FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33962

FusionGeneSummary for SKIL_TNIK

check button Fusion gene summary
Fusion gene informationFusion gene name: SKIL_TNIK
Fusion gene ID: 33962
HgeneTgene
Gene symbol

SKIL

TNIK

Gene ID

6498

23043

Gene nameSKI like proto-oncogeneTRAF2 and NCK interacting kinase
SynonymsSNO|SnoA|SnoI|SnoNMRT54
Cytomap

3q26.2

3q26.2-q26.31

Type of geneprotein-codingprotein-coding
Descriptionski-like proteinSKI-like oncogeneski-related oncogene snoNTRAF2 and NCK-interacting protein kinase
Modification date2018052320180523
UniProtAcc

P12757

Q9UKE5

Ensembl transtripts involved in fusion geneENST00000259119, ENST00000426052, 
ENST00000490989, ENST00000413427, 
ENST00000458537, 
ENST00000436636, 
ENST00000538048, ENST00000369326, 
ENST00000341852, ENST00000284483, 
ENST00000470834, ENST00000460047, 
ENST00000475336, ENST00000488470, 
ENST00000357327, ENST00000464785, 
ENST00000465393, 
Fusion gene scores* DoF score3 X 1 X 3=95 X 5 X 3=75
# samples 35
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SKIL [Title/Abstract] AND TNIK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTNIK

GO:0006468

protein phosphorylation

10521462|15342639|22797597

TgeneTNIK

GO:0007256

activation of JNKK activity

15342639

TgeneTNIK

GO:0031532

actin cytoskeleton reorganization

15342639

TgeneTNIK

GO:0035556

intracellular signal transduction

10521462

TgeneTNIK

GO:0046777

protein autophosphorylation

10521462|15342639

TgeneTNIK

GO:0048814

regulation of dendrite morphogenesis

20159449


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-VQ-AA6B-01ASKILchr3

170079217

+TNIKchr3

171087474

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000259119ENST00000436636SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000538048SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000369326SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000341852SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000284483SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000470834SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000460047SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000475336SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000488470SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000259119ENST00000357327SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000259119ENST00000464785SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000259119ENST00000465393SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000436636SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000538048SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000369326SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000341852SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000284483SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000470834SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000460047SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000475336SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000488470SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000426052ENST00000357327SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000426052ENST00000464785SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000426052ENST00000465393SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000436636SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000538048SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000369326SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000341852SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000284483SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000470834SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000460047SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000475336SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000488470SKILchr3

170079217

+TNIKchr3

171087474

-
intron-3CDSENST00000490989ENST00000357327SKILchr3

170079217

+TNIKchr3

171087474

-
intron-intronENST00000490989ENST00000464785SKILchr3

170079217

+TNIKchr3

171087474

-
intron-intronENST00000490989ENST00000465393SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000436636SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000538048SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000369326SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000341852SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000284483SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000470834SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000460047SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000475336SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000488470SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000413427ENST00000357327SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000413427ENST00000464785SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000413427ENST00000465393SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000436636SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000538048SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000369326SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000341852SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000284483SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000470834SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000460047SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000475336SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000488470SKILchr3

170079217

+TNIKchr3

171087474

-
In-frameENST00000458537ENST00000357327SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000458537ENST00000464785SKILchr3

170079217

+TNIKchr3

171087474

-
5CDS-intronENST00000458537ENST00000465393SKILchr3

170079217

+TNIKchr3

171087474

-

Top

FusionProtFeatures for SKIL_TNIK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SKIL

P12757

TNIK

Q9UKE5

May have regulatory role in cell division ordifferentiation in response to extracellular signals.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTNIKchr3:170079217chr3:171087474ENST00000284483-0321047_1334191353DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000284483-03225_289191353DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000341852-0311047_1334191277DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000341852-03125_289191277DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000357327-0321047_1334191332DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000357327-03225_289191332DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000436636-0331047_1334191361DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000436636-03325_289191361DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000460047-0311047_1334191298DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000460047-03125_289191298DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000470834-0311047_1334191324DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000470834-03125_289191324DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000475336-0301047_1334191269DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000475336-03025_289191269DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000488470-0321047_1334191306DomainCNH
TgeneTNIKchr3:170079217chr3:171087474ENST00000488470-03225_289191306DomainProtein kinase
TgeneTNIKchr3:170079217chr3:171087474ENST00000284483-03231_39191353Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000341852-03131_39191277Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000357327-03231_39191332Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000436636-03331_39191361Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000460047-03131_39191298Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000470834-03131_39191324Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000475336-03031_39191269Nucleotide bindingATP
TgeneTNIKchr3:170079217chr3:171087474ENST00000488470-03231_39191306Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSKILchr3:170079217chr3:171087474ENST00000259119+27536_684366685Coiled coilOntology_term=ECO:0000255
HgeneSKILchr3:170079217chr3:171087474ENST00000413427+16536_684366639Coiled coilOntology_term=ECO:0000255
HgeneSKILchr3:170079217chr3:171087474ENST00000426052+38536_684346665Coiled coilOntology_term=ECO:0000255
HgeneSKILchr3:170079217chr3:171087474ENST00000458537+16536_684366685Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for SKIL_TNIK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_1708aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPH
KVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPT
SENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSS
STPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPM
KKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKK
RSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFT
SELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDV
LEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFK
SFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITK

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_1660aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGS
NEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGT
EYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEIL
CAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDL
EGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIP
SHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_1686aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEED
GESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ
SHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNV
NPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYL
SWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRL
KVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIM

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_1624aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPR
QNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSS
GSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIE
ETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRE
TSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESS
AAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRR
FQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYH
KFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNT
YGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNSM

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_1700aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPH
KVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPT
SENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSS
STPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSS
SSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSN
GFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQ
AKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLV
TISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHK
PLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGE

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_1671aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDI
PRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRV
STHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIR
KYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVE
KKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDV
DSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETG

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_1645aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLE
TSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPF
VDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTEN
GLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIK
FLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVIL
PKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFF

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_1616aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPR
QNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSS
GSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKK
VTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRS
GHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSE
LLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLE
GLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSF
ADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDV

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_1653aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVG
MVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSS
TKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGV
NLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYK
VVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNI
TPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLC

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_1679aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHD
GTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGT
PTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRP
HSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRI
LHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSH
TGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAI

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_1688aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQ
RQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSI
SGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLR
QEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAG
SSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEE
EDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLV
QQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVV
NVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVY
YLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQ
RLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQ

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_1640aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQ
RQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNV
TSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPIL
ESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPAVSAFLSKSFELLIY
QDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHAD
SFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRV
YQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLL
DRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIA
LKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDG
MEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRS

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_1666aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRP
VEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQG
PALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNG
SALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPE
ESRDITRPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIP
TGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQ
EMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKR
FNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGW
ITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNS
YDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGV

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_1604aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRP
VEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFD
RSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQ
PGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESE
SSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHI
NLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEA
RKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKK
NKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDL
TVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVA

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_1680aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQ
RQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSI
SGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLR
QEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAG
SSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETH
DGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAG
TPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIR
PHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNR
ILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGS
HTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKA

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_1651aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRP
VEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQG
PALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNG
SALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPE
ESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMV
GTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTK
ASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNL
LVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVV
KYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITP
HAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCER

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_1625aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQ
RQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNV
TSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPIL
ESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRI
EETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIR
ETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEES
SAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRR
RFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPY
HKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVN
TYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNS

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_1596aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRP
VEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFD
RSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQ
PGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEED
GESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ
SHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNV
NPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYL
SWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRL
KVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIM

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_1633aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQQLLHEQALLLEYKRKQLEEQ
RQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNV
TSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPIL
ESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALA
KELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSIS
REGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTD
EDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGK
VYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEI
YAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCY
EDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVF

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_1659aa
MGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSAR
HSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSD
QLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQ
CLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKDPAGIFELVELVGN
GTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGN
TLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFK
SDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLK
DHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQK
RIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRP
VEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQG
PALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNG
SALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPE
ESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSN
EQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTE
YGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILC
AALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLE
GCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPS
HIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQ

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_1708aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPH
KVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPT
SENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSS
STPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPM
KKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKK
RSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFT
SELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDV
LEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFK
SFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITK

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_1660aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGS
NEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGT
EYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEIL
CAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDL
EGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIP
SHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRA

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_1686aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEED
GESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ
SHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNV
NPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYL
SWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRL
KVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIM

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_1624aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPR
QNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSS
GSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIE
ETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRE
TSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESS
AAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRR
FQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYH
KFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNT
YGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNSM

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_1700aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPH
KVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPT
SENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSS
STPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSS
SSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSN
GFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQ
AKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLV
TISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHK
PLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGE

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_1671aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDI
PRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRV
STHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIR
KYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVE
KKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDV
DSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_1645aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLE
TSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPF
VDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTEN
GLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIK
FLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVIL
PKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFF

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_1616aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPR
QNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSS
GSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKK
VTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRS
GHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSE
LLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLE
GLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSF
ADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDV

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_1653aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVG
MVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSS
TKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGV
NLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYK
VVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNI
TPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLC

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_1679aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHD
GTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGT
PTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRP
HSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRI
LHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSH
TGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAI

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_1708aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPH
KVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPT
SENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSS
STPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPM
KKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKK
RSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFT
SELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDV
LEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFK
SFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITK

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_1660aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGS
NEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGT
EYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEIL
CAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDL
EGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIP
SHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRA

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_1686aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKIVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPAVSAFLSKSFELLIYQDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEED
GESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ
SHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNV
NPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYL
SWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRL
KVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIM

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_1624aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPR
QNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSS
GSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIE
ETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRE
TSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESS
AAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRR
FQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYH
KFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNT
YGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTLNRNSM

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_1700aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPH
KVANRISDPNLPPRSESFSISGVQPARTPPMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPT
SENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSS
STPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSS
SSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSN
GFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQ
AKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLV
TISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHK
PLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGE

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_1671aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDI
PRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRV
STHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIR
KYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVE
KKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDV
DSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_1645aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPADLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLE
TSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPF
VDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTEN
GLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIK
FLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVIL
PKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFF

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_1616aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPR
QNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSS
GSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDITRPSRPADLTALAKELRELRIEETNRPMKK
VTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRS
GHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSE
LLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLE
GLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSF
ADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDV

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_1653aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYIRRQLEEEQRQLEILQQ
QLLHEQALLLEYKRKQLEEQRQAERLQRQLKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEIPHLVAVKSQGPALTAS
QSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPR
LGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRANSKSEGSPVLPHEPAKVKPEESRDIT
RPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVG
MVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGTPTEGLGRVSTHSQEMDSGTEYGMGSS
TKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRPHSDTPEIRKYKKRFNSEILCAALWGV
NLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGDLEGCIHYK
VVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNI
TPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLC

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_1679aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTL
AQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLG
KCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWL
VMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPY
WMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQL
MKHPFIRDQPNERQVRIQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEENDSGEPSSILNLPGESTLRRDFLRLQLANKERSEALRRQQL
EQQQRENEEHKRQLLAERQKRIEEQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRAEHEQEYKRKQLEEQRQAERLQRQ
LKQERDYLVSLQHQRQEQRPVEKKPLYHYKEGMSPSEKPAWAKEVEERSRLNRQSSPAMPHKVANRISDPNLPPRSESFSISGVQPARTP
PMLRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKV
PQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSSTPSSQPSSQGGSQPGSQAGSSERTRVRA
NSKSEGSPVLPHEPAKVKPEESRDITRPSRPASYKKAIDEDLTALAKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHD
GTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQSHSPAGT
PTEGLGRVSTHSQEMDSGTEYGMGSSTKASFTPFVDPRVYQTSPTDEDEEDEESSAAALFTSELLRQEQAKLNEARKISVVNVNPTNIRP
HSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRI
LHNDPEVEKKQGWITVGDLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSH
TGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_5124nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCAC
AAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCC
ATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAG
CAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACC
TCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCT
CAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCC
ATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCC
AGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAAC
AGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCA
GCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATG
AAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGG
ACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCAT
GGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAG
CGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCG
ACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTC
ACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACT
AGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCAT
AGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGG
ACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTG
CTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTA
CATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAA
AGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAG
TCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACT
GGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATT
GTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAG
GATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAG
ATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAG

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_4980nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTA
AGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAA
GAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGC
AACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGA
ACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGAC
CTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACT
GAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAA
GAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCG
GTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTT
TGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAAT
CTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGA
GTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTG
GAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGG
GCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAA
GGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCA
TCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAG
GGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCC
AATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCT
CAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACC

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_5058nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGG
ATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGAT
GGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTAC
AATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATT
AGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAG
AGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATG
GGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAA
TCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTA
AACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTG
TGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGG
AGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTT
TCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATA
CATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCG
TATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTA
AAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAG
GGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTA
AACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATG
GGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAG
TTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAAT

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_4872nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCC
TCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGC
CAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGAC
ATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCC
AGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGT
GGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGC
ACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATT
ACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAA
GAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAG
AGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTG
GGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAG
ACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCAT
TCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGC
AGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCA
GCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCA
ACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGT
GTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGA
TTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGG
TTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTAT
AAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCAT
AAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTT
ATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAAT
ATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACC
TATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGG
GGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTA
TGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATG

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5100nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCAC
AAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCC
ATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAG
CAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACC
TCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCT
CAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCC
ATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCC
AGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAAC
AGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCA
GCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCC
TCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCC
AGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGAC
AGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAAT
GGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCA
ACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTA
TACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAG
GCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAA
TACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTG
GACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTG
ACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAG
AAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCC
TTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAG
CCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGAT
TCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGA
ATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAA
ATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACAT
TTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCT

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5013nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCC
TCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATA
CCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCG
GACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGC
AATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTC
TCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGA
GTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAA
CAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGA
AAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTT
TTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTT
GTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAA
AAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATT
GCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCAC
AAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTT
GATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGAT
GGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGA
GAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGA
CATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_4935nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTG
ACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCT
GTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAG
ACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGC
CACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGA
CTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTT
GTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTT
CTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACA
CCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAAT
GGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGA
CTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGAC
CCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAA
TTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCA
GATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCAT
GTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTG
CCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTG
CTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCA
GTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTT

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_4848nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCC
TCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGC
CAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGAC
ATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCC
AGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGT
GGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGC
ACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATT
ACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAG
GTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTG
GCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTG
GAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCT
GGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAG
GGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCC
TTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAA
CTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGAC
ACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAA
AATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAG
GGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAAT
GACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATC
AAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTT
GCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTC
CATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATC
TTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTG
GTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGG
TCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTT

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_4959nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAA
ACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGC
GAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGA
ATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACG
TCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCT
CCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGC
ACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCC
GCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACC
AACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTA
AACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTT
CAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTA
AGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAA
GTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAA
TTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATT
TTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATC
ACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTAT
GGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGC
GAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGT
GAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATG

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5037nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCA
ATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGAT
GGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACG
CATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAG
AAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACC
CCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCC
TTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTT
ACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCT
CATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTG
GGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGAT
GTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATA
CTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATAT
GAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTT
AAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACAC
ACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCT
ATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACT
AAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATT
GAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGAT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_5064nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAG
GAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAG
AGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTG
GAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTC
AACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATT
AGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCT
GCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTG
GAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGA
CAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGT
GCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAG
AGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGA
TCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAA
TCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAA
CTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAG
GAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAG
CAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTG
ATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTG
CAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATAT
GGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGAT
GAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTA
AATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCA
GCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATC
AACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTAC
TATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGC
TGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCT
AAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAA
AGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCAT
ATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTG
TATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAG
ATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGG
TTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAAC

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_4920nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAG
GAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAG
AGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTG
GAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTA
AAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTG
ACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGA
AGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCT
CCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTG
GAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCT
GGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAG
GTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTAC
CAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCC
TCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCC
AGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGAC
AGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAAT
GGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCA
ACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTA
TACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAG
GCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAA
TACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTG
GACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTG
ACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAG
AAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCC
TTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAG
CCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGAT
TCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGA
ATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAA
ATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACAT
TTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_4998nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAA
CAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCT
GTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGG
CTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGC
ATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGA
CCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGC
GTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTA
CGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGT
AGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTG
CAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCA
GGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAA
GAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACG
GCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAG
TCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCA
ACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGC
AGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGC
CACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAG
GAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCT
CCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAAT
GAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGA
TTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGG
CAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGA
AAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGG
ATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCT
GTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTT
GATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCT
TATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTT
GTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCT
GTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTA
TTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGC

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_4812nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAA
CAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCT
GTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCT
GTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAAC
GTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGAC
CGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAAT
TCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATC
TTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAG
CCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCG
AAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTA
GCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAA
AGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGA
GCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATT
TCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATC
AACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATG
GACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACT
GATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCA
AGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAAC
TCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGC
AAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAG
AATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACT
GTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAA
ATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTC
ACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGAT
ATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGC
TATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCC
TACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATG
CATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTG

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5040nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAG
GAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAG
AGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTG
GAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTC
AACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATT
AGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCT
GCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTG
GAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGA
CAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGT
GCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAG
AGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGA
TCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAA
TCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGC
CCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCAT
GATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGG
ACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAG
AAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGA
ACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCC
TCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTG
TTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGG
CCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTG
GTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATG
GATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGA
ATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAA
TATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCA
TTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCA
CACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCAT
GCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATA
ACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCT
ATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAAT
GATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAA

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_4953nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAA
CAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCT
GTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGG
CTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGC
ATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGA
CCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGC
GTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTA
CGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGT
AGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTG
CAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCA
GGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAA
GAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAAC
CGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACC
CATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTG
GGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGA
GAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCT
GGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAA
GCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCT
CTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATT
CGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTT
CTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAG
ATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAAC
AGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTT
AAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATG
GCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGT
TCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCT
CATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGG
ATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAA
GCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGA
AATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGG

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_4875nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAG
GAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAG
AGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTG
GAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTA
AAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTG
ACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGA
AGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCT
CCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTG
GAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCT
GGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAG
GTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATT
GAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGA
GAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAAT
GTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGA
GAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGC
CATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGG
AGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCA
TCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAAC
CCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGG
GGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGG
CGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCA
TGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACAT
TATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTAT
CATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAG
GTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGC
AATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAAC
ACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGC
TGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTT
CTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCC

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_4788nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAA
CAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCT
GTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCT
GTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAAC
GTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGAC
CGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAAT
TCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATC
TTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAG
CCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCG
AAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGG
ATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGAT
GGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTAC
AATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATT
AGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAG
AGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATG
GGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAA
TCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTA
AACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTG
TGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGG
AGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTT
TCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATA
CATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCG
TATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTA
AAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAG
GGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTA
AACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATG
GGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAG
TTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAAT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_4899nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAG
GAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAG
AGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTG
GAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTA
AAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTG
ACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGA
AGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCT
CCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTG
GAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCT
GGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAG
GTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCC
AAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGT
AGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCT
CCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCA
AGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAAC
CTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGAC
TCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGAT
GAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGA
AAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCA
GAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAA
GTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAAT
AAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTT
GGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATA
TATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACG
GTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATC
TACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTAT
GAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTAC
ATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCAT
AAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_4977nt
ATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAG
AAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTG
CATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGG
CATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGC
TCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTC
TTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGAC
CAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGT
AATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGT
GCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAA
TGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTT
GAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAA
ATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAAT
GGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAG
GAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAAC
CCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAAC
ACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGAT
ATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGC
AGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAG
AGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTC
CTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAAT
CACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAG
GACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAAT
GACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAG
CGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAG
CGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAG
CGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAA
CAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCT
GTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGG
CTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGC
ATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGA
CCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGC
GTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTA
CGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGT
AGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTG
CAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCA
GGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAA
GAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGA
GAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAG
GAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAAC
GAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACC
TTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTG
GTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAA
TATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAG
GATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTG
GTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGT
GCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTG
ATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTT
TACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAA
GGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCT
CCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGT
CAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCT
CATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGG
GTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAAT
CAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAA
AGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTC

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_5124nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCAC
AAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCC
ATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAG
CAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACC
TCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCT
CAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCC
ATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCC
AGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAAC
AGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCA
GCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATG
AAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGG
ACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCAT
GGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAG
CGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCG
ACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTC
ACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACT
AGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCAT
AGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGG
ACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTG
CTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTA
CATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAA
AGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAG
TCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACT
GGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATT
GTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAG
GATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAG
ATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_4980nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTA
AGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAA
GAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGC
AACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGA
ACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGAC
CTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACT
GAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAA
GAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCG
GTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTT
TGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAAT
CTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGA
GTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTG
GAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGG
GCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAA
GGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCA
TCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAG
GGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCC
AATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCT
CAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACC

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_5058nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGG
ATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGAT
GGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTAC
AATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATT
AGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAG
AGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATG
GGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAA
TCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTA
AACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTG
TGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGG
AGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTT
TCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATA
CATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCG
TATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTA
AAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAG
GGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTA
AACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATG
GGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAG
TTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAAT

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_4872nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCC
TCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGC
CAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGAC
ATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCC
AGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGT
GGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGC
ACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATT
ACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAA
GAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAG
AGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTG
GGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAG
ACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCAT
TCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGC
AGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCA
GCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCA
ACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGT
GTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGA
TTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGG
TTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTAT
AAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCAT
AAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTT
ATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAAT
ATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACC
TATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGG
GGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTA
TGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5100nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCAC
AAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCC
ATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAG
CAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACC
TCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCT
CAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCC
ATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCC
AGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAAC
AGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCA
GCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCC
TCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCC
AGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGAC
AGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAAT
GGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCA
ACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTA
TACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAG
GCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAA
TACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTG
GACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTG
ACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAG
AAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCC
TTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAG
CCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGAT
TCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGA
ATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAA
ATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACAT
TTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCT

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5013nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCC
TCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATA
CCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCG
GACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGC
AATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTC
TCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGA
GTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAA
CAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGA
AAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTT
TTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTT
GTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAA
AAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATT
GCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCAC
AAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTT
GATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGAT
GGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGA
GAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGA
CATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGA

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_4935nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTG
ACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCT
GTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAG
ACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGC
CACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGA
CTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTT
GTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTT
CTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACA
CCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAAT
GGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGA
CTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGAC
CCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAA
TTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCA
GATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCAT
GTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTG
CCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTG
CTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCA
GTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTT

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_4848nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCC
TCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGC
CAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGAC
ATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCC
AGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGT
GGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGC
ACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATT
ACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAG
GTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTG
GCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTG
GAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCT
GGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAG
GGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCC
TTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAA
CTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGAC
ACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAA
AATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAG
GGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAAT
GACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATC
AAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTT
GCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTC
CATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATC
TTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTG
GTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGG
TCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTT

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_4959nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAA
ACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGC
GAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGA
ATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACG
TCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCT
CCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGC
ACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCC
GCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACC
AACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTA
AACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTT
CAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTA
AGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAA
GTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAA
TTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATT
TTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATC
ACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTAT
GGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGC
GAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGT
GAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5037nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCA
ATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGAT
GGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACG
CATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAG
AAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACC
CCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCC
TTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTT
ACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCT
CATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTG
GGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGAT
GTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATA
CTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATAT
GAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTT
AAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACAC
ACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCT
ATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACT
AAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATT
GAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGAT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_5124nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCAC
AAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCC
ATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAG
CAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACC
TCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCT
CAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCC
ATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCC
AGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAAC
AGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCA
GCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATG
AAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGG
ACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCAT
GGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAG
CGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCG
ACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTC
ACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACT
AGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCAT
AGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGG
ACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTG
CTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTA
CATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAA
AGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAG
TCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACT
GGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATT
GTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAG
GATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAG
ATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_4980nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTA
AGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAA
GAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGC
AACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGA
ACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGAC
CTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACT
GAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAA
GAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCG
GTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTT
TGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAAT
CTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGA
GTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTG
GAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGG
GCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAA
GGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCA
TCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAG
GGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCC
AATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCT
CAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACC

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_5058nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGG
ATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGAT
GGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTAC
AATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATT
AGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAG
AGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATG
GGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAA
TCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTA
AACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTG
TGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGG
AGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTT
TCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATA
CATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCG
TATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTA
AAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAG
GGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTA
AACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATG
GGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAG
TTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAAT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_4872nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCC
TCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGC
CAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGAC
ATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCC
AGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGT
GGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGC
ACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATT
ACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAA
GAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAG
AGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTG
GGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAG
ACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCAT
TCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGC
AGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCA
GCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCA
ACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGT
GTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGA
TTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGG
TTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTAT
AAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCAT
AAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTT
ATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAAT
ATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACC
TATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGG
GGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTA
TGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5100nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCAC
AAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCC
ATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAG
CAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACC
TCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCT
CAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCC
ATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCC
AGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAAC
AGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCA
GCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCC
TCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCC
AGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGAC
AGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAAT
GGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCA
ACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTA
TACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAG
GCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAA
TACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTG
GACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTG
ACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAG
AAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCC
TTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAG
CCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGAT
TCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGA
ATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAA
ATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACAT
TTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5013nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCC
TCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATA
CCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCG
GACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGC
AATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTC
TCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGA
GTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAA
CAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGA
AAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTT
TTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTT
GTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAA
AAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATT
GCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCAC
AAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTT
GATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGAT
GGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGA
GAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGA
CATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGA

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_4935nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTG
ACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCT
GTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAG
ACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGC
CACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGA
CTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTT
GTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTT
CTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACA
CCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAAT
GGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGA
CTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGAC
CCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAA
TTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCA
GATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCAT
GTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTG
CCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTG
CTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCA
GTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_4848nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCC
TCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGC
CAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGAC
ATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCC
AGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGT
GGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGC
ACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATT
ACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAG
GTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTG
GCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTG
GAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCT
GGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAG
GGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCC
TTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAA
CTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGAC
ACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAA
AATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAG
GGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAAT
GACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATC
AAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTT
GCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTC
CATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATC
TTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTG
GTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGG
TCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_4959nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAG
CAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTA
AAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAA
GGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCC
CAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAG
AACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATT
CCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGA
CTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGC
AGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACC
AGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACC
CGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAA
ACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGC
GAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGA
ATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACG
TCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCT
CCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGC
ACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCC
GCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACC
AACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTA
AACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTT
CAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTA
AGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAA
GTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAA
TTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATT
TTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATC
ACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTAT
GGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGC
GAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGT
GAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5037nt
ATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAA
AAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCA
CCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTG
GCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTA
TTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAA
GGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTC
CAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATA
CTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCT
CAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGC
AAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCC
CAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCAT
GTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGA
AAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGT
CATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTG
AAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTG
GTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATC
TGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAA
AATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTAC
TGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCC
ATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTG
AAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTG
ATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGA
GGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAAT
CTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTG
GAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGG
CGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGG
GAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAG
CTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAA
GAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCT
CACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCC
CCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCAC
GAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCC
ACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTG
CCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAA
CCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGC
TCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCC
AACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGA
CCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCA
ATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGAT
GGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACG
CATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAG
AAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACC
CCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCC
TTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTT
ACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCT
CATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTG
GGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGAT
GTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATA
CTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATAT
GAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTT
AAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACAC
ACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCT
ATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACT
AAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATT
GAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_8337nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGAC
AGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAAT
TGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGC
AGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAAC
GGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGT
CCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAAT
CCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCT
CCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCT
CTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTG
GGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGA
GCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGAT
CACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGA
AACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAG
AACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCG
AGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAG
GCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAG
AAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCC
CTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTG
GGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAG
ATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGA
TTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAA
TACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCT
ATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGC
TACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGG
ACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATG
CTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAG
AAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACA
TACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGG
ATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTC
ATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGC
GAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCA
TGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACAT
AACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTC
CCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGC
CTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATG
GTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAA
TTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAG
GCTGAAGGCCATAACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAA
TGAATTTTTAAAAAGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACT
AGTCTAATAAAATCAACTACCACTTTTGTGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATA
CTAACGCCATTGAGTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAG
ATGGGATGACAGATGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAG
AGGTCACTTGGTTTGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACAT
TCCCAGCGCTCTCCCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTC
TCCCTGTGTGGGTGAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAG
CAAGGCTTTGGACAAAATTTTGAGACCCTAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTAT
GTATGTATTTAGTTCAGGTTGACTTGTGTCCTTATAAACTCTTACTCAAATGATTTGAACTTTTATGCGACTGGGATTTTTTTTTTCCAA
AGCTACAAGCATGGCCGCCTGTGGTATCGAGGTGTTGCAAACAATATCTGTGTTGCGCTTCCTGTTTTAACCTACCTCGTTTTGTTTGTT
TTTGTTTCACTGTTCATCACAGCAGTGTTATCTCCAGGAGACATATAGAGAGCTCAACCGGCAATCTCAGGTGCATTTAACATTTTTAAA
ACGAAACAGTAGTTGACCAAATTTTTCTTCTTAAAAAATTGGAAGTGGGGGGAATCCAATGACAAAAACTAATGTGGCTTGTTTCTGGAG
AAAATAATTACTGTAAATGGAACAACAACAACAAAAAAAACTACGATCTTACTGACTTTGCCTAAATACACAAGCAGCTGATGTACTATT
AATGAGAACGAAATACACATTAGGAAAATGGAGCCATTTCAATCTAGTGGTTTGGGCAAGATGGGGAAGAGAAGGGGAAACATTCTAGTT
TCTGGATTACATTATTATGCCCCTCCTGAAAAGGTGGTTGTCATTTGCATTTATTTAAAGCAGGTAATATGCAGGAATGTAACTGAGGAT
TATCTTCAGGCAATCAGCAAGATATCCTCCTCATGGTCCCTTTAGCTCTCAAAAGCAATGAAATCCTCCTGTTCTCATTTTTACTGCTGT
GGTTGTGCTGCTGAACAATACTATCTTCTCAAATTCCATGCCACAAATTCAGCAATAACTTTTTGGATTGAATTTAACAACTACTGTAAT
TGGATGCTGATGTGGACAAAATATATTGATTTCGATTTCACTCCCGAATGTGATTGCCACCAGCTCTTTATATTGCTGCTGTGGTATTTT
AAACCAGAAGCTTCTTTAAATTATGTTGCAAACTGATCTTTGTTTTTATGTTTTGTTTTGTTTTTATTTCTAAGTGATAAGTTTGAAACA
CACAGCTTTAAATGATTTTTTTATTGTGGGATTTTGGGTACAGTTAAGAAATAAAAGGGAATCATTGTGTTTAAACATAAGGTAGTTTGT
GAATGTATTTTTTAAAATCTAGAGTCATTGAAACAAATCATAAGAAAACAATATTAATGCAGTCTTGTTTACAGTATGTACAGTGACATA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_7029nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGAC
AGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAAT
TGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGC
AGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATC
TGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGG
CTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAA
AGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCA
GAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTG
AGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAG
GCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATG
AGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAAC
TCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTG
ATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCA
GCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCT
CTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACA
GTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGG
GGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGG
ACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTA
GGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAG
AAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCC
TGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGA
ATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAG
AAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTT
TGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATC
TCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAA
TTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTA
AAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCC
AATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGG
AAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCAT
CCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACT
TATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAAC
ATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGG
TGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACA
AATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGG
GGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGAT
GAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCACC
AACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAATAG
ATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTGTGAATCTGACAGGCCACATTTTTATA
TGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACACAACT
TTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTACAT
AGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCTGG
GACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGAAA
AAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACAAG
AGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCCTAATCACTTTACCTTCCTCCAAATTA
CCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTTGTGTCCTTATAAACTCTTACTCAAATGAT

