FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33957

FusionGeneSummary for SKAP1_ZNF74

check button Fusion gene summary
Fusion gene informationFusion gene name: SKAP1_ZNF74
Fusion gene ID: 33957
HgeneTgene
Gene symbol

SKAP1

ZNF74

Gene ID

8631

7625

Gene namesrc kinase associated phosphoprotein 1zinc finger protein 74
SynonymsHEL-S-81p|SCAP1|SKAP55COS52|ZFP520|ZNF520|hZNF7
Cytomap

17q21.32

22q11.21

Type of geneprotein-codingprotein-coding
Descriptionsrc kinase-associated phosphoprotein 1SKAP-55epididymis secretory sperm binding protein Li 81ppp55src family-associated phosphoprotein 1src kinase-associated phosphoprotein of 55 kDazinc finger protein 74zinc finger protein 520
Modification date2018052320180522
UniProtAcc

Q86WV1

Q16587

Ensembl transtripts involved in fusion geneENST00000336915, ENST00000584924, 
ENST00000400451, ENST00000403682, 
ENST00000357502, ENST00000356671, 
ENST00000405993, 
Fusion gene scores* DoF score16 X 4 X 7=4482 X 1 X 2=4
# samples 162
** MAII scorelog2(16/448*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: SKAP1 [Title/Abstract] AND ZNF74 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSKAP1

GO:0045944

positive regulation of transcription by RNA polymerase II

11909961


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-1467-01ASKAP1chr17

46474042

-ZNF74chr22

20754922

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336915ENST00000400451SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000336915ENST00000403682SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000336915ENST00000357502SKAP1chr17

46474042

-ZNF74chr22

20754922

+
In-frameENST00000336915ENST00000356671SKAP1chr17

46474042

-ZNF74chr22

20754922

+
In-frameENST00000336915ENST00000405993SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000584924ENST00000400451SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000584924ENST00000403682SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000584924ENST00000357502SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000584924ENST00000356671SKAP1chr17

46474042

-ZNF74chr22

20754922

+
Frame-shiftENST00000584924ENST00000405993SKAP1chr17

46474042

-ZNF74chr22

20754922

+

Top

FusionProtFeatures for SKAP1_ZNF74


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SKAP1

Q86WV1

ZNF74

Q16587

Positively regulates T-cell receptor signaling byenhancing the MAP kinase pathway. Required for optimal conjugationbetween T-cells and antigen-presenting cells by promoting theclustering of integrin ITGAL on the surface of T-cells. May beinvolved in high affinity immunoglobulin epsilon receptorsignaling in mast cells. {ECO:0000269|PubMed:10856234,ECO:0000269|PubMed:11909961, ECO:0000269|PubMed:12652296,ECO:0000269|PubMed:15939789, ECO:0000269|PubMed:16980616}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+2643_11440645DomainKRAB
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+1543_11440645DomainKRAB
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+0443_11411179DomainKRAB
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+1443_11440613DomainKRAB
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26248_27040645Zinc fingerC2H2-type 1
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26276_29840645Zinc fingerC2H2-type 2
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26304_32640645Zinc fingerC2H2-type 3
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26332_35440645Zinc fingerC2H2-type 4
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26360_38240645Zinc fingerC2H2-type 5
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26388_41040645Zinc fingerC2H2-type 6
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26416_43840645Zinc fingerC2H2-type 7
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26444_46640645Zinc fingerC2H2-type 8
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26472_49440645Zinc fingerC2H2-type 9
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26500_52240645Zinc fingerC2H2-type 10
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26528_55040645Zinc fingerC2H2-type 11
TgeneZNF74chr17:46474042chr22:20754922ENST00000356671+26556_57840645Zinc fingerC2H2-type 12
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15248_27040645Zinc fingerC2H2-type 1
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15276_29840645Zinc fingerC2H2-type 2
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15304_32640645Zinc fingerC2H2-type 3
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15332_35440645Zinc fingerC2H2-type 4
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15360_38240645Zinc fingerC2H2-type 5
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15388_41040645Zinc fingerC2H2-type 6
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15416_43840645Zinc fingerC2H2-type 7
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15444_46640645Zinc fingerC2H2-type 8
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15472_49440645Zinc fingerC2H2-type 9
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15500_52240645Zinc fingerC2H2-type 10
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15528_55040645Zinc fingerC2H2-type 11
TgeneZNF74chr17:46474042chr22:20754922ENST00000400451+15556_57840645Zinc fingerC2H2-type 12
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04248_27011179Zinc fingerC2H2-type 1
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04276_29811179Zinc fingerC2H2-type 2
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04304_32611179Zinc fingerC2H2-type 3
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04332_35411179Zinc fingerC2H2-type 4
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04360_38211179Zinc fingerC2H2-type 5
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04388_41011179Zinc fingerC2H2-type 6
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04416_43811179Zinc fingerC2H2-type 7
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04444_46611179Zinc fingerC2H2-type 8
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04472_49411179Zinc fingerC2H2-type 9
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04500_52211179Zinc fingerC2H2-type 10
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04528_55011179Zinc fingerC2H2-type 11
TgeneZNF74chr17:46474042chr22:20754922ENST00000403682+04556_57811179Zinc fingerC2H2-type 12
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14248_27040613Zinc fingerC2H2-type 1
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14276_29840613Zinc fingerC2H2-type 2
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14304_32640613Zinc fingerC2H2-type 3
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14332_35440613Zinc fingerC2H2-type 4
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14360_38240613Zinc fingerC2H2-type 5
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14388_41040613Zinc fingerC2H2-type 6
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14416_43840613Zinc fingerC2H2-type 7
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14444_46640613Zinc fingerC2H2-type 8
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14472_49440613Zinc fingerC2H2-type 9
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14500_52240613Zinc fingerC2H2-type 10
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14528_55040613Zinc fingerC2H2-type 11
TgeneZNF74chr17:46474042chr22:20754922ENST00000405993+14556_57840613Zinc fingerC2H2-type 12

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSKAP1chr17:46474042chr22:20754922ENST00000336915-213220_23050448Compositional biasNote=Poly-Glu
HgeneSKAP1chr17:46474042chr22:20754922ENST00000584924-212220_23050360Compositional biasNote=Poly-Glu
HgeneSKAP1chr17:46474042chr22:20754922ENST00000336915-213107_21050448DomainPH
HgeneSKAP1chr17:46474042chr22:20754922ENST00000336915-213294_35550448DomainSH3
HgeneSKAP1chr17:46474042chr22:20754922ENST00000584924-212107_21050360DomainPH
HgeneSKAP1chr17:46474042chr22:20754922ENST00000584924-212294_35550360DomainSH3


Top

FusionGeneSequence for SKAP1_ZNF74


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000400451_chr22_20754922_+_655aa
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARNRXVSRMWLWTSPRRSGVNXTPLRGPCTGMXCWRTTRTF
LPXDLHCTSQMXSLIWNEARSHGACRGKSPEGPVQNGSXRRCPLNSRAFAKKNRPRSPSWSGPSAGRRRGGARQVLCRGVRLRPGRPHLP
WSGTSLXRNSPSGVPSSPSNAFPRGDPCWTHARTSRPLRAEPRPPRDCVQGKTPPRQVSQKSSPRCAGSAGRAPGRASSCAASAGRRSAR
APPSRCTGAGTAGRRLTSAMNAARPSPGAPTFWSTGASTPARSPSSAASAGRPSAATRPSTCTSASTRASGPTSAAPARRPSAAARCSAC
TCGCTPARSPTGAASAARPSTSVHTSHATTASTRARSPTSAAPAARPSPATHPSPCMRRSTAGTSRSSAATARRPSTAARASPSTRGRTR
ARSPSSAPTAGRASAATRTCSCTGASTAARSPSSATSAAKPSAPTPTSSCTGASTQARSPSTAASVGRPSAATRPSSCTSASTPVRSPTS
AASAAEPSARTTVSLNIRKSTPGRSRLSVRNVGRCSTGARTSLSTRGCTARGSPWPSSSTNTCSAHTTCLAACWVQGMLDXGTWIPSTRW

>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000356671_chr22_20754922_+_655aa
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARNRXVSRMWLWTSPRRSGVNXTPLRGPCTGMXCWRTTRTF
LPXDLHCTSQMXSLIWNEARSHGACRGKSPEGPVQNGSXRRCPLNSRAFAKKNRPRSPSWSGPSAGRRRGGARQVLCRGVRLRPGRPHLP
WSGTSLXRNSPSGVPSSPSNAFPRGDPCWTHARTSRPLRAEPRPPRDCVQGKTPPRQVSQKSSPRCAGSAGRAPGRASSCAASAGRRSAR
APPSRCTGAGTAGRRLTSAMNAARPSPGAPTFWSTGASTPARSPSSAASAGRPSAATRPSTCTSASTRASGPTSAAPARRPSAAARCSAC
TCGCTPARSPTGAASAARPSTSVHTSHATTASTRARSPTSAAPAARPSPATHPSPCMRRSTAGTSRSSAATARRPSTAARASPSTRGRTR
ARSPSSAPTAGRASAATRTCSCTGASTAARSPSSATSAAKPSAPTPTSSCTGASTQARSPSTAASVGRPSAATRPSSCTSASTPVRSPTS
AASAAEPSARTTVSLNIRKSTPGRSRLSVRNVGRCSTGARTSLSTRGCTARGSPWPSSSTNTCSAHTTCLAACWVQGMLDXGTWIPSTRW

>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000405993_chr22_20754922_+_623aa
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARNRXVSRMWLWTSPRRSGVNXTPLRGPCTGMXCWRTTRTF
LPXNGSXRRCPLNSRAFAKKNRPRSPSWSGPSAGRRRGGARQVLCRGVRLRPGRPHLPWSGTSLXRNSPSGVPSSPSNAFPRGDPCWTHA
RTSRPLRAEPRPPRDCVQGKTPPRQVSQKSSPRCAGSAGRAPGRASSCAASAGRRSARAPPSRCTGAGTAGRRLTSAMNAARPSPGAPTF
WSTGASTPARSPSSAASAGRPSAATRPSTCTSASTRASGPTSAAPARRPSAAARCSACTCGCTPARSPTGAASAARPSTSVHTSHATTAS
TRARSPTSAAPAARPSPATHPSPCMRRSTAGTSRSSAATARRPSTAARASPSTRGRTRARSPSSAPTAGRASAATRTCSCTGASTAARSP
SSATSAAKPSAPTPTSSCTGASTQARSPSTAASVGRPSAATRPSSCTSASTPVRSPTSAASAAEPSARTTVSLNIRKSTPGRSRLSVRNV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000400451_chr22_20754922_+_1967nt
ATGCAGGCCGCCGCCCTCCCTGAGGAGATCCGTTGGCTCCTGGAAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTC
AGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGAATCGGTGAGTTTCAAGGATGTGGCTG
TGGACTTCACCCAGGAGGAGTGGGGTCAACTAGACTCCCCTCAGAGGGCCTTGTACCGGGATGTGATGTTGGAGAACTACCAGAACCTTC
TTGCCCTAGGACCTCCACTGCACAAGCCAGATGTGATCTCTCATCTGGAACGAGGCGAGGAGCCATGGAGCATGCAGAGGGAAGTCCCCA
GAGGGCCCTGTCCAGAATGGGAGCTGAAGGCGGTGCCCTCTCAACAGCAGGGCATTTGCAAAGAAGAACCGGCCCAGGAGCCCATCATGG
AGCGGCCCCTCGGCGGGGCGCAGGCGTGGGGGCGCCAGGCAGGTGCTCTGCAGAGGAGTCAGGCTGCGCCCTGGGCGCCCGCACCTGCCA
TGGTCTGGGACGTCCCTGTAGAGGAATTCCCCCTCAGGTGTCCCCTCTTCGCCCAGCAACGCGTTCCCGAGGGGGGACCCTTGCTGGACA
CACGCAAGAACGTCCAGGCCACTGAGGGCAGAACCAAGGCCCCCGCGAGACTGTGTGCAGGGGAAAACGCCTCCACGCCAAGTGAGCCAG
AAAAGTTCCCCCAGGTGCGCCGGCAGCGCGGGGCGGGCGCCGGGGAGGGCGAGTTCGTGTGCGGCGAGTGCGGGAAGGCGTTCCGCCAGA
GCTCCTCCCTCACGCTGCACCGGCGCTGGCACAGCCGGGAGAAGGCTTACAAGTGCGATGAATGCGGCAAGGCCTTCACCTGGAGCACCA
ACCTTCTGGAGCACCGGCGCATCCACACCGGCGAGAAGCCCTTCTTCTGCGGCGAGTGCGGGAAGGCCTTCAGCTGCCACTCGTCCCTCA
ACGTGCACCAGCGCATCCACACGGGCGAGCGGCCCTACAAGTGCAGCGCCTGCGAGAAGGCCTTCAGCTGCAGCTCGCTGCTCAGCATGC
ACCTGCGGGTGCACACCGGCGAGAAGCCCTACCGGTGCGGCGAGTGCGGCAAGGCCTTCAACCAGCGTACACACCTCACACGCCACCACC
GCATCCACACGGGCGAGAAGCCCTACCAGTGCGGCTCCTGCGGCAAGGCCTTCACCTGCCACTCATCCCTCACCGTGCATGAGAAGATCC
ACAGCGGGGACAAGCCGTTCAAGTGCAGCGACTGCGAGAAGGCCTTCAACAGCCGCTCGCGCCTCACCCTCCACCAGAGGACGCACACGG
GCGAGAAGCCCTTCAAGTGCGCCGACTGCGGGAAGGGCTTCAGCTGCCACGCGTACCTGCTCGTGCACCGGCGCATCCACAGCGGCGAGA
AGCCCTTCAAGTGCAACGAGTGCGGCAAAGCCTTCAGCTCCCACGCCTACCTCATCGTGCACCGGCGCATCCACACAGGCGAGAAGCCCT
TCGACTGCAGCCAGTGTTGGAAGGCCTTCAGCTGCCACTCGTCCCTCATCGTGCACCAGCGCATCCACACCGGTGAGAAGCCCTACAAGT
GCAGCGAGTGCGGCAGAGCCTTCAGCCAGAACCACTGTCTCATTAAACATCAGAAAATCCACTCCGGGGAGAAGTCGTTTAAGTGTGAGA
AATGTGGGGAGATGTTCAACTGGAGCTCGCACCTCACTGAGCACCAGAGGCTGCACAGCGAGGGGAAGCCCTTGGCCATCCAGTTCAACA
AACACCTGCTCAGCACATACTACGTGCCTGGCAGCCTGCTGGGTGCAGGGGATGCTGGACTGAGGGACGTGGATCCCATCGACGCGCTGG

>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000356671_chr22_20754922_+_1967nt
ATGCAGGCCGCCGCCCTCCCTGAGGAGATCCGTTGGCTCCTGGAAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTC
AGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGAATCGGTGAGTTTCAAGGATGTGGCTG
TGGACTTCACCCAGGAGGAGTGGGGTCAACTAGACTCCCCTCAGAGGGCCTTGTACCGGGATGTGATGTTGGAGAACTACCAGAACCTTC
TTGCCCTAGGACCTCCACTGCACAAGCCAGATGTGATCTCTCATCTGGAACGAGGCGAGGAGCCATGGAGCATGCAGAGGGAAGTCCCCA
GAGGGCCCTGTCCAGAATGGGAGCTGAAGGCGGTGCCCTCTCAACAGCAGGGCATTTGCAAAGAAGAACCGGCCCAGGAGCCCATCATGG
AGCGGCCCCTCGGCGGGGCGCAGGCGTGGGGGCGCCAGGCAGGTGCTCTGCAGAGGAGTCAGGCTGCGCCCTGGGCGCCCGCACCTGCCA
TGGTCTGGGACGTCCCTGTAGAGGAATTCCCCCTCAGGTGTCCCCTCTTCGCCCAGCAACGCGTTCCCGAGGGGGGACCCTTGCTGGACA
CACGCAAGAACGTCCAGGCCACTGAGGGCAGAACCAAGGCCCCCGCGAGACTGTGTGCAGGGGAAAACGCCTCCACGCCAAGTGAGCCAG
AAAAGTTCCCCCAGGTGCGCCGGCAGCGCGGGGCGGGCGCCGGGGAGGGCGAGTTCGTGTGCGGCGAGTGCGGGAAGGCGTTCCGCCAGA
GCTCCTCCCTCACGCTGCACCGGCGCTGGCACAGCCGGGAGAAGGCTTACAAGTGCGATGAATGCGGCAAGGCCTTCACCTGGAGCACCA
ACCTTCTGGAGCACCGGCGCATCCACACCGGCGAGAAGCCCTTCTTCTGCGGCGAGTGCGGGAAGGCCTTCAGCTGCCACTCGTCCCTCA
ACGTGCACCAGCGCATCCACACGGGCGAGCGGCCCTACAAGTGCAGCGCCTGCGAGAAGGCCTTCAGCTGCAGCTCGCTGCTCAGCATGC
ACCTGCGGGTGCACACCGGCGAGAAGCCCTACCGGTGCGGCGAGTGCGGCAAGGCCTTCAACCAGCGTACACACCTCACACGCCACCACC
GCATCCACACGGGCGAGAAGCCCTACCAGTGCGGCTCCTGCGGCAAGGCCTTCACCTGCCACTCATCCCTCACCGTGCATGAGAAGATCC
ACAGCGGGGACAAGCCGTTCAAGTGCAGCGACTGCGAGAAGGCCTTCAACAGCCGCTCGCGCCTCACCCTCCACCAGAGGACGCACACGG
GCGAGAAGCCCTTCAAGTGCGCCGACTGCGGGAAGGGCTTCAGCTGCCACGCGTACCTGCTCGTGCACCGGCGCATCCACAGCGGCGAGA
AGCCCTTCAAGTGCAACGAGTGCGGCAAAGCCTTCAGCTCCCACGCCTACCTCATCGTGCACCGGCGCATCCACACAGGCGAGAAGCCCT
TCGACTGCAGCCAGTGTTGGAAGGCCTTCAGCTGCCACTCGTCCCTCATCGTGCACCAGCGCATCCACACCGGTGAGAAGCCCTACAAGT
GCAGCGAGTGCGGCAGAGCCTTCAGCCAGAACCACTGTCTCATTAAACATCAGAAAATCCACTCCGGGGAGAAGTCGTTTAAGTGTGAGA
AATGTGGGGAGATGTTCAACTGGAGCTCGCACCTCACTGAGCACCAGAGGCTGCACAGCGAGGGGAAGCCCTTGGCCATCCAGTTCAACA
AACACCTGCTCAGCACATACTACGTGCCTGGCAGCCTGCTGGGTGCAGGGGATGCTGGACTGAGGGACGTGGATCCCATCGACGCGCTGG

>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000405993_chr22_20754922_+_1871nt
ATGCAGGCCGCCGCCCTCCCTGAGGAGATCCGTTGGCTCCTGGAAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTC
AGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGAATCGGTGAGTTTCAAGGATGTGGCTG
TGGACTTCACCCAGGAGGAGTGGGGTCAACTAGACTCCCCTCAGAGGGCCTTGTACCGGGATGTGATGTTGGAGAACTACCAGAACCTTC
TTGCCCTAGAATGGGAGCTGAAGGCGGTGCCCTCTCAACAGCAGGGCATTTGCAAAGAAGAACCGGCCCAGGAGCCCATCATGGAGCGGC
CCCTCGGCGGGGCGCAGGCGTGGGGGCGCCAGGCAGGTGCTCTGCAGAGGAGTCAGGCTGCGCCCTGGGCGCCCGCACCTGCCATGGTCT
GGGACGTCCCTGTAGAGGAATTCCCCCTCAGGTGTCCCCTCTTCGCCCAGCAACGCGTTCCCGAGGGGGGACCCTTGCTGGACACACGCA
AGAACGTCCAGGCCACTGAGGGCAGAACCAAGGCCCCCGCGAGACTGTGTGCAGGGGAAAACGCCTCCACGCCAAGTGAGCCAGAAAAGT
TCCCCCAGGTGCGCCGGCAGCGCGGGGCGGGCGCCGGGGAGGGCGAGTTCGTGTGCGGCGAGTGCGGGAAGGCGTTCCGCCAGAGCTCCT
CCCTCACGCTGCACCGGCGCTGGCACAGCCGGGAGAAGGCTTACAAGTGCGATGAATGCGGCAAGGCCTTCACCTGGAGCACCAACCTTC
TGGAGCACCGGCGCATCCACACCGGCGAGAAGCCCTTCTTCTGCGGCGAGTGCGGGAAGGCCTTCAGCTGCCACTCGTCCCTCAACGTGC
ACCAGCGCATCCACACGGGCGAGCGGCCCTACAAGTGCAGCGCCTGCGAGAAGGCCTTCAGCTGCAGCTCGCTGCTCAGCATGCACCTGC
GGGTGCACACCGGCGAGAAGCCCTACCGGTGCGGCGAGTGCGGCAAGGCCTTCAACCAGCGTACACACCTCACACGCCACCACCGCATCC
ACACGGGCGAGAAGCCCTACCAGTGCGGCTCCTGCGGCAAGGCCTTCACCTGCCACTCATCCCTCACCGTGCATGAGAAGATCCACAGCG
GGGACAAGCCGTTCAAGTGCAGCGACTGCGAGAAGGCCTTCAACAGCCGCTCGCGCCTCACCCTCCACCAGAGGACGCACACGGGCGAGA
AGCCCTTCAAGTGCGCCGACTGCGGGAAGGGCTTCAGCTGCCACGCGTACCTGCTCGTGCACCGGCGCATCCACAGCGGCGAGAAGCCCT
TCAAGTGCAACGAGTGCGGCAAAGCCTTCAGCTCCCACGCCTACCTCATCGTGCACCGGCGCATCCACACAGGCGAGAAGCCCTTCGACT
GCAGCCAGTGTTGGAAGGCCTTCAGCTGCCACTCGTCCCTCATCGTGCACCAGCGCATCCACACCGGTGAGAAGCCCTACAAGTGCAGCG
AGTGCGGCAGAGCCTTCAGCCAGAACCACTGTCTCATTAAACATCAGAAAATCCACTCCGGGGAGAAGTCGTTTAAGTGTGAGAAATGTG
GGGAGATGTTCAACTGGAGCTCGCACCTCACTGAGCACCAGAGGCTGCACAGCGAGGGGAAGCCCTTGGCCATCCAGTTCAACAAACACC
TGCTCAGCACATACTACGTGCCTGGCAGCCTGCTGGGTGCAGGGGATGCTGGACTGAGGGACGTGGATCCCATCGACGCGCTGGATGTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000400451_chr22_20754922_+_2747nt
GTCGCCTTCCAGCCCGTCCGCCTCCCGACCAGGGCCCGCGCCCCGTCCCGCCTCTCTCCCGCCCAGCCAAATGCAGGCCGCCGCCCTCCC
TGAGGAGATCCGTTGGCTCCTGGAAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCA
CAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGAATCGGTGAGTTTCAAGGATGTGGCTGTGGACTTCACCCAGGAGGAG
TGGGGTCAACTAGACTCCCCTCAGAGGGCCTTGTACCGGGATGTGATGTTGGAGAACTACCAGAACCTTCTTGCCCTAGGACCTCCACTG
CACAAGCCAGATGTGATCTCTCATCTGGAACGAGGCGAGGAGCCATGGAGCATGCAGAGGGAAGTCCCCAGAGGGCCCTGTCCAGAATGG
GAGCTGAAGGCGGTGCCCTCTCAACAGCAGGGCATTTGCAAAGAAGAACCGGCCCAGGAGCCCATCATGGAGCGGCCCCTCGGCGGGGCG
CAGGCGTGGGGGCGCCAGGCAGGTGCTCTGCAGAGGAGTCAGGCTGCGCCCTGGGCGCCCGCACCTGCCATGGTCTGGGACGTCCCTGTA
GAGGAATTCCCCCTCAGGTGTCCCCTCTTCGCCCAGCAACGCGTTCCCGAGGGGGGACCCTTGCTGGACACACGCAAGAACGTCCAGGCC
ACTGAGGGCAGAACCAAGGCCCCCGCGAGACTGTGTGCAGGGGAAAACGCCTCCACGCCAAGTGAGCCAGAAAAGTTCCCCCAGGTGCGC
CGGCAGCGCGGGGCGGGCGCCGGGGAGGGCGAGTTCGTGTGCGGCGAGTGCGGGAAGGCGTTCCGCCAGAGCTCCTCCCTCACGCTGCAC
CGGCGCTGGCACAGCCGGGAGAAGGCTTACAAGTGCGATGAATGCGGCAAGGCCTTCACCTGGAGCACCAACCTTCTGGAGCACCGGCGC
ATCCACACCGGCGAGAAGCCCTTCTTCTGCGGCGAGTGCGGGAAGGCCTTCAGCTGCCACTCGTCCCTCAACGTGCACCAGCGCATCCAC
ACGGGCGAGCGGCCCTACAAGTGCAGCGCCTGCGAGAAGGCCTTCAGCTGCAGCTCGCTGCTCAGCATGCACCTGCGGGTGCACACCGGC
GAGAAGCCCTACCGGTGCGGCGAGTGCGGCAAGGCCTTCAACCAGCGTACACACCTCACACGCCACCACCGCATCCACACGGGCGAGAAG
CCCTACCAGTGCGGCTCCTGCGGCAAGGCCTTCACCTGCCACTCATCCCTCACCGTGCATGAGAAGATCCACAGCGGGGACAAGCCGTTC
AAGTGCAGCGACTGCGAGAAGGCCTTCAACAGCCGCTCGCGCCTCACCCTCCACCAGAGGACGCACACGGGCGAGAAGCCCTTCAAGTGC
GCCGACTGCGGGAAGGGCTTCAGCTGCCACGCGTACCTGCTCGTGCACCGGCGCATCCACAGCGGCGAGAAGCCCTTCAAGTGCAACGAG
TGCGGCAAAGCCTTCAGCTCCCACGCCTACCTCATCGTGCACCGGCGCATCCACACAGGCGAGAAGCCCTTCGACTGCAGCCAGTGTTGG
AAGGCCTTCAGCTGCCACTCGTCCCTCATCGTGCACCAGCGCATCCACACCGGTGAGAAGCCCTACAAGTGCAGCGAGTGCGGCAGAGCC
TTCAGCCAGAACCACTGTCTCATTAAACATCAGAAAATCCACTCCGGGGAGAAGTCGTTTAAGTGTGAGAAATGTGGGGAGATGTTCAAC
TGGAGCTCGCACCTCACTGAGCACCAGAGGCTGCACAGCGAGGGGAAGCCCTTGGCCATCCAGTTCAACAAACACCTGCTCAGCACATAC
TACGTGCCTGGCAGCCTGCTGGGTGCAGGGGATGCTGGACTGAGGGACGTGGATCCCATCGACGCGCTGGATGTGGCAAAGCTCTTGTGC
GTGGTTCCCCCCAGAGCTGGCAGGAATTTCTCCCTGGGGAGCAAACCTCGAAACTAACATGATGTGCTTTGGTGTCAGTAGCTGCTTTCT
GAGCTACTCAACAAGGAAAGCACCCTGGTCCTCCCTGGCTCCTAGATCCAGACCACCTTCCTCCAGGTGTGGGAGCCTTGCCTTATCACC
CCCATCAGGTCTGCATGCCAGGGTGCCTCCTCTAGTTAAAGTCAGTCACCTCCCCAGAAGGGCCACACTCCAGGAGGAGTGTTGAGAGTC
ATTTGAGGTAGTCTTGCCACCTGTTTTCCTTGATGGGCCTGGAAGTTGTTGACAAGGGGAAAGATCTTTCTTGCCAATAAAAAGAAGGGA
TATCGTTGGGTGCCATGGCTCACACCTGTAATCTTAACACTGTGGGAGGCCAAGGCAAGGGGATCACTTGAGCCCAGGAGTCTAGGACCA
GCCTGGACAACATGGTGAGACCTCGTCTCTACAAAAAATGCAAAAATTAGCCAGATGTGGCGGCATGTCCCTGTGGTCCCAGCTACTCAG
GAGGCTGAGGTGGGAGGATCATTTGAGCCTAGGAGGTCAAGGCTGCAGTGAGCCATGATTCACAGCACTGCACTGCAGCCTGGGTGACAA
AGCAAGACCCTGTGTGAAATTAAAAGGAGGTATATCAACTGTTGTATCCTCGGACGGGCTCCTGACACGGCTTTAATCAGGAGTTTCCTC

