A1, KIAA1715, ATP11C, ATP6V0A2, SYNGR2, CACNA2D1, SLC30A7ROS1PTPN6, PTPN11, VAV3, IKBKG, GRB2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SLC34A2_ROS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SLC34A2_ROS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSLC34A2C0007131Non-Small Cell Lung Carcinoma2CTD_human
HgeneSLC34A2C0041755Adverse reaction to drug1CTD_human
HgeneSLC34A2C0155912Pulmonary Alveolar Microlithiasis1CTD_human;ORPHANET;UNIPROT
TgeneROS1C0007131Non-Small Cell Lung Carcinoma4CTD_human
TgeneROS1C0017638Glioma1CTD_human
TgeneROS1C0025202melanoma1CTD_human
TgeneROS1C0152013Adenocarcinoma of lung (disorder)1CTD_human