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_7107nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAAC
AATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGG
AGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAG
AACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGG
AGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAA
AATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGA
CCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAA
GCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTC
CTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGG
AGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTG
GATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGG
TGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACC
AGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCT
CCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCA
GACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACA
GTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATG
GCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAA
CCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTAT
ACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGG
CCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAAT
ACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGG
ACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGA
CAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGA
AACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCT
TAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGC
CTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATT
CAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAA
TGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAA
TGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATT
TGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTG
GAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGC
GTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCC
CTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTT
CCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGC
TCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCA
TACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCAC
AATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGT
TGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGC
TAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTGTGAATCTGACAGGCCACATTTTTATATGGCCCTTTACA
GAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTA
TTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAA
AATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGT
GGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATA
AATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGG
CTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCCTAATCACTTTACCTTCCTCCAAATTACCCAACATACGG

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_6094nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAAC
AATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGG
AGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCAC
ATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGG
AGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTG
AAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAG
CCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAA
CTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAG
GAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCC
ATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATC
TGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTG
AGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGA
TACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCA
GCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTG
CTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATT
CCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGA
CGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAAC
TCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGA
AACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAA
GTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTT
CAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAG
GCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGA
ATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGC
TAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAA
ACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAA
TGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCA
CGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATG
GAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAA
GTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATT
TCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTT
CCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGA
GATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAA
CGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGC
GAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5771nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGAC
AGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAAT
TGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGC
AGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAAC
GGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGT
CCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAAT
CCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCT
CCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCT
CTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTG
GGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGA
GCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGAT
CACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGA
AACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAG
AAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGA
GCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGG
GAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGA
CGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATT
CTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCA
GCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAG
CCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAA
CCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTG
TAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGAT
TTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGT
TAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATA
AAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATA
AATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTA
TTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATA
TCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCT
ATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGG
GCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTAT
GTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5684nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAAC
AATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGG
AGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAG
AACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGG
AGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAA
AATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGA
CCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAA
GCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTC
CTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGG
AGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTG
GATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGG
TGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTG
AAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAG
AGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATG
TGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAG
AGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCC
ATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGA
GCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCAT
CAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACC
CAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGG
GTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGC
GATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCAT
GGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATT
ATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATC
ATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGG
TTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCA
ATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACA
CCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCT
GGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTC
TATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_5606nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGAC
AGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAAT
TGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGC
AGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATC
TGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGG
CTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAA
AGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCA
GAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTG
AGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAG
GCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATG
AGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAG
AACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGG
AGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACG
AGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCT
TGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGG
TGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAAT
ATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGG
ATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGG
TAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTG
CAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGA
TCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTT
ACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAG
GCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTC
CTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTC
AAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTC
ATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGG
TGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATC
AGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAA
GGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_5519nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAAC
AATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGG
AGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCAC
ATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGG
AGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTG
AAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAG
CCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAA
CTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAG
GAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCC
ATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAA
GAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAG
AGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCA
ACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAA
CCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACC
TGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTG
AATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAG
AGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGG
TGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTT
GTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATC
TGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAG
TTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGG
AAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGG
CTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAG
GTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCAT
CTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGG
GGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCA
ATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTC
AAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCC

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_5630nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGAC
AGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAAT
TGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGC
AGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATC
TGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGG
CTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAA
AGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCA
GAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTG
AGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAG
GCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATG
AGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGA
CGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGG
AGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATAC
CAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCG
GCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTG
GCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCC
AGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGT
CTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCA
ATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAAC
GATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTG
GGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAG
GAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCT
GGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATG
CTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAG
TTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACT
CTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGC
TTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGT
CTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAG
TATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTA

>In-frame_SKIL_ENST00000259119_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5708nt
GAGCGGGCGAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTT
TTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAA
ATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTGGTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTA
TGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAGACCATTGCATTGACCCTGGACATCTTTAATTGAGAAAT
TGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCATCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGC
AAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGAGAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGG
GCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATTCATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAA
ATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCTCCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAA
AACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGC
CAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTC
CTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCAT
TTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCC
CTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTT
TGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGT
GTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCAC
AAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGG
AAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTC
CGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCC
ACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAA
TTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAAC
TTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAG
GGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTA
TCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACA
CAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGA
TTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATC
GAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACAT
ATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGA
GAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCT
TGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCA
TTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAG
AGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGG
CCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCG
AGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGG
AGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAAC
AATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGG
AGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAG
AACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGG
AGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAA
AATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGA
CCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAA
GCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTC
CTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGG
AGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTG
GATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGG
TGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCA
AAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTA
GCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTC
CAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAA
GAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACC
TCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACT
CTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATG
AAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAA
AGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAG
AAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAG
TCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATA
AGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTG
GGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATAT
ATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGG
TAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCT
ACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATG
AGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACA
TTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATA
AGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_7838nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACT
GCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTA
CAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGT
GACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGC
TGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGA
GACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGG
CCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGG
ACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTT
TGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACT
TCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACAC
ACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAA
TGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGG
ACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGA
CCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAA
ATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGC
AGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCA
TGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTT
GCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGT
GCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTC
AGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTT
TGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTG
GCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGT
TGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAA
AAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAG
AAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAG
AATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCA
ATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCT
TCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGA
AATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTGTGAATCTGACAGGCCACATTT
TTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACA
CAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCT
TACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTT
TCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGAC
TGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGAT
ACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCCTAATCACTTTACCTTCCTCCA
AATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTTGTGTCCTTATAAACTCTTACTCAA
ATGATTTGAACTTTTATGCGACTGGGATTTTTTTTTTCCAAAGCTACAAGCATGGCCGCCTGTGGTATCGAGGTGTTGCAAACAATATCT
GTGTTGCGCTTCCTGTTTTAACCTACCTCGTTTTGTTTGTTTTTGTTTCACTGTTCATCACAGCAGTGTTATCTCCAGGAGACATATAGA
GAGCTCAACCGGCAATCTCAGGTGCATTTAACATTTTTAAAACGAAACAGTAGTTGACCAAATTTTTCTTCTTAAAAAATTGGAAGTGGG
GGGAATCCAATGACAAAAACTAATGTGGCTTGTTTCTGGAGAAAATAATTACTGTAAATGGAACAACAACAACAAAAAAAACTACGATCT
TACTGACTTTGCCTAAATACACAAGCAGCTGATGTACTATTAATGAGAACGAAATACACATTAGGAAAATGGAGCCATTTCAATCTAGTG
GTTTGGGCAAGATGGGGAAGAGAAGGGGAAACATTCTAGTTTCTGGATTACATTATTATGCCCCTCCTGAAAAGGTGGTTGTCATTTGCA
TTTATTTAAAGCAGGTAATATGCAGGAATGTAACTGAGGATTATCTTCAGGCAATCAGCAAGATATCCTCCTCATGGTCCCTTTAGCTCT
CAAAAGCAATGAAATCCTCCTGTTCTCATTTTTACTGCTGTGGTTGTGCTGCTGAACAATACTATCTTCTCAAATTCCATGCCACAAATT
CAGCAATAACTTTTTGGATTGAATTTAACAACTACTGTAATTGGATGCTGATGTGGACAAAATATATTGATTTCGATTTCACTCCCGAAT
GTGATTGCCACCAGCTCTTTATATTGCTGCTGTGGTATTTTAAACCAGAAGCTTCTTTAAATTATGTTGCAAACTGATCTTTGTTTTTAT
GTTTTGTTTTGTTTTTATTTCTAAGTGATAAGTTTGAAACACACAGCTTTAAATGATTTTTTTATTGTGGGATTTTGGGTACAGTTAAGA
AATAAAAGGGAATCATTGTGTTTAAACATAAGGTAGTTTGTGAATGTATTTTTTAAAATCTAGAGTCATTGAAACAAATCATAAGAAAAC
AATATTAATGCAGTCTTGTTTACAGTATGTACAGTGACATAACATAGAACATGAGCTTTTCTGGTGCCAACAACAATAAAACACACGTTA

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_6530nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACT
GCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACT
CCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGA
AGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCA
GTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGAT
GATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCA
GCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGG
CATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGA
GGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAA
TGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGC
TCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAA
CCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTA
TCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTG
TATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAA
ACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAG
ATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATAT
TCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTA
TGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGAT
AATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTT
AAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAG
AAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGAC
TTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCA
TCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGAC
AAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGG
TTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTA
CTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATA
ACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAA
AGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAAT
CAACTACCACTTTTGTGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGA
GTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGA
TGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTT
TGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTC
CCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGT
GAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGAC
AAAATTTTGAGACCCTAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_6608nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCA
AGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAAT
GAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGT
TGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCT
CAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCC
CACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGA
AAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAG
AACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAG
AGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCAC
CCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAA
GTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGT
GAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGA
AACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAG
CGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGG
AATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGAC
GTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTC
TCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAG
CACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGC
CGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAAC
CAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGT
AAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATT
TCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTT
AAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAA
AGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAA
ATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTAT
TTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATAT
CACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTA
TGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGG
CGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATG
TGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGAT
GAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCT
AGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTT
GCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCA
TGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTT
TTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGT
ATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGG
AGTAATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAA
TACTAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTT
TTGTGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCC
TAGCGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACA
GAAAGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTA
GGACTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCA
CTTTCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGAC
TAGACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGA
CCCTAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_5595nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCA
AGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAAT
GAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTC
AGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTC
AGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACC
AAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGG
ATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTC
CTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGT
TCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCC
CAGTCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAA
CCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGAC
CCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGT
GGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGG
AGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGC
TGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAA
AGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGC
TCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACAT
TCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCT
TCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCA
GATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAA
CAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGT
TAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCAT
GGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGG
TTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCC
TCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCG
GATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAA
AGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAG
AAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTG
GTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGC
AGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCC
TGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCC
CTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTT
ACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGG
TATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAAT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5272nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACT
GCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCT
GACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGA
GGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGAT
ACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAG
CGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGC
TGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTC
CCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGAC
GTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACT
CAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAA
ACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAG
TGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTC
AGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGG
CTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAA
TGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCT
AGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAA
CTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAAT
GCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCAC
GTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGG
AGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAG

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5185nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCA
AGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAAT
GAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGT
TGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCT
CAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCC
CACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGA
AAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAG
AACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAG
AGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCAC
CCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAA
GTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGA
TCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAG
TGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACT
GATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTT
CAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTT
TGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCA
TTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCA
GACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAA
ACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAA
GAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCG
AAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAAT
TTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACA
AGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAA
GAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCT
GCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGG
AAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGA
AATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCC
CACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGA
TGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGG

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_5107nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACT
GCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTA
CTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGA
CATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCA
TGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGA
CAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCG
CGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCC
CAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCA
AGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAAT
CAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGAT
GCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGT
CCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGT
AGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGT
GATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCA
GCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGA
TGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAAC
AGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATG
GGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAAC
AGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGT

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_5020nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCA
AGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAAT
GAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTC
AGTGCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTC
AGATCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACC
AAAGGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGG
ATCTCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTC
CTCCAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGT
TCGAGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCC
CAGTCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGA
TTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAG
CGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTC
TCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAG
TGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGG
GCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGA
CCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAG
GCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGA
AATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCT
GATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAA
TGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGA
AGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTT
GGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCT
CCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAAT
TGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAA
AACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCA
ATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGA
AACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATC

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_5131nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACT
GCATGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCG
CCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCA
TGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGG
GACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGA
GAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGG
AACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGC
CTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCT
GTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCG
GCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCT
GGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGAT
GGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAG
AATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAA
ATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGC
ATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTC
ACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCA
TGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGAT
AACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGC
TATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAA
TGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTA

>In-frame_SKIL_ENST00000426052_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5209nt
GAGCGGCGACGGCGGCGGCGGCGGGCACAGATTAATTAAAAGAAGAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCG
GAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTTTTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCC
TCTGCCCTCCTTTTTGGTTTCCTTGGTGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGAT
AACGGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGA
AACTGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATT
CCATTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCC
TCTTCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATC
TATTTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAAT
AAATACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATT
CAATGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGG
TAGCGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCA
GGGTTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTT
TGTGATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCA
AAAATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAA
TCAATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAA
AACGGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATA
TTCTCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGA
GTTTTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGA
AATCTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGA
AGTTAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGC
ACCAGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAAT
GGCAGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAA
GAAGTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCA
TCCATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAA
AGATGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGG
GGAGTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCA
GCAGCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGA
GGAGCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGA
GAGGAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCA
AGAAAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAAT
GAGTCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGT
TGCCAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCT
CAGACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCC
CACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGA
AAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAG
AACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAG
AGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCAC
CCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAA
GTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAG
CTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAA
GGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGT
GGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCT
GGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATC
TGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGA
GGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCC
CTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGA
ACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGA
CACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGA
AAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGA
GGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAA
TGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGAT
CAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTT
TGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTT
CCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCAT
CTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGT
GGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCG
GTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATT

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_8375nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAA
CAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACC
AGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAA
GGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCC
TCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAAC
TTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAG
CAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAG
CTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGA
AGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAA
AAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGAC
TGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGT
CAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGAC
CTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCA
CAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACT
GGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGT
GGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCT
TAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACC
AGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGG
CCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACT
GAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCC
AGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATT
TTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGA
TCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGT
AATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCC
TAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCT
CCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGT
GGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGC
ATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCA
CTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGA
ACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAA
GGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAA
CAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAAT
GGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATG
ATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCA
CCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAAT
AGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTGTGAATCTGACAGGCCACATTTTTA
TATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACACAA
CTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTAC
ATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCT
GGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGA
AAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACA
AGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCCTAATCACTTTACCTTCCTCCAAAT
TACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTTGTGTCCTTATAAACTCTTACTCAAATG
ATTTGAACTTTTATGCGACTGGGATTTTTTTTTTCCAAAGCTACAAGCATGGCCGCCTGTGGTATCGAGGTGTTGCAAACAATATCTGTG
TTGCGCTTCCTGTTTTAACCTACCTCGTTTTGTTTGTTTTTGTTTCACTGTTCATCACAGCAGTGTTATCTCCAGGAGACATATAGAGAG
CTCAACCGGCAATCTCAGGTGCATTTAACATTTTTAAAACGAAACAGTAGTTGACCAAATTTTTCTTCTTAAAAAATTGGAAGTGGGGGG
AATCCAATGACAAAAACTAATGTGGCTTGTTTCTGGAGAAAATAATTACTGTAAATGGAACAACAACAACAAAAAAAACTACGATCTTAC
TGACTTTGCCTAAATACACAAGCAGCTGATGTACTATTAATGAGAACGAAATACACATTAGGAAAATGGAGCCATTTCAATCTAGTGGTT
TGGGCAAGATGGGGAAGAGAAGGGGAAACATTCTAGTTTCTGGATTACATTATTATGCCCCTCCTGAAAAGGTGGTTGTCATTTGCATTT
ATTTAAAGCAGGTAATATGCAGGAATGTAACTGAGGATTATCTTCAGGCAATCAGCAAGATATCCTCCTCATGGTCCCTTTAGCTCTCAA
AAGCAATGAAATCCTCCTGTTCTCATTTTTACTGCTGTGGTTGTGCTGCTGAACAATACTATCTTCTCAAATTCCATGCCACAAATTCAG
CAATAACTTTTTGGATTGAATTTAACAACTACTGTAATTGGATGCTGATGTGGACAAAATATATTGATTTCGATTTCACTCCCGAATGTG
ATTGCCACCAGCTCTTTATATTGCTGCTGTGGTATTTTAAACCAGAAGCTTCTTTAAATTATGTTGCAAACTGATCTTTGTTTTTATGTT
TTGTTTTGTTTTTATTTCTAAGTGATAAGTTTGAAACACACAGCTTTAAATGATTTTTTTATTGTGGGATTTTGGGTACAGTTAAGAAAT
AAAAGGGAATCATTGTGTTTAAACATAAGGTAGTTTGTGAATGTATTTTTTAAAATCTAGAGTCATTGAAACAAATCATAAGAAAACAAT
ATTAATGCAGTCTTGTTTACAGTATGTACAGTGACATAACATAGAACATGAGCTTTTCTGGTGCCAACAACAATAAAACACACGTTAAAC

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_7067nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCA
CGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCC
CACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGT
GCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCA
ACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAG
CTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGC
CAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCG
ACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCG
GATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGA
TGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTA
CAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGAT
TAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCA
GAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCAT
GGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGA
ATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGT
AAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCT
GTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCG
GAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCT
TTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTAT
ACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACC
GTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATT
AAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCA
GGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGT
AAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAAT
GGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAA
GTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAA
TTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTA
TGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCT
TTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAA
GATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTT
TTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTA
GTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACT
ACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGA
GAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAA
CTACCACTTTTGTGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTT
GAGCTGGCCTAGCGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGG
GGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGG
GCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCG
AGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAG
AGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAA
ATTTTGAGACCCTAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCA

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_7145nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGTGAG
TGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAAC
AAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGA
GACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAAT
GGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTC
TGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCC
AGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCAC
CAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGC
AGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAA
CATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAA
CCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCA
GCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAG
AAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGT
TGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATT
CATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTT
TGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCAC
TCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGG
CCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGA
GAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGA
AAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAA
CTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGA
GGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCA
GCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGT
GCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTC
TTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATA
TGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGT
AATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATAC
TAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTG
TGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAG
CGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAA
AGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGA
CTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTT
TCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAG
ACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCC
TAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTTGTG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_6132nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCG
CCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCA
TGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGG
GACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGA
GAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGG
AACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGC
CTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCT
GTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCG
GCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCT
GGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGAT
GGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAG
AATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAA
ATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGC
ATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTC
ACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCA
TGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGAT
AACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGC
TATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAA
TGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTA
ACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGA
ATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGG
TTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTT
CGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACC
CCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTAT
GTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTA

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5809nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAA
CAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACC
AGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAA
GGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCC
TCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAAC
TTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAG
CAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAG
CTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGA
AGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGAC
GGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGA
GTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACC
AACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGG
CAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGG
CCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCA
GGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTC
TCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAA
TGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACG
ATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGG
GCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGG
AAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTG
GATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGC
TGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGT
TGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTC
TTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCT
TGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTC
TGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGT
ATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5722nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCT
GACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGA
GGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGAT
ACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAG
CGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGC
TGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTC
CCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGAC
GTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACT
CAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAA
ACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAG
TGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTC
AGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGG
CTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAA
TGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCT
AGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAA
CTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAAT
GCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCAC
GTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGG
AGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_5644nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCA
CGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCC
CACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGT
GCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCA
ACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAG
CTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGC
CAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCG
ACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTC
CTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACAT
ACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGC
GGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAG
CAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGT
CTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAG
AGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGA
ACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAG
AAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCT
TTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCT
TGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGA
AAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGAT
TGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCA
CAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGT
TGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGA
TGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGG
AGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGG
ACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCG

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_5557nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTA
CTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGA
CATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCA
TGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGA
CAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCG
CGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCC
CAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCA
AGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAAT
CAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGAT
GCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGT
CCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGT
AGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGT
GATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCA
GCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGA
TGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAAC
AGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATG
GGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAAC
AGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGT

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_5668nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCA
CGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCC
CACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGT
GCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCA
ACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAG
CTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGC
CAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCG
ACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCC
AATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGA
TGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGAC
GCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAA
GAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAAC
CCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTC
CTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTT
TACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCC
TCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGT
GGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGA
TGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAAT
ACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATA
TGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATT
TAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACA
CACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGC
TATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAAC
TAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTAT
TGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGA

>In-frame_SKIL_ENST00000413427_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5746nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTA
CAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGT
GACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGC
TGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGA
GACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGG
CCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGG
ACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTT
TGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACT
TCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACAC
ACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAA
TGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGG
ACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGA
CCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAA
ATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGC
AGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCA
TGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTT
GCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGT
GCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTC
AGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000436636_chr3_171087474_-_8375nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAA
CAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACC
AGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAA
GGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCC
TCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAAC
TTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAG
CAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAG
CTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGA
AGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTACAA
AAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGAC
TGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGT
CAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGAC
CTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCA
CAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACT
GGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGT
GGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCT
TAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACC
AGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGG
CCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACT
GAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCC
AGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATT
TTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGA
TCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGT
AATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCC
TAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCT
CCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGT
GGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGC
ATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTAACAGAAGAGCACTTGGCA
CTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGA
ACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAA
GGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTTCGGAATTAGGGATAGAAA
CAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAAT
GGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTATGTTGTAAAATTTCCAATG
ATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCA
CCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAAT
AGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTGTGAATCTGACAGGCCACATTTTTA
TATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAGCGATGGAGGGACACTCTAACACAA
CTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTAC
ATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCT
GGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGA
AAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACA
AGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCCTAATCACTTTACCTTCCTCCAAAT
TACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTTGTGTCCTTATAAACTCTTACTCAAATG
ATTTGAACTTTTATGCGACTGGGATTTTTTTTTTCCAAAGCTACAAGCATGGCCGCCTGTGGTATCGAGGTGTTGCAAACAATATCTGTG
TTGCGCTTCCTGTTTTAACCTACCTCGTTTTGTTTGTTTTTGTTTCACTGTTCATCACAGCAGTGTTATCTCCAGGAGACATATAGAGAG
CTCAACCGGCAATCTCAGGTGCATTTAACATTTTTAAAACGAAACAGTAGTTGACCAAATTTTTCTTCTTAAAAAATTGGAAGTGGGGGG
AATCCAATGACAAAAACTAATGTGGCTTGTTTCTGGAGAAAATAATTACTGTAAATGGAACAACAACAACAAAAAAAACTACGATCTTAC
TGACTTTGCCTAAATACACAAGCAGCTGATGTACTATTAATGAGAACGAAATACACATTAGGAAAATGGAGCCATTTCAATCTAGTGGTT
TGGGCAAGATGGGGAAGAGAAGGGGAAACATTCTAGTTTCTGGATTACATTATTATGCCCCTCCTGAAAAGGTGGTTGTCATTTGCATTT
ATTTAAAGCAGGTAATATGCAGGAATGTAACTGAGGATTATCTTCAGGCAATCAGCAAGATATCCTCCTCATGGTCCCTTTAGCTCTCAA
AAGCAATGAAATCCTCCTGTTCTCATTTTTACTGCTGTGGTTGTGCTGCTGAACAATACTATCTTCTCAAATTCCATGCCACAAATTCAG
CAATAACTTTTTGGATTGAATTTAACAACTACTGTAATTGGATGCTGATGTGGACAAAATATATTGATTTCGATTTCACTCCCGAATGTG
ATTGCCACCAGCTCTTTATATTGCTGCTGTGGTATTTTAAACCAGAAGCTTCTTTAAATTATGTTGCAAACTGATCTTTGTTTTTATGTT
TTGTTTTGTTTTTATTTCTAAGTGATAAGTTTGAAACACACAGCTTTAAATGATTTTTTTATTGTGGGATTTTGGGTACAGTTAAGAAAT
AAAAGGGAATCATTGTGTTTAAACATAAGGTAGTTTGTGAATGTATTTTTTAAAATCTAGAGTCATTGAAACAAATCATAAGAAAACAAT
ATTAATGCAGTCTTGTTTACAGTATGTACAGTGACATAACATAGAACATGAGCTTTTCTGGTGCCAACAACAATAAAACACACGTTAAAC

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000538048_chr3_171087474_-_7067nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCA
CGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCC
CACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGT
GCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCA
ACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAG
CTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGC
CAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCG
ACCAGCTGTGAGTGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCG
GATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGA
TGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTA
CAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGAT
TAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCA
GAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCAT
GGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGA
ATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGT
AAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCT
GTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCG
GAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCT
TTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTAT
ACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACC
GTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATT
AAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCA
GGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGT
AAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAAT
GGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAA
GTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAA
TTCCATGATGAACTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTA
TGCCAGTCTAGAGGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCT
TTCAATGTTGCAGCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAA
GATGGACCATGTGCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTT
TTACCTTTTTTCTTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTA
GTTTTAAGTATATGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACT
ACATAGTGGAGTAATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGA
GAAGAAAAATACTAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAA
CTACCACTTTTGTGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTT
GAGCTGGCCTAGCGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGG
GGTCAGACAGAAAGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGG
GCTTCATTAGGACTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCG
AGGGTGCCACTTTCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAG
AGAAGGGACTAGACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAA
ATTTTGAGACCCTAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCA

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000369326_chr3_171087474_-_7145nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAAATAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGTGAG
TGCTTTTCTCTCCAAGAGTTTTGAACTCTTAATTTACCAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAAC
AAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGA
GACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAAT
GGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTC
TGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCC
AGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCAC
CAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGC
AGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAA
CATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAA
CCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCA
GCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAG
AAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGT
TGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATT
CATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTT
TGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCAC
TCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGG
CCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGA
GAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGA
AAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAA
CTGGTAACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGA
GGCAGAATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCA
GCCTGGTTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGT
GCCCTTCGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTC
TTTACCCCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATA
TGGTATGTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGT
AATTTAAGAACTCTCTTGCCTTCACCAACCCAAAAGGTTGCTTTTTGATAGCAACTGGCTAATGAATTTTTAAAAAGAGAAGAAAAATAC
TAGTTTTCCCCTCTTTTGGGAAATAGATTTTAAATGGCTAAACTACTAGCCTTAAAACTACTAGTCTAATAAAATCAACTACCACTTTTG
TGAATCTGACAGGCCACATTTTTATATGGCCCTTTACAGAATGGAGTGTGTTGAACAGGATACTAACGCCATTGAGTTGAGCTGGCCTAG
CGATGGAGGGACACTCTAACACAACTTTCCCTCAGCTATTATGCAACAGATCAGGGAAAAAGATGGGATGACAGATGGGGTCAGACAGAA
AGAGCTTCTGGGAAACAAGCTTACATAGTCTTTTTTAAAATGCACAAAGCCTCCCAGCTAAGAGGTCACTTGGTTTGGGCTTCATTAGGA
CTGAGACTTTGTTGAGTTCTTTCTGGGACTTGGAGAGTGGATGATATTCAGGCTCTGAACATTCCCAGCGCTCTCCCGAGGGTGCCACTT
TCTCAAGATGAAAACTGTGACTGAAAAAATTAATAATAAATGTTTCTGAGCTGCCTGTGTTCTCCCTGTGTGGGTGAGAGAAGGGACTAG
ACTCCTAAGCCTGCCTCAGATACAAGAGGCATCATTGGCTCCAATTTTAGAGAACTTGAAAGCAAGGCTTTGGACAAAATTTTGAGACCC
TAATCACTTTACCTTCCTCCAAATTACCCAACATACGGTAAACAACATTTGTGCAGAAGTATGTATGTATTTAGTTCAGGTTGACTTGTG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000341852_chr3_171087474_-_6132nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCG
CCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCA
TGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGG
GACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGA
GAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGG
AACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGC
CTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCT
GTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCG
GCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCT
GGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGAT
GGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAG
AATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAA
ATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGC
ATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTC
ACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCA
TGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGAT
AACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGC
TATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAA
TGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAGCCAAGTGTTTTTCATGACCCTCAACAGAAATTCCATGATGAACTGGTA
ACAGAAGAGCACTTGGCACTTATCTTCATGGCGTTATTTCTAATTTAAAAGAACATAACTCATGTGGACTTATGCCAGTCTAGAGGCAGA
ATCAGAAGGCTTGGTTGAACATATCGCTTTCCCTTTTTCCTCTCCCTCCGCCCCTCCCAGTACAGTCCATCTTTCAATGTTGCAGCCTGG
TTGAGAAGGAGAGAAAAAGGTGGCAGGAATTTCCAGGAGATCCCCAAGAATGCTGCCTTGTCTGTGGACAAAGATGGACCATGTGCCCTT
CGGAATTAGGGATAGAAACAAATATTGTGTGCTCTTAACGATTAAGCTGTGTTATGGTGGGTTTTCAGGTTTTTACCTTTTTTCTTTACC
CCTTTACTCTGCAAGAATGGGGAAAGAATGCATACTGCGAAAATGAGTCTTTTAAATTCTGTCTGCCTACTAGTTTTAAGTATATGGTAT
GTTGTAAAATTTCCAATGATGAGAGACAGCACAATAAATGTACCTTATCTCCTTAGGCTGAAGGCCATAACTACATAGTGGAGTAATTTA