>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000356671_chr22_20754922_+_2393nt
GTCGCCTTCCAGCCCGTCCGCCTCCCGACCAGGGCCCGCGCCCCGTCCCGCCTCTCTCCCGCCCAGCCAAATGCAGGCCGCCGCCCTCCC
TGAGGAGATCCGTTGGCTCCTGGAAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCA
CAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGAATCGGTGAGTTTCAAGGATGTGGCTGTGGACTTCACCCAGGAGGAG
TGGGGTCAACTAGACTCCCCTCAGAGGGCCTTGTACCGGGATGTGATGTTGGAGAACTACCAGAACCTTCTTGCCCTAGGACCTCCACTG
CACAAGCCAGATGTGATCTCTCATCTGGAACGAGGCGAGGAGCCATGGAGCATGCAGAGGGAAGTCCCCAGAGGGCCCTGTCCAGAATGG
GAGCTGAAGGCGGTGCCCTCTCAACAGCAGGGCATTTGCAAAGAAGAACCGGCCCAGGAGCCCATCATGGAGCGGCCCCTCGGCGGGGCG
CAGGCGTGGGGGCGCCAGGCAGGTGCTCTGCAGAGGAGTCAGGCTGCGCCCTGGGCGCCCGCACCTGCCATGGTCTGGGACGTCCCTGTA
GAGGAATTCCCCCTCAGGTGTCCCCTCTTCGCCCAGCAACGCGTTCCCGAGGGGGGACCCTTGCTGGACACACGCAAGAACGTCCAGGCC
ACTGAGGGCAGAACCAAGGCCCCCGCGAGACTGTGTGCAGGGGAAAACGCCTCCACGCCAAGTGAGCCAGAAAAGTTCCCCCAGGTGCGC
CGGCAGCGCGGGGCGGGCGCCGGGGAGGGCGAGTTCGTGTGCGGCGAGTGCGGGAAGGCGTTCCGCCAGAGCTCCTCCCTCACGCTGCAC
CGGCGCTGGCACAGCCGGGAGAAGGCTTACAAGTGCGATGAATGCGGCAAGGCCTTCACCTGGAGCACCAACCTTCTGGAGCACCGGCGC
ATCCACACCGGCGAGAAGCCCTTCTTCTGCGGCGAGTGCGGGAAGGCCTTCAGCTGCCACTCGTCCCTCAACGTGCACCAGCGCATCCAC
ACGGGCGAGCGGCCCTACAAGTGCAGCGCCTGCGAGAAGGCCTTCAGCTGCAGCTCGCTGCTCAGCATGCACCTGCGGGTGCACACCGGC
GAGAAGCCCTACCGGTGCGGCGAGTGCGGCAAGGCCTTCAACCAGCGTACACACCTCACACGCCACCACCGCATCCACACGGGCGAGAAG
CCCTACCAGTGCGGCTCCTGCGGCAAGGCCTTCACCTGCCACTCATCCCTCACCGTGCATGAGAAGATCCACAGCGGGGACAAGCCGTTC
AAGTGCAGCGACTGCGAGAAGGCCTTCAACAGCCGCTCGCGCCTCACCCTCCACCAGAGGACGCACACGGGCGAGAAGCCCTTCAAGTGC
GCCGACTGCGGGAAGGGCTTCAGCTGCCACGCGTACCTGCTCGTGCACCGGCGCATCCACAGCGGCGAGAAGCCCTTCAAGTGCAACGAG
TGCGGCAAAGCCTTCAGCTCCCACGCCTACCTCATCGTGCACCGGCGCATCCACACAGGCGAGAAGCCCTTCGACTGCAGCCAGTGTTGG
AAGGCCTTCAGCTGCCACTCGTCCCTCATCGTGCACCAGCGCATCCACACCGGTGAGAAGCCCTACAAGTGCAGCGAGTGCGGCAGAGCC
TTCAGCCAGAACCACTGTCTCATTAAACATCAGAAAATCCACTCCGGGGAGAAGTCGTTTAAGTGTGAGAAATGTGGGGAGATGTTCAAC
TGGAGCTCGCACCTCACTGAGCACCAGAGGCTGCACAGCGAGGGGAAGCCCTTGGCCATCCAGTTCAACAAACACCTGCTCAGCACATAC
TACGTGCCTGGCAGCCTGCTGGGTGCAGGGGATGCTGGACTGAGGGACGTGGATCCCATCGACGCGCTGGATGTGGCAAAGCTCTTGTGC
GTGGTTCCCCCCAGAGCTGGCAGGAATTTCTCCCTGGGGAGCAAACCTCGAAACTAACATGATGTGCTTTGGTGTCAGTAGCTGCTTTCT
GAGCTACTCAACAAGGAAAGCACCCTGGTCCTCCCTGGCTCCTAGATCCAGACCACCTTCCTCCAGGTGTGGGAGCCTTGCCTTATCACC
CCCATCAGGTCTGCATGCCAGGGTGCCTCCTCTAGTTAAAGTCAGTCACCTCCCCAGAAGGGCCACACTCCAGGAGGAGTGTTGAGAGTC
ATTTGAGGTAGTCTTGCCACCTGTTTTCCTTGATGGGCCTGGAAGTTGTTGACAAGGGGAAAGATCTTTCTTGCCAATAAAAAGAAGGGA

>In-frame_SKAP1_ENST00000336915_chr17_46474042_-_ZNF74_ENST00000405993_chr22_20754922_+_1941nt
GTCGCCTTCCAGCCCGTCCGCCTCCCGACCAGGGCCCGCGCCCCGTCCCGCCTCTCTCCCGCCCAGCCAAATGCAGGCCGCCGCCCTCCC
TGAGGAGATCCGTTGGCTCCTGGAAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCA
CAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGAATCGGTGAGTTTCAAGGATGTGGCTGTGGACTTCACCCAGGAGGAG
TGGGGTCAACTAGACTCCCCTCAGAGGGCCTTGTACCGGGATGTGATGTTGGAGAACTACCAGAACCTTCTTGCCCTAGAATGGGAGCTG
AAGGCGGTGCCCTCTCAACAGCAGGGCATTTGCAAAGAAGAACCGGCCCAGGAGCCCATCATGGAGCGGCCCCTCGGCGGGGCGCAGGCG
TGGGGGCGCCAGGCAGGTGCTCTGCAGAGGAGTCAGGCTGCGCCCTGGGCGCCCGCACCTGCCATGGTCTGGGACGTCCCTGTAGAGGAA
TTCCCCCTCAGGTGTCCCCTCTTCGCCCAGCAACGCGTTCCCGAGGGGGGACCCTTGCTGGACACACGCAAGAACGTCCAGGCCACTGAG
GGCAGAACCAAGGCCCCCGCGAGACTGTGTGCAGGGGAAAACGCCTCCACGCCAAGTGAGCCAGAAAAGTTCCCCCAGGTGCGCCGGCAG
CGCGGGGCGGGCGCCGGGGAGGGCGAGTTCGTGTGCGGCGAGTGCGGGAAGGCGTTCCGCCAGAGCTCCTCCCTCACGCTGCACCGGCGC
TGGCACAGCCGGGAGAAGGCTTACAAGTGCGATGAATGCGGCAAGGCCTTCACCTGGAGCACCAACCTTCTGGAGCACCGGCGCATCCAC
ACCGGCGAGAAGCCCTTCTTCTGCGGCGAGTGCGGGAAGGCCTTCAGCTGCCACTCGTCCCTCAACGTGCACCAGCGCATCCACACGGGC
GAGCGGCCCTACAAGTGCAGCGCCTGCGAGAAGGCCTTCAGCTGCAGCTCGCTGCTCAGCATGCACCTGCGGGTGCACACCGGCGAGAAG
CCCTACCGGTGCGGCGAGTGCGGCAAGGCCTTCAACCAGCGTACACACCTCACACGCCACCACCGCATCCACACGGGCGAGAAGCCCTAC
CAGTGCGGCTCCTGCGGCAAGGCCTTCACCTGCCACTCATCCCTCACCGTGCATGAGAAGATCCACAGCGGGGACAAGCCGTTCAAGTGC
AGCGACTGCGAGAAGGCCTTCAACAGCCGCTCGCGCCTCACCCTCCACCAGAGGACGCACACGGGCGAGAAGCCCTTCAAGTGCGCCGAC
TGCGGGAAGGGCTTCAGCTGCCACGCGTACCTGCTCGTGCACCGGCGCATCCACAGCGGCGAGAAGCCCTTCAAGTGCAACGAGTGCGGC
AAAGCCTTCAGCTCCCACGCCTACCTCATCGTGCACCGGCGCATCCACACAGGCGAGAAGCCCTTCGACTGCAGCCAGTGTTGGAAGGCC
TTCAGCTGCCACTCGTCCCTCATCGTGCACCAGCGCATCCACACCGGTGAGAAGCCCTACAAGTGCAGCGAGTGCGGCAGAGCCTTCAGC
CAGAACCACTGTCTCATTAAACATCAGAAAATCCACTCCGGGGAGAAGTCGTTTAAGTGTGAGAAATGTGGGGAGATGTTCAACTGGAGC
TCGCACCTCACTGAGCACCAGAGGCTGCACAGCGAGGGGAAGCCCTTGGCCATCCAGTTCAACAAACACCTGCTCAGCACATACTACGTG
CCTGGCAGCCTGCTGGGTGCAGGGGATGCTGGACTGAGGGACGTGGATCCCATCGACGCGCTGGATGTGGCAAAGCTCTTGTGCGTGGTT


Top

FusionGenePPI for SKAP1_ZNF74


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SKAP1PTPRC, FYB, SRC, LYN, FYN, LCK, SKAP1, GRB2, APP, BLCAP, SH2D4A, PRAM1, FAM102A, AP3M1, MYO9B, MYO9A, POLR1B, LOC81691, EML3, WRN, ASPM, JPH1, POLR1A, POLR3A, RECQL4, HPS3, ZNF324, FAM208A, UXT, NCAPD3, MYCBP2, CUL2, PIP5K1A, NEK1, PLEKHH3, PHLDB3, PIK3C3, SEC63, SKAP2, GTF3C1, URI1, PIK3R2, PIK3R3, POLRMT, PLD2, UCKL1, PRR14L, KSR1, ZNHIT6, PDRG1, SETX, NEFL, ALMS1, APPBP2, DDX11L8, UTP15, SENP5, NCAPH2, PAX3, TBL2, ZNHIT2, ZNF644, SUGCT, PKN3, TTF2, PPHLN1, NPHP4, MTMR1, PKN2, C21orf2, POLA1, POLR3B, POLR2L, CCP110, SETD5, ELP3, DOCK7, USP54, POLR1E, TRMT44, POLR1D, EXPH5, NEK4, ATXN2, SBF1, GTPBP6, TRMT1, CD3EAP, PER1, SUPT6H, MCM8, RTEL1, TIGD5, PUSL1, KLHDC3, DYNLL2, MAP7D1ZNF74TRIM28, POLR2A, HSP90AA1, VWCE


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSKAP1chr17:46474042chr22:20754922ENST00000336915-213290_29550448FYB1
HgeneSKAP1chr17:46474042chr22:20754922ENST00000584924-212290_29550360FYB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SKAP1_ZNF74


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SKAP1_ZNF74


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSKAP1C0919267ovarian neoplasm1CTD_human
TgeneZNF74C0036341Schizophrenia1PSYGENET