FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33872

FusionGeneSummary for SIL1_SLC23A1

check button Fusion gene summary
Fusion gene informationFusion gene name: SIL1_SLC23A1
Fusion gene ID: 33872
HgeneTgene
Gene symbol

SIL1

SLC23A1

Gene ID

64374

9963

Gene nameSIL1 nucleotide exchange factorsolute carrier family 23 member 1
SynonymsBAP|MSS|ULG5SLC23A2|SVCT1|YSPL3
Cytomap

5q31.2

5q31.2

Type of geneprotein-codingprotein-coding
Descriptionnucleotide exchange factor SIL1BiP-associated proteinSIL1 homolog, endoplasmic reticulum chaperoneSIL1-like protein endoplasmic reticulum chaperonesolute carrier family 23 member 1Na(+)/L-ascorbic acid transporter 1hSVCT1sodium-dependent vitamin C transporter-1solute carrier family 23 (ascorbic acid transporter), member 1solute carrier family 23 (nucleobase transporters), member 1solute carrie
Modification date2018052320180523
UniProtAcc

Q9H173

Q9UHI7

Ensembl transtripts involved in fusion geneENST00000394817, ENST00000265195, 
ENST00000509534, ENST00000515008, 
ENST00000353963, ENST00000348729, 
ENST00000503919, 
Fusion gene scores* DoF score6 X 4 X 5=1202 X 2 X 2=8
# samples 72
** MAII scorelog2(7/120*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: SIL1 [Title/Abstract] AND SLC23A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSLC23A1

GO:0006814

sodium ion transport

18094143

TgeneSLC23A1

GO:0009636

response to toxic substance

17575980

TgeneSLC23A1

GO:0015882

L-ascorbic acid transmembrane transport

10631088|11895172|18247577|18417304|19216494

TgeneSLC23A1

GO:0070904

transepithelial L-ascorbic acid transport

18417304


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-2E-A9G8-01ASIL1chr5

138456724

-SLC23A1chr5

138716575

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394817ENST00000353963SIL1chr5

138456724

-SLC23A1chr5

138716575

-
In-frameENST00000394817ENST00000348729SIL1chr5

138456724

-SLC23A1chr5

138716575

-
5CDS-5UTRENST00000394817ENST00000503919SIL1chr5

138456724

-SLC23A1chr5

138716575

-
Frame-shiftENST00000265195ENST00000353963SIL1chr5

138456724

-SLC23A1chr5

138716575

-
Frame-shiftENST00000265195ENST00000348729SIL1chr5

138456724

-SLC23A1chr5

138716575

-
5CDS-5UTRENST00000265195ENST00000503919SIL1chr5

138456724

-SLC23A1chr5

138716575

-
Frame-shiftENST00000509534ENST00000353963SIL1chr5

138456724

-SLC23A1chr5

138716575

-
Frame-shiftENST00000509534ENST00000348729SIL1chr5

138456724

-SLC23A1chr5

138716575

-
5CDS-5UTRENST00000509534ENST00000503919SIL1chr5

138456724

-SLC23A1chr5

138716575

-
intron-3CDSENST00000515008ENST00000353963SIL1chr5

138456724

-SLC23A1chr5

138716575

-
intron-3CDSENST00000515008ENST00000348729SIL1chr5

138456724

-SLC23A1chr5

138716575

-
intron-5UTRENST00000515008ENST00000503919SIL1chr5

138456724

-SLC23A1chr5

138716575

-

Top

FusionProtFeatures for SIL1_SLC23A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SIL1

Q9H173

SLC23A1

Q9UHI7

Required for protein translocation and folding in theendoplasmic reticulum (ER). Functions as a nucleotide exchangefactor for the ER lumenal chaperone HSPA5.{ECO:0000269|PubMed:12356756}. Sodium/ascorbate cotransporter. Mediates electrogenicuptake of vitamin C, with a stoichiometry of 2 Na(+) for eachascorbate.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215230_243102767IntramembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215230_243102774IntramembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215103_103102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215125_159102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215181_207102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215226_229102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215244_250102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215272_312102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215334_358102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215380_402102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215424_426102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215448_457102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215479_490102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215512_598102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215103_103102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215125_159102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215181_207102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215226_229102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215244_250102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215272_312102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215334_358102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215380_402102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215424_426102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215448_457102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215479_490102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215512_598102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215104_124102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215160_180102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215208_225102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215251_271102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215313_333102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215359_379102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215403_423102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215427_447102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215458_478102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-215491_511102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215104_124102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215160_180102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215208_225102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215251_271102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215313_333102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215359_379102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215403_423102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215427_447102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215458_478102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-215491_511102774TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-2151_52102767Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-21574_81102767Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-2151_52102774Topological domainCytoplasmic
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-21574_81102774Topological domainExtracellular
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-21553_73102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000348729-21582_102102767TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-21553_73102774TransmembraneHelical
TgeneSLC23A1chr5:138456724chr5:138716575ENST00000353963-21582_102102774TransmembraneHelical


Top

FusionGeneSequence for SIL1_SLC23A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SIL1_ENST00000394817_chr5_138456724_-_SLC23A1_ENST00000353963_chr5_138716575_-_581aa
MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVFHPTHEWQALQPGCRCSRPVP
LHFWFQPKPYWLWRDGNAPRKRRSTVTGVCPXTPLIFGTHGYGRWVCMSRVQSWCPAWWRWXLACWGCLGPCSTTLGLSQSPPLSPSLAF
LSSKLLATELAPTGASQLAPFSXSSSSPSTCATSPSCCLSTAGARASLSSASRSSKCFLSCWPSXPCGCSAMSXPXQTCCPQTQKPMASR
HEPMPVVTSWLLHPGSASPTPVSGACPRXLRLLSWECSAPLWQASLSPSEITTPVPAWLVHHPLQYMLSTGASSPKAFAASSRGYWARAT
GPPRPVPTLASWELPRWAAGAWCSMVRLSCWSWAPSASSRPSSPRSLTPSWGACSALSLAXLQLWGCPTCNLWTXTPLATSSCWDFPCSS
GSRCPITWSPTLAPSIQAFLKWIRFXLCCXPRRCLWAGALLSYLTTQCQGAQRSVVXYSGKLGLMPTVTCLPASRATISPLGWAXXKELP

>In-frame_SIL1_ENST00000394817_chr5_138456724_-_SLC23A1_ENST00000348729_chr5_138716575_-_577aa
MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVFHPTHEWQALQPGCRCSRPVP
LHFWFQPKPYWLWRDGNAPRKRRSTVTGVCPXTPLIFGTHGYGRSRVQSWCPAWWRWXLACWGCLGPCSTTLGLSQSPPLSPSLAFLSSK
LLATELAPTGASQLAPFSXSSSSPSTCATSPSCCLSTAGARASLSSASRSSKCFLSCWPSXPCGCSAMSXPXQTCCPQTQKPMASRHEPM
PVVTSWLLHPGSASPTPVSGACPRXLRLLSWECSAPLWQASLSPSEITTPVPAWLVHHPLQYMLSTGASSPKAFAASSRGYWARATGPPR
PVPTLASWELPRWAAGAWCSMVRLSCWSWAPSASSRPSSPRSLTPSWGACSALSLAXLQLWGCPTCNLWTXTPLATSSCWDFPCSSGSRC
PITWSPTLAPSIQAFLKWIRFXLCCXPRRCLWAGALLSYLTTQCQGAQRSVVXYSGKLGLMPTVTCLPASRATISPLGWAXXKELPFXNT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SIL1_ENST00000394817_chr5_138456724_-_SLC23A1_ENST00000353963_chr5_138716575_-_1745nt
ATGGCTCCCCAGAGCCTGCCTTCATCTAGGATGGCTCCTCTGGGCATGCTGCTTGGGCTGCTGATGGCCGCCTGCTTCACCTTCTGCCTC
AGTCATCAGAACCTGAAGGAGTTTGCCCTGACCAACCCAGAGAAGAGCAGCACCAAAGAAACAGAGAGAAAAGAAACCAAAGCCGAGGAG
GAGCTGGATGCCGAAGTCCTGGAGGTGTTCCACCCGACGCATGAGTGGCAGGCCCTTCAGCCAGGCTGCCGCTGTTCCAGGCCAGTGCCT
TTGCATTTCTGGTTCCAGCCAAAGCCATACTGGCTCTGGAGAGATGGAAATGCCCCCCGGAAGAGGAGATCTACGGTAACTGGAGTCTGC
CCCTGAACACCTCTCATATTTGGCACCCACGGATACGGGAGGTGGGTTTGCATGTCCAGGGTGCAATCATGGTGTCCAGCGTGGTGGAGG
TGGTGATTGGCCTGCTGGGGCTGCCTGGGGCCCTGCTCAACTACATTGGGCCTCTCACAGTCACCCCCACTGTCTCCCTCATTGGCCTTT
CTGTCTTCCAAGCTGCTGGCGACCGAGCTGGCTCCCACTGGGGCATCTCAGCTTGCTCCATTCTCCTGATCATCCTCTTCTCCCAGTACC
TGCGCAACCTCACCTTCCTGCTGCCTGTCTACCGCTGGGGCAAGGGCCTCACTCTCCTCCGCATCCAGATCTTCAAAATGTTTCCTATCA
TGCTGGCCATCATGACCGTGTGGCTGCTCTGCTATGTCCTGACCTTGACAGACGTGCTGCCCACAGACCCAAAAGCCTATGGCTTCCAGG
CACGAACCGATGCCCGTGGTGACATCATGGCTATTGCACCCTGGATCCGCATCCCCTACCCCTGTCAGTGGGGCCTGCCCACGGTGACTG
CGGCTGCTGTCCTGGGAATGTTCAGCGCCACTCTGGCAGGCATCATTGAGTCCATCGGAGATTACTACGCCTGTGCCCGCCTGGCTGGTG
CACCACCCCCTCCAGTACATGCTATCAACAGGGGCATCTTCACCGAAGGCATTTGCTGCATCATCGCGGGGCTATTGGGCACGGGCAACG
GGTCCACCTCGTCCAGTCCCAACATTGGCGTCCTGGGAATTACCAAGGTGGGCAGCCGGCGCGTGGTGCAGTATGGTGCGGCTATCATGC
TGGTCCTGGGCACCATCGGCAAGTTCACGGCCCTCTTCTCCTCGCTCCCTGACCCCATCCTGGGGGGCATGTTCTGCACTCTCTTTGGCA
TGATTACAGCTGTGGGGCTGTCCAACCTGCAATTTGTGGACATGAACTCCTCTCGCAACCTCTTCGTGCTGGGATTTTCCATGTTCTTCG
GGCTCACGCTGCCCAATTACCTGGAGTCCAACCCTGGCGCCATCAATACAGGCATTCTTGAAGTGGATCAGATTCTGATTGTGCTGCTGA
CCACGGAGATGTTTGTGGGCGGGTGCCTTGCTTTCATACTTGACAACACAGTGCCAGGGAGCCCAGAGGAGCGTGGTCTGATACAGTGGA
AAGCTGGGGCTCATGCCAACAGTGACATGTCTTCCAGCCTCAAGAGCTACGATTTCCCCATTGGGATGGGCATAGTAAAAAGAATTACCT
TTCTGAAATACATTCCTATCTGCCCAGTCTTCAAAGGATTTTCTTCAAGTTCAAAAGATCAGATTGCAATTCCAGAAGACACTCCAGAAA

>In-frame_SIL1_ENST00000394817_chr5_138456724_-_SLC23A1_ENST00000348729_chr5_138716575_-_1733nt
ATGGCTCCCCAGAGCCTGCCTTCATCTAGGATGGCTCCTCTGGGCATGCTGCTTGGGCTGCTGATGGCCGCCTGCTTCACCTTCTGCCTC
AGTCATCAGAACCTGAAGGAGTTTGCCCTGACCAACCCAGAGAAGAGCAGCACCAAAGAAACAGAGAGAAAAGAAACCAAAGCCGAGGAG
GAGCTGGATGCCGAAGTCCTGGAGGTGTTCCACCCGACGCATGAGTGGCAGGCCCTTCAGCCAGGCTGCCGCTGTTCCAGGCCAGTGCCT
TTGCATTTCTGGTTCCAGCCAAAGCCATACTGGCTCTGGAGAGATGGAAATGCCCCCCGGAAGAGGAGATCTACGGTAACTGGAGTCTGC
CCCTGAACACCTCTCATATTTGGCACCCACGGATACGGGAGGTCCAGGGTGCAATCATGGTGTCCAGCGTGGTGGAGGTGGTGATTGGCC
TGCTGGGGCTGCCTGGGGCCCTGCTCAACTACATTGGGCCTCTCACAGTCACCCCCACTGTCTCCCTCATTGGCCTTTCTGTCTTCCAAG
CTGCTGGCGACCGAGCTGGCTCCCACTGGGGCATCTCAGCTTGCTCCATTCTCCTGATCATCCTCTTCTCCCAGTACCTGCGCAACCTCA
CCTTCCTGCTGCCTGTCTACCGCTGGGGCAAGGGCCTCACTCTCCTCCGCATCCAGATCTTCAAAATGTTTCCTATCATGCTGGCCATCA
TGACCGTGTGGCTGCTCTGCTATGTCCTGACCTTGACAGACGTGCTGCCCACAGACCCAAAAGCCTATGGCTTCCAGGCACGAACCGATG
CCCGTGGTGACATCATGGCTATTGCACCCTGGATCCGCATCCCCTACCCCTGTCAGTGGGGCCTGCCCACGGTGACTGCGGCTGCTGTCC
TGGGAATGTTCAGCGCCACTCTGGCAGGCATCATTGAGTCCATCGGAGATTACTACGCCTGTGCCCGCCTGGCTGGTGCACCACCCCCTC
CAGTACATGCTATCAACAGGGGCATCTTCACCGAAGGCATTTGCTGCATCATCGCGGGGCTATTGGGCACGGGCAACGGGTCCACCTCGT
CCAGTCCCAACATTGGCGTCCTGGGAATTACCAAGGTGGGCAGCCGGCGCGTGGTGCAGTATGGTGCGGCTATCATGCTGGTCCTGGGCA
CCATCGGCAAGTTCACGGCCCTCTTCTCCTCGCTCCCTGACCCCATCCTGGGGGGCATGTTCTGCACTCTCTTTGGCATGATTACAGCTG
TGGGGCTGTCCAACCTGCAATTTGTGGACATGAACTCCTCTCGCAACCTCTTCGTGCTGGGATTTTCCATGTTCTTCGGGCTCACGCTGC
CCAATTACCTGGAGTCCAACCCTGGCGCCATCAATACAGGCATTCTTGAAGTGGATCAGATTCTGATTGTGCTGCTGACCACGGAGATGT
TTGTGGGCGGGTGCCTTGCTTTCATACTTGACAACACAGTGCCAGGGAGCCCAGAGGAGCGTGGTCTGATACAGTGGAAAGCTGGGGCTC
ATGCCAACAGTGACATGTCTTCCAGCCTCAAGAGCTACGATTTCCCCATTGGGATGGGCATAGTAAAAAGAATTACCTTTCTGAAATACA
TTCCTATCTGCCCAGTCTTCAAAGGATTTTCTTCAAGTTCAAAAGATCAGATTGCAATTCCAGAAGACACTCCAGAAAATACAGAAACTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SIL1_ENST00000394817_chr5_138456724_-_SLC23A1_ENST00000353963_chr5_138716575_-_2340nt
GCGGCGTGACAGCTGCCAGCTCACCGGCTCAGACGGTCGCCGCCGCGTTTGCGCAGGGGGAGCTGGTCGCCGCCGCGGCCGCCTGGAATT
GTGGGAGTTGTGTCTGCCACTCGGCTGCCGGAGGCCGAAGGTCCCTGACTATGGCTCCCCAGAGCCTGCCTTCATCTAGGATGGCTCCTC
TGGGCATGCTGCTTGGGCTGCTGATGGCCGCCTGCTTCACCTTCTGCCTCAGTCATCAGAACCTGAAGGAGTTTGCCCTGACCAACCCAG
AGAAGAGCAGCACCAAAGAAACAGAGAGAAAAGAAACCAAAGCCGAGGAGGAGCTGGATGCCGAAGTCCTGGAGGTGTTCCACCCGACGC
ATGAGTGGCAGGCCCTTCAGCCAGGCTGCCGCTGTTCCAGGCCAGTGCCTTTGCATTTCTGGTTCCAGCCAAAGCCATACTGGCTCTGGA
GAGATGGAAATGCCCCCCGGAAGAGGAGATCTACGGTAACTGGAGTCTGCCCCTGAACACCTCTCATATTTGGCACCCACGGATACGGGA
GGTGGGTTTGCATGTCCAGGGTGCAATCATGGTGTCCAGCGTGGTGGAGGTGGTGATTGGCCTGCTGGGGCTGCCTGGGGCCCTGCTCAA
CTACATTGGGCCTCTCACAGTCACCCCCACTGTCTCCCTCATTGGCCTTTCTGTCTTCCAAGCTGCTGGCGACCGAGCTGGCTCCCACTG
GGGCATCTCAGCTTGCTCCATTCTCCTGATCATCCTCTTCTCCCAGTACCTGCGCAACCTCACCTTCCTGCTGCCTGTCTACCGCTGGGG
CAAGGGCCTCACTCTCCTCCGCATCCAGATCTTCAAAATGTTTCCTATCATGCTGGCCATCATGACCGTGTGGCTGCTCTGCTATGTCCT
GACCTTGACAGACGTGCTGCCCACAGACCCAAAAGCCTATGGCTTCCAGGCACGAACCGATGCCCGTGGTGACATCATGGCTATTGCACC
CTGGATCCGCATCCCCTACCCCTGTCAGTGGGGCCTGCCCACGGTGACTGCGGCTGCTGTCCTGGGAATGTTCAGCGCCACTCTGGCAGG
CATCATTGAGTCCATCGGAGATTACTACGCCTGTGCCCGCCTGGCTGGTGCACCACCCCCTCCAGTACATGCTATCAACAGGGGCATCTT
CACCGAAGGCATTTGCTGCATCATCGCGGGGCTATTGGGCACGGGCAACGGGTCCACCTCGTCCAGTCCCAACATTGGCGTCCTGGGAAT
TACCAAGGTGGGCAGCCGGCGCGTGGTGCAGTATGGTGCGGCTATCATGCTGGTCCTGGGCACCATCGGCAAGTTCACGGCCCTCTTCTC
CTCGCTCCCTGACCCCATCCTGGGGGGCATGTTCTGCACTCTCTTTGGCATGATTACAGCTGTGGGGCTGTCCAACCTGCAATTTGTGGA
CATGAACTCCTCTCGCAACCTCTTCGTGCTGGGATTTTCCATGTTCTTCGGGCTCACGCTGCCCAATTACCTGGAGTCCAACCCTGGCGC
CATCAATACAGGCATTCTTGAAGTGGATCAGATTCTGATTGTGCTGCTGACCACGGAGATGTTTGTGGGCGGGTGCCTTGCTTTCATACT
TGACAACACAGTGCCAGGGAGCCCAGAGGAGCGTGGTCTGATACAGTGGAAAGCTGGGGCTCATGCCAACAGTGACATGTCTTCCAGCCT
CAAGAGCTACGATTTCCCCATTGGGATGGGCATAGTAAAAAGAATTACCTTTCTGAAATACATTCCTATCTGCCCAGTCTTCAAAGGATT
TTCTTCAAGTTCAAAAGATCAGATTGCAATTCCAGAAGACACTCCAGAAAATACAGAAACTGCATCTGTGTGCACCAAGGTCTGAAAAAT
GACTTCCAGGAAAGGAAGCATGGTATATAACAGGAAAAGAAAACTACATGGGGAACCAGAAGACCTAAGCCTGAAATCCCAGCCCTGCCC
CTAACTAACTTCTGTGTAAACTCAGATAAGTCACCTTTCTCTGGGATTCAAATTTTTGCATCAGTTAAAAAAAAAGGGGTGGGGGGGAAT
GGGCCAAAGTCTGAGTCTTAGAGACTTGTACCAATGTTATGCTATGTCTCTAAATCTTTACTCTCCTAAGTAGACTTGTCAGCATCTAGG
AAGAACAGCTAGAAATTTTCCTCTGTGATATTTTAGACTGCAAGTTGAAAAAAATAAAAAGAAATGAGGGCAGGTTCCAGGGCCTGAAAT
GTAGGTATGCTGCAAGGCTTTTACATTGAATTTGACCCTACATCACTTCAAGACTAATGCATAATATTAAACATCATGTTGAAGAAATAA

>In-frame_SIL1_ENST00000394817_chr5_138456724_-_SLC23A1_ENST00000348729_chr5_138716575_-_2328nt
GCGGCGTGACAGCTGCCAGCTCACCGGCTCAGACGGTCGCCGCCGCGTTTGCGCAGGGGGAGCTGGTCGCCGCCGCGGCCGCCTGGAATT
GTGGGAGTTGTGTCTGCCACTCGGCTGCCGGAGGCCGAAGGTCCCTGACTATGGCTCCCCAGAGCCTGCCTTCATCTAGGATGGCTCCTC
TGGGCATGCTGCTTGGGCTGCTGATGGCCGCCTGCTTCACCTTCTGCCTCAGTCATCAGAACCTGAAGGAGTTTGCCCTGACCAACCCAG
AGAAGAGCAGCACCAAAGAAACAGAGAGAAAAGAAACCAAAGCCGAGGAGGAGCTGGATGCCGAAGTCCTGGAGGTGTTCCACCCGACGC
ATGAGTGGCAGGCCCTTCAGCCAGGCTGCCGCTGTTCCAGGCCAGTGCCTTTGCATTTCTGGTTCCAGCCAAAGCCATACTGGCTCTGGA
GAGATGGAAATGCCCCCCGGAAGAGGAGATCTACGGTAACTGGAGTCTGCCCCTGAACACCTCTCATATTTGGCACCCACGGATACGGGA
GGTCCAGGGTGCAATCATGGTGTCCAGCGTGGTGGAGGTGGTGATTGGCCTGCTGGGGCTGCCTGGGGCCCTGCTCAACTACATTGGGCC
TCTCACAGTCACCCCCACTGTCTCCCTCATTGGCCTTTCTGTCTTCCAAGCTGCTGGCGACCGAGCTGGCTCCCACTGGGGCATCTCAGC
TTGCTCCATTCTCCTGATCATCCTCTTCTCCCAGTACCTGCGCAACCTCACCTTCCTGCTGCCTGTCTACCGCTGGGGCAAGGGCCTCAC
TCTCCTCCGCATCCAGATCTTCAAAATGTTTCCTATCATGCTGGCCATCATGACCGTGTGGCTGCTCTGCTATGTCCTGACCTTGACAGA
CGTGCTGCCCACAGACCCAAAAGCCTATGGCTTCCAGGCACGAACCGATGCCCGTGGTGACATCATGGCTATTGCACCCTGGATCCGCAT
CCCCTACCCCTGTCAGTGGGGCCTGCCCACGGTGACTGCGGCTGCTGTCCTGGGAATGTTCAGCGCCACTCTGGCAGGCATCATTGAGTC
CATCGGAGATTACTACGCCTGTGCCCGCCTGGCTGGTGCACCACCCCCTCCAGTACATGCTATCAACAGGGGCATCTTCACCGAAGGCAT
TTGCTGCATCATCGCGGGGCTATTGGGCACGGGCAACGGGTCCACCTCGTCCAGTCCCAACATTGGCGTCCTGGGAATTACCAAGGTGGG
CAGCCGGCGCGTGGTGCAGTATGGTGCGGCTATCATGCTGGTCCTGGGCACCATCGGCAAGTTCACGGCCCTCTTCTCCTCGCTCCCTGA
CCCCATCCTGGGGGGCATGTTCTGCACTCTCTTTGGCATGATTACAGCTGTGGGGCTGTCCAACCTGCAATTTGTGGACATGAACTCCTC
TCGCAACCTCTTCGTGCTGGGATTTTCCATGTTCTTCGGGCTCACGCTGCCCAATTACCTGGAGTCCAACCCTGGCGCCATCAATACAGG
CATTCTTGAAGTGGATCAGATTCTGATTGTGCTGCTGACCACGGAGATGTTTGTGGGCGGGTGCCTTGCTTTCATACTTGACAACACAGT
GCCAGGGAGCCCAGAGGAGCGTGGTCTGATACAGTGGAAAGCTGGGGCTCATGCCAACAGTGACATGTCTTCCAGCCTCAAGAGCTACGA
TTTCCCCATTGGGATGGGCATAGTAAAAAGAATTACCTTTCTGAAATACATTCCTATCTGCCCAGTCTTCAAAGGATTTTCTTCAAGTTC
AAAAGATCAGATTGCAATTCCAGAAGACACTCCAGAAAATACAGAAACTGCATCTGTGTGCACCAAGGTCTGAAAAATGACTTCCAGGAA
AGGAAGCATGGTATATAACAGGAAAAGAAAACTACATGGGGAACCAGAAGACCTAAGCCTGAAATCCCAGCCCTGCCCCTAACTAACTTC
TGTGTAAACTCAGATAAGTCACCTTTCTCTGGGATTCAAATTTTTGCATCAGTTAAAAAAAAAGGGGTGGGGGGGAATGGGCCAAAGTCT
GAGTCTTAGAGACTTGTACCAATGTTATGCTATGTCTCTAAATCTTTACTCTCCTAAGTAGACTTGTCAGCATCTAGGAAGAACAGCTAG
AAATTTTCCTCTGTGATATTTTAGACTGCAAGTTGAAAAAAATAAAAAGAAATGAGGGCAGGTTCCAGGGCCTGAAATGTAGGTATGCTG


Top

FusionGenePPI for SIL1_SLC23A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SIL1HSPA5, SMAD9, CCND3, FBXO6, UBQLN1, GLB1L3, PON2, PFDN4, PSMD8, TCTN1, CEP192, POC1A, POC1B, EDRF1, CNTNAP1, ERGIC2, UBR1, TDGF1, UBR2, COL14A1, OMA1, SERPINB11, PTPROSLC23A1KRT31, AHCYL1, MTUS2, ADAMTSL4, KRTAP4-2, KRTAP10-7, KRTAP10-9, KRTAP10-1, KRTAP10-5, KRTAP10-8, KRTAP10-3, NOTCH2NL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSIL1chr5:138456724chr5:138716575ENST00000265195-4111_25681462HSPA5 and localization to the endoplasmic reticulum
HgeneSIL1chr5:138456724chr5:138716575ENST00000394817-3101_25681462HSPA5 and localization to the endoplasmic reticulum


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SIL1_SLC23A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneSLC23A1Q9UHI7DB00126Vitamin CSolute carrier family 23 member 1small moleculeapproved|nutraceutical

Top

RelatedDiseases for SIL1_SLC23A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSIL1C0033578Prostatic Neoplasms1CTD_human
TgeneSLC23A1C0008370Cholestasis1CTD_human
TgeneSLC23A1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneSLC23A1C0035229Respiratory Insufficiency1CTD_human
TgeneSLC23A1C0151699Intracranial Hemorrhages1CTD_human