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000284483_chr3_171087474_-_5809nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGCCAA
CAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAGACC
AGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCACAAA
GGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAATCC
TCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAACAAC
TTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGCAAG
CAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCCTAG
CTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTCAGA
AGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCTGAC
GGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGA
GTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACC
AACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGG
CAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGG
CCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCA
GGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTC
TCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAA
TGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAAACG
ATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGG
GCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGG
AAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTG
GATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGC
TGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGT
TGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTC
TTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCT
TGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTC
TGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGT
ATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAGTAG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000470834_chr3_171087474_-_5722nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTGATCT
GACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGA
GGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACATACCCAGACTGAT
ACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAG
CGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGC
TGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTC
CCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAGAGTATACCAGAC
GTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACT
CAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAGAAAATACAAGAA
ACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAG
TGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTC
AGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGAAAAGAAACAAGG
CTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAA
TGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCT
AGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGTTGATTCAGGAAA
CTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGATGGAATGGAAAT
GCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCAC
GTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGGACATTTGGATGG
AGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCGATCTGGAGGAAG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000460047_chr3_171087474_-_5644nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCA
CGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCC
CACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGT
GCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCA
ACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAG
CTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGC
CAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCG
ACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTACTC
CTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGACAT
ACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCATGC
GGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGACAG
CAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCGCGT
CTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCCCAG
AGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCAAGA
ACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAATCAG
AAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGATGCT
TTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGTCCT
TGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGTAGA
AAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGTGAT
TGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCAGCA
CAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGATGT
TGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAACAGA
TGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATGGGG
AGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAACAGG
ACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGTGCG

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000475336_chr3_171087474_-_5557nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGT
GCACGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGA
TCCCACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAA
GGTGCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATC
TCAACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTC
CAGCTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCG
AGCCAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAG
TCGACCAGCTGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGTGACTGATTA
CTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGCTGTCAGCGA
CATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGAGACCTCTCA
TGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGGCCACAGTGA
CAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGGACTGGGGCG
CGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTTTGTGGACCC
CAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACTTCTTAGGCA
AGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACACACCAGAAAT
CAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAATGGCCTGAT
GCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGGACTGAATGT
CCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGACCCAGAAGT
AGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAAATTTTTGGT
GATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGCAGATCTCCA
GCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCATGTAATTGA
TGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTTGCCTAAAAC
AGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGTGCTCCAATG
GGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTCAGTGGAAAC
AGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTTTGCATCCGT

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000488470_chr3_171087474_-_5668nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATACATCAGGCGACAGTTAGAGGAGGAGCAGAGACAGTTAGAGATCTTGCAGCAGCAGCTACTGCA
TGAACAAGCTCTACTTCTGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGAAAG
AGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAGTCC
TAGTGAGAAGCCAGCATGGGCCAAGGAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCA
CGAGCAGCCCACAAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCC
CACCTCGGAAAATCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGT
GCCTCAAAGAACAACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCA
ACCCATCAGAGCAAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAG
CTCCAGCACCCCTAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGC
CAACAGTAAGTCAGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCG
ACCAGCTAGCTACAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCC
AATGAAGAAGGTGACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGA
TGGGACAGTGGCTGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGAC
GCATGGGCTGGAGACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAA
GAAGCGATCTGGCCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAAC
CCCGACTGAGGGACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTC
CTTCACCCCCTTTGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTT
TACTAGCGAACTTCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCC
TCATAGCGACACACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGT
GGGGACTGAAAATGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGA
TGTGCTAGAGGGACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAAT
ACTACATAATGACCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATA
TGAAAGGATCAAATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATT
TAAGTCTTTTGCAGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACA
CACTGGTTTCCATGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGC
TATTGTCATCTTGCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAAC
TAAGGATGTGGTGCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTAT
TGAGATCCGGTCAGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGA

>In-frame_SKIL_ENST00000458537_chr3_170079217_+_TNIK_ENST00000357327_chr3_171087474_-_5746nt
GGTTTCAAATTGGCCCTTTGGCCTCTGGAGCAAATTCAAATGTAACTCTTCCCCAACCCCCCTTCTCTTCTTCCAGATTAATTAAAAGAA
GAATGAACTATAATCCTTGAAGATAACTGGGCAATTTTTTAAGTCGGAGGCTGTTCTTACTGGTGTGAGGATTTACACACGTCTTCAGTT
TTTCAGCACAGACCAGCAGACCATCATTTTTAGAGGAAATACTCCCTCTGCCCTCCTTTTTGGTTTCCTTGGTGGTAAAGATTAAATTTG
GTTGCATCATTTTGACTTGTGTTTGAGTCTAGATTTTATGGCACAAGGAATGGCATAAACTTTTCATGTGTTTTGGTTAAAACAAACCAG
ACCATTGCATTGACCCTGGACATCTTTAATTGAGAAATTGGTAACTTTATTTTAATATGTATATCTGAAGAATTCAAGAAAACAAAGGCA
TCCTCAGAGGTGTGCCTCTTTTCTTTATTATTAGAGGCAAAACGAACAATTTTATAGGATTTGTAGTGAAATTATACCAGATTATAAGGA
GAACCAAAACTAAGTCGCAAAATTTATTAATTTAAGGGGCTCTCGCTTTGAAAGTTTGAGAGTAAGTTACGATAGGCATTTGTATCCATT
CATTACTTTCCTCTTTTCAAATAAGCAACTAAATAGAAATGCTAATCTCAGACTTAATTATTTAACAGAAGAGTGTACCATGGAAAACCT
CCAGACAAATTTCTCCTTGGTTCAGGGCTCAACTAAAAAACTGAATGGGATGGGAGATGATGGCAGCCCCCCAGCGAAAAAAATGATAAC
GGACATTCATGCAAATGGAAAAACGATAAACAAGGTGCCAACAGTTAAGAAGGAACACTTGGATGACTATGGAGAAGCACCAGTGGAAAC
TGATGGAGAGCATGTTAAGCGAACCTGTACTTCTGTTCCTGAAACTTTGCATTTAAATCCCAGTTTGAAACACACATTGGCACAATTCCA
TTTAAGTAGTCAGAGCTCGCTGGGTGGACCAGCAGCATTTTCTGCTCGGCATTCCCAAGAAAGCATGTCGCCTACTGTATTTCTGCCTCT
TCCATCACCTCAGGTTCTTCCTGGCCCATTGCTCATCCCTTCAGATAGCTCCACAGAACTCACTCAGACTGTGTTGGAAGGGGAATCTAT
TTCTTGTTTTCAAGTTGGAGGAGAAAAGAGACTCTGTTTGCCCCAAGTCTTAAATTCTGTTCTCCGAGAATTTACACTCCAGCAAATAAA
TACAGTGTGTGATGAACTGTACATATATTGTTCAAGGTGTACTTCAGACCAGCTTCATATCTTAAAGGTACTGGGCATACTTCCATTCAA
TGCCCCATCCTGTGGGCTGATTACATTAACTGATGCACAAAGATTATGTAATGCTTTATTGCGGCCACGAACTTTTCCTCAAAATGGTAG
CGTACTTCCTGCTAAAAGCTCATTGGCCCAGTTAAAGGAAACTGGCAGTGCCTTTGAAGTGGAGCATGAATGCCTAGGCAAATGTCAGGG
TTTATTTGCACCCCAGTTTTATGTTCAGCCTGATGCTCCGTGTATTCAATGTCTGGAGTGTTGTGGAATGTTTGCACCCCAGACGTTTGT
GATGCATTCTCACAGATCACCTGACAAAAGAACTTGCCACTGGGGCTTTGAATCAGCTAAATGGCATTGCTATCTTCATGTGAACCAAAA
ATACTTAGGAACACCTGAAGAAAAGAAACTGAAGATAATTTTAGAAGAAATGAAGGAGAAGTTTAGCATGAGAAGTGGAAAGAGAAATCA
ATCCAAGGACCCCGCAGGGATCTTTGAATTGGTGGAACTTGTTGGAAATGGAACATACGGGCAAGTTTATAAGGGTCGTCATGTCAAAAC
GGGCCAGCTTGCAGCCATCAAGGTTATGGATGTCACAGGGGATGAAGAGGAAGAAATCAAACAAGAAATTAACATGTTGAAGAAATATTC
TCATCACCGGAATATTGCTACATACTATGGTGCTTTTATCAAAAAGAACCCACCAGGCATGGATGACCAACTTTGGTTGGTGATGGAGTT
TTGTGGTGCTGGCTCTGTCACCGACCTGATCAAGAACACAAAAGGTAACACGTTGAAAGAGGAGTGGATTGCATACATCTGCAGGGAAAT
CTTACGGGGGCTGAGTCACCTGCACCAGCATAAAGTGATTCATCGAGATATTAAAGGGCAAAATGTCTTGCTGACTGAAAATGCAGAAGT
TAAACTAGTGGACTTTGGAGTCAGTGCTCAGCTTGATCGAACAGTGGGCAGGAGGAATACTTTCATTGGAACTCCCTACTGGATGGCACC
AGAAGTTATTGCCTGTGATGAAAACCCAGATGCCACATATGATTTCAAGAGTGACTTGTGGTCTTTGGGTATCACCGCCATTGAAATGGC
AGAAGGTGCTCCCCCTCTCTGTGACATGCACCCCATGAGAGCTCTCTTCCTCATCCCCCGGAACCCAGCGCCTCGGCTGAAGTCTAAGAA
GTGGTCAAAAAAATTCCAGTCATTTATTGAGAGCTGCTTGGTAAAGAATCACAGCCAGCGACCAGCAACAGAACAATTGATGAAGCATCC
ATTTATACGAGACCAACCTAATGAGCGACAGGTCCGCATTCAACTCAAGGACCATATTGATAGAACAAAGAAGAAGCGAGGAGAAAAAGA
TGAGACAGAGTATGAGTACAGTGGAAGTGAGGAAGAAGAGGAGGAGAATGACTCAGGAGAGCCCAGCTCCATCCTGAATCTGCCAGGGGA
GTCGACGCTGCGGAGGGACTTTCTGAGGCTGCAGCTGGCCAACAAGGAGCGTTCTGAGGCCCTACGGAGGCAGCAGCTGGAGCAGCAGCA
GCGGGAGAATGAGGAGCACAAGCGGCAGCTGCTGGCCGAGCGTCAGAAGCGCATCGAGGAGCAGAAAGAGCAGAGGCGGCGGCTGGAGGA
GCAACAAAGGCGAGAGAAGGAGCTGCGGAAGCAGCAGGAGAGGGAGCAGCGCCGGCACTATGAGGAGCAGATGCGCCGGGAGGAGGAGAG
GAGGCGTGCGGAGCATGAACAGGAATATAAGCGCAAACAATTGGAAGAACAGAGACAAGCAGAAAGACTGCAGAGGCAGCTAAAGCAAGA
AAGAGACTACTTAGTTTCCCTTCAGCATCAGCGGCAGGAGCAGAGGCCTGTGGAGAAGAAGCCACTGTACCATTACAAAGAAGGAATGAG
TCCTAGTGAGAAGCCAGCATGGGCCAAGGAGGTAGAAGAACGGTCAAGGCTCAACCGGCAAAGTTCCCCTGCCATGCCTCACAAGGTTGC
CAACAGGATATCTGACCCCAACCTGCCCCCAAGGTCGGAGTCCTTCAGCATTAGTGGAGTTCAGCCTGCTCGAACACCCCCCATGCTCAG
ACCAGTCGATCCCCAGATCCCACATCTGGTAGCTGTAAAATCCCAGGGACCTGCCTTGACCGCCTCCCAGTCAGTGCACGAGCAGCCCAC
AAAGGGCCTCTCTGGGTTTCAGGAGGCTCTGAACGTGACCTCCCACCGCGTGGAGATGCCACGCCAGAACTCAGATCCCACCTCGGAAAA
TCCTCCTCTCCCCACTCGCATTGAAAAGTTTGACCGAAGCTCTTGGTTACGACAGGAAGAAGACATTCCACCAAAGGTGCCTCAAAGAAC
AACTTCTATATCCCCAGCATTAGCCAGAAAGAATTCTCCTGGGAATGGTAGTGCTCTGGGACCCAGACTAGGATCTCAACCCATCAGAGC
AAGCAACCCTGATCTCCGGAGAACTGAGCCCATCTTGGAGAGCCCCTTGCAGAGGACCAGCAGTGGCAGTTCCTCCAGCTCCAGCACCCC
TAGCTCCCAGCCCAGCTCCCAAGGAGGCTCCCAGCCTGGATCACAAGCAGGATCCAGTGAACGCACCAGAGTTCGAGCCAACAGTAAGTC
AGAAGGATCACCTGTGCTCCCCCATGAGCCTGCGAAGGTGAAACCAGAAGAATCCAGGGACATTACCCGGCCCAGTCGACCAGCTAGCTA
CAAAAAAGCTATAGATGAGGATCTGACGGCATTAGCCAAAGAACTAAGAGAACTCCGGATTGAAGAAACAAACCGCCCAATGAAGAAGGT
GACTGATTACTCCTCCTCCAGTGAGGAGTCAGAAAGTAGCGAGGAAGAGGAGGAAGATGGAGAGAGCGAGACCCATGATGGGACAGTGGC
TGTCAGCGACATACCCAGACTGATACCAACAGGAGCTCCAGGCAGCAACGAGCAGTACAATGTGGGAATGGTGGGGACGCATGGGCTGGA
GACCTCTCATGCGGACAGTTTCAGCGGCAGTATTTCAAGAGAAGGAACCTTGATGATTAGAGAGACGTCTGGAGAGAAGAAGCGATCTGG
CCACAGTGACAGCAATGGCTTTGCTGGCCACATCAACCTCCCTGACCTGGTGCAGCAGAGCCATTCTCCAGCTGGAACCCCGACTGAGGG
ACTGGGGCGCGTCTCAACCCATTCCCAGGAGATGGACTCTGGGACTGAATATGGCATGGGGAGCAGCACCAAAGCCTCCTTCACCCCCTT
TGTGGACCCCAGAGTATACCAGACGTCTCCCACTGATGAAGATGAAGAGGATGAGGAATCATCAGCCGCAGCTCTGTTTACTAGCGAACT
TCTTAGGCAAGAACAGGCCAAACTCAATGAAGCAAGAAAGATTTCGGTGGTAAATGTAAACCCAACCAACATTCGGCCTCATAGCGACAC
ACCAGAAATCAGAAAATACAAGAAACGATTCAACTCAGAAATACTTTGTGCAGCTCTGTGGGGTGTAAACCTTCTGGTGGGGACTGAAAA
TGGCCTGATGCTTTTGGACCGAAGTGGGCAAGGCAAAGTCTATAATCTGATCAACCGGAGGCGATTTCAGCAGATGGATGTGCTAGAGGG
ACTGAATGTCCTTGTGACAATTTCAGGAAAGAAGAATAAGCTACGAGTTTACTATCTTTCATGGTTAAGAAACAGAATACTACATAATGA
CCCAGAAGTAGAAAAGAAACAAGGCTGGATCACTGTTGGGGACTTGGAAGGCTGTATACATTATAAAGTTGTTAAATATGAAAGGATCAA
ATTTTTGGTGATTGCCTTAAAGAATGCTGTGGAAATATATGCTTGGGCTCCTAAACCGTATCATAAATTCATGGCATTTAAGTCTTTTGC
AGATCTCCAGCACAAGCCTCTGCTAGTTGATCTCACGGTAGAAGAAGGTCAAAGATTAAAGGTTATTTTTGGTTCACACACTGGTTTCCA
TGTAATTGATGTTGATTCAGGAAACTCTTATGATATCTACATACCATCTCATATTCAGGGCAATATCACTCCTCATGCTATTGTCATCTT
GCCTAAAACAGATGGAATGGAAATGCTTGTTTGCTATGAGGATGAGGGGGTGTATGTAAACACCTATGGCCGGATAACTAAGGATGTGGT
GCTCCAATGGGGAGAAATGCCCACGTCTGTGGCCTACATTCATTCCAATCAGATAATGGGCTGGGGCGAGAAAGCTATTGAGATCCGGTC
AGTGGAAACAGGACATTTGGATGGAGTATTTATGCATAAGCGAGCTCAAAGGTTAAAGTTTCTATGTGAAAGAAATGATAAGGTATTTTT


Top

FusionGenePPI for SKIL_TNIK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SKILSMAD3, SMAD2, FZR1, SMAD4, SMURF2, SKIL, SKI, SNW1, RNF111, NEDD4, WWP1, ING2, NCOR1, NCOR2, SIN3A, HDAC1, RB1, TGFBR1, SMAD1, ESR1, RB1CC1, AXIN1, MAP3K7, ZZEF1, PPL, PIAS1, SRP72, SASH1, TDP2, TPM2, COL4A2, SNRNP70, PTPRF, XRCC6, NID1, GLUL, FBLN1, EEF1G, PSMC2, TFPI2, UBE2I, RNF4, EIF4G2, LRP1, CHD3, PAPPA, TDG, NID2, KRT81, GOLGB1, SNX17, SETDB1, ZBTB6, PSG3, CAMSAP1, CBX4, DHX30, CXXC5, THAP5, HIPK1, CHPF, PIAS4, ASCC3, PLCD3, SPARCL1, SVEP1, MORC4, TSKU, PYCR2, UIMC1, TRIM62, ZNF106, ZBTB3, HEYL, IL36RN, ZMYM2, USP25, FAF1, TTF2, MACF1, TRAK1, THSD7A, HEY1, PIAS3, RPS27, ZNF200, MVP, TRIM33, AES, DRG1, STK16, OIP5, VPS28, NXF3, PMLTNIKTRAF2, NEDD4, DISC1, DST, SYNE1, TNKS, SOS1, SPTBN1, MACF1, PDE4DIP, GOLGA4, SRGAP3, ANK2, TRIM2, DPYSL3, HARS, WWC1, TIAM2, TUBB2A, AKAP9, CLU, DPYSL2, NEFM, AGTPBP1, CNKSR2, NCOR2, DYNC1H1, PPP1R13B, SNX6, GSE1, ACTG1, PAFAH1B1, PPM1E, SMARCE1, NCK2, LTBR, CEP63, TMEM17, XPO1, SMURF1, EGFR, KBTBD7, IL20RA, MRPS11, UBE2A, TRAF6, MAP3K7, TAB2, IKBKB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SKIL_TNIK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SKIL_TNIK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSKILC0034069Pulmonary Fibrosis1CTD_human
HgeneSKILC0037274Dermatologic disorders1CTD_human
HgeneSKILC0311375Arsenic Poisoning1CTD_human
HgeneSKILC2931434Paraquat lung1CTD_human
TgeneTNIKC0036341Schizophrenia1PSYGENET
TgeneTNIKC0037274Dermatologic disorders1CTD_human
TgeneTNIKC0311375Arsenic Poisoning1CTD_human
TgeneTNIKC3495559Juvenile arthritis1CTD_human