FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33850

FusionGeneSummary for SIK2_PIR

check button Fusion gene summary
Fusion gene informationFusion gene name: SIK2_PIR
Fusion gene ID: 33850
HgeneTgene
Gene symbol

SIK2

PIR

Gene ID

23235

8544

Gene namesalt inducible kinase 2pirin
SynonymsLOH11CR1I|QIK|SIK-2|SNF1LK2-
Cytomap

11q23.1

Xp22.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase SIK2SNF1-like kinase 2qin-induced kinasesalt-inducible protein kinase 2salt-inducible serine/threonine kinase 2serine/threonine-protein kinase SNF1-like kinase 2pirinpirin (iron-binding nuclear protein)probable quercetin 2,3-dioxygenase PIRprobable quercetinase
Modification date2018052320180523
UniProtAcc

Q9H0K1

O00625

Ensembl transtripts involved in fusion geneENST00000304987, ENST00000533868, 
ENST00000380420, ENST00000380421, 
ENST00000476381, 
Fusion gene scores* DoF score8 X 6 X 6=2882 X 2 X 2=8
# samples 92
** MAII scorelog2(9/288*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: SIK2 [Title/Abstract] AND PIR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSIK2

GO:0006468

protein phosphorylation

14976552

HgeneSIK2

GO:0035556

intracellular signal transduction

14976552

HgeneSIK2

GO:0046777

protein autophosphorylation

18348280


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-G9-6361-01ASIK2chr11

111583099

+PIRchrX

15477863

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000304987ENST00000380420SIK2chr11

111583099

+PIRchrX

15477863

-
In-frameENST00000304987ENST00000380421SIK2chr11

111583099

+PIRchrX

15477863

-
5CDS-5UTRENST00000304987ENST00000476381SIK2chr11

111583099

+PIRchrX

15477863

-
intron-3CDSENST00000533868ENST00000380420SIK2chr11

111583099

+PIRchrX

15477863

-
intron-3CDSENST00000533868ENST00000380421SIK2chr11

111583099

+PIRchrX

15477863

-
intron-5UTRENST00000533868ENST00000476381SIK2chr11

111583099

+PIRchrX

15477863

-

Top

FusionProtFeatures for SIK2_PIR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SIK2

Q9H0K1

PIR

O00625

Transcriptional coregulator of NF-kappa-B whichfacilitates binding of NF-kappa-B proteins to target kappa-B genesin a redox-state-dependent manner. May be required for efficientterminal myeloid maturation of hematopoietic cells. Has quercetin2,3-dioxygenase activity (in vitro). {ECO:0000269|PubMed:17288615,ECO:0000269|PubMed:20010624, ECO:0000269|PubMed:20711196,ECO:0000269|PubMed:23716661}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSIK2chr11:111583099chrX:15477863ENST00000304987+91520_271422927DomainProtein kinase
HgeneSIK2chr11:111583099chrX:15477863ENST00000304987+915295_335422927DomainUBA
HgeneSIK2chr11:111583099chrX:15477863ENST00000304987+91526_34422927Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SIK2_PIR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SIK2_ENST00000304987_chr11_111583099_+_PIR_ENST00000380420_chrX_15477863_-_650aa
MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKS
MLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSP
PYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKW
MLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTI
AEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDTPKVSYLLEGGSMAHEDFCGHTGKMNPGDLQ
WMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAK
HSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDF

>In-frame_SIK2_ENST00000304987_chr11_111583099_+_PIR_ENST00000380421_chrX_15477863_-_650aa
MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKS
MLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSP
PYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKW
MLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTI
AEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDTPKVSYLLEGGSMAHEDFCGHTGKMNPGDLQ
WMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAK
HSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SIK2_ENST00000304987_chr11_111583099_+_PIR_ENST00000380420_chrX_15477863_-_1950nt
ATGGTCATGGCGGATGGCCCGAGGCACTTGCAGCGCGGGCCGGTCCGGGTGGGGTTCTACGACATCGAGGGCACGCTGGGCAAGGGCAAC
TTCGCTGTGGTGAAGCTGGGGCGGCACCGGATCACCAAGACGGAGGTGGCAATAAAAATAATCGATAAGTCTCAGCTGGATGCAGTGAAC
CTTGAGAAAATCTACCGAGAAGTACAAATAATGAAAATGTTAGACCACCCTCACATAATCAAACTTTATCAGGTAATGGAGACCAAAAGT
ATGTTGTACCTTGTGACAGAATATGCCAAAAATGGAGAAATTTTTGACTATCTTGCTAATCATGGCCGGTTAAATGAGTCTGAAGCCAGG
CGAAAATTCTGGCAAATCCTGTCTGCTGTTGATTATTGTCATGGTCGGAAGATTGTGCACCGTGACCTCAAAGCTGAAAATCTCCTGCTG
GATAACAACATGAATATCAAAATAGCAGATTTCGGTTTTGGAAATTTCTTTAAAAGTGGTGAACTGCTGGCAACATGGTGTGGCAGCCCC
CCTTATGCAGCCCCAGAAGTCTTTGAAGGGCAGCAGTATGAAGGACCACAGCTGGACATCTGGAGTATGGGAGTTGTTCTTTATGTCCTT
GTCTGTGGAGCTCTGCCCTTTGATGGACCGACTCTTCCAATTTTGAGGCAGAGGGTTCTGGAAGGAAGATTCCGGATTCCGTATTTCATG
TCAGAAGATTGCGAGCACCTTATCCGAAGGATGTTGGTCCTAGACCCATCCAAACGGCTAACCATAGCCCAAATCAAGGAGCATAAATGG
ATGCTCATAGAAGTTCCTGTCCAGAGACCTGTTCTCTATCCACAAGAGCAAGAAAATGAGCCATCCATCGGGGAGTTTAATGAGCAGGTT
CTGCGACTGATGCACAGCCTTGGAATAGATCAGCAGAAAACCATTGAGTCTTTGCAGAACAAGAGCTATAACCACTTTGCTGCCATTTAT
TTCTTGTTGGTGGAGCGCCTGAAATCACATCGGAGCAGTTTCCCAGTGGAGCAGAGACTTGATGGCCGCCAGCGTCGGCCTAGCACCATT
GCTGAGCAAACAGTTGCCAAGGCACAGACTGTGGGGCTCCCAGTGACCATGCATTCACCGAACATGAGGCTGCTGCGATCTGCCCTCCTC
CCCCAGGCATCCAACGTGGAGGCCTTTTCATTTCCAGCATCTGGCTGTCAGGCGGAAGCTGCATTCATGGAAGAAGAGTGTGTGGACACT
CCAAAGGTATCCTACCTCCTGGAAGGGGGCAGCATGGCCCATGAAGACTTCTGTGGACACACTGGTAAAATGAACCCAGGAGATTTGCAG
TGGATGACTGCGGGCCGGGGCATTCTGCACGCTGAGATGCCTTGCTCAGAGGAGCCAGCCCATGGCCTACAACTGTGGGTTAATTTGAGG
AGCTCAGAGAAGATGGTGGAGCCTCAGTACCAGGAACTGAAAAGTGAAGAAATCCCTAAACCCAGTAAGGATGGTGTGACAGTTGCTGTC
ATTTCTGGAGAAGCCCTGGGAATAAAGTCCAAGGTTTACACTCGCACACCAACCTTATATTTGGACTTCAAATTGGACCCAGGAGCCAAA
CATTCCCAACCTATCCCTAAAGGGTGGACAAGCTTCATTTACACGATATCTGGAGATGTGTATATTGGGCCCGATGATGCACAACAAAAA
ATAGAACCTCATCACACAGCAGTGCTTGGAGAAGGTGACAGTGTCCAGGTGGAGAACAAGGATCCCAAGAGAAGCCACTTTGTCTTAATT
GCTGGGGAGCCATTAAGAGAACCAGTTATCCAACATGGTCCATTTGTGATGAACACCAATGAAGAGATTTCTCAAGCTATTCTTGATTTC

>In-frame_SIK2_ENST00000304987_chr11_111583099_+_PIR_ENST00000380421_chrX_15477863_-_1950nt
ATGGTCATGGCGGATGGCCCGAGGCACTTGCAGCGCGGGCCGGTCCGGGTGGGGTTCTACGACATCGAGGGCACGCTGGGCAAGGGCAAC
TTCGCTGTGGTGAAGCTGGGGCGGCACCGGATCACCAAGACGGAGGTGGCAATAAAAATAATCGATAAGTCTCAGCTGGATGCAGTGAAC
CTTGAGAAAATCTACCGAGAAGTACAAATAATGAAAATGTTAGACCACCCTCACATAATCAAACTTTATCAGGTAATGGAGACCAAAAGT
ATGTTGTACCTTGTGACAGAATATGCCAAAAATGGAGAAATTTTTGACTATCTTGCTAATCATGGCCGGTTAAATGAGTCTGAAGCCAGG
CGAAAATTCTGGCAAATCCTGTCTGCTGTTGATTATTGTCATGGTCGGAAGATTGTGCACCGTGACCTCAAAGCTGAAAATCTCCTGCTG
GATAACAACATGAATATCAAAATAGCAGATTTCGGTTTTGGAAATTTCTTTAAAAGTGGTGAACTGCTGGCAACATGGTGTGGCAGCCCC
CCTTATGCAGCCCCAGAAGTCTTTGAAGGGCAGCAGTATGAAGGACCACAGCTGGACATCTGGAGTATGGGAGTTGTTCTTTATGTCCTT
GTCTGTGGAGCTCTGCCCTTTGATGGACCGACTCTTCCAATTTTGAGGCAGAGGGTTCTGGAAGGAAGATTCCGGATTCCGTATTTCATG
TCAGAAGATTGCGAGCACCTTATCCGAAGGATGTTGGTCCTAGACCCATCCAAACGGCTAACCATAGCCCAAATCAAGGAGCATAAATGG
ATGCTCATAGAAGTTCCTGTCCAGAGACCTGTTCTCTATCCACAAGAGCAAGAAAATGAGCCATCCATCGGGGAGTTTAATGAGCAGGTT
CTGCGACTGATGCACAGCCTTGGAATAGATCAGCAGAAAACCATTGAGTCTTTGCAGAACAAGAGCTATAACCACTTTGCTGCCATTTAT
TTCTTGTTGGTGGAGCGCCTGAAATCACATCGGAGCAGTTTCCCAGTGGAGCAGAGACTTGATGGCCGCCAGCGTCGGCCTAGCACCATT
GCTGAGCAAACAGTTGCCAAGGCACAGACTGTGGGGCTCCCAGTGACCATGCATTCACCGAACATGAGGCTGCTGCGATCTGCCCTCCTC
CCCCAGGCATCCAACGTGGAGGCCTTTTCATTTCCAGCATCTGGCTGTCAGGCGGAAGCTGCATTCATGGAAGAAGAGTGTGTGGACACT
CCAAAGGTATCCTACCTCCTGGAAGGGGGCAGCATGGCCCATGAAGACTTCTGTGGACACACTGGTAAAATGAACCCAGGAGATTTGCAG
TGGATGACTGCGGGCCGGGGCATTCTGCACGCTGAGATGCCTTGCTCAGAGGAGCCAGCCCATGGCCTACAACTGTGGGTTAATTTGAGG
AGCTCAGAGAAGATGGTGGAGCCTCAGTACCAGGAACTGAAAAGTGAAGAAATCCCTAAACCCAGTAAGGATGGTGTGACAGTTGCTGTC
ATTTCTGGAGAAGCCCTGGGAATAAAGTCCAAGGTTTACACTCGCACACCAACCTTATATTTGGACTTCAAATTGGACCCAGGAGCCAAA
CATTCCCAACCTATCCCTAAAGGGTGGACAAGCTTCATTTACACGATATCTGGAGATGTGTATATTGGGCCCGATGATGCACAACAAAAA
ATAGAACCTCATCACACAGCAGTGCTTGGAGAAGGTGACAGTGTCCAGGTGGAGAACAAGGATCCCAAGAGAAGCCACTTTGTCTTAATT
GCTGGGGAGCCATTAAGAGAACCAGTTATCCAACATGGTCCATTTGTGATGAACACCAATGAAGAGATTTCTCAAGCTATTCTTGATTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SIK2_ENST00000304987_chr11_111583099_+_PIR_ENST00000380420_chrX_15477863_-_2328nt
GACGTCGGCGCACGTCAGCGGCGGCGCGCGCCTGGCTGGGCCCTGGGGAGCGGGAGGGAAGGAGCGAAGGAGCGAAGGAGCAAGCGGAGC
GGCCGTCGCCCAAGCCAAGCCGCGCTGCCAACCCTCCCGCCCGCCCGCGCTCCTGTCCGCCGTGTCTAGCAGCGGGGCCCAGCATGGTCA
TGGCGGATGGCCCGAGGCACTTGCAGCGCGGGCCGGTCCGGGTGGGGTTCTACGACATCGAGGGCACGCTGGGCAAGGGCAACTTCGCTG
TGGTGAAGCTGGGGCGGCACCGGATCACCAAGACGGAGGTGGCAATAAAAATAATCGATAAGTCTCAGCTGGATGCAGTGAACCTTGAGA
AAATCTACCGAGAAGTACAAATAATGAAAATGTTAGACCACCCTCACATAATCAAACTTTATCAGGTAATGGAGACCAAAAGTATGTTGT
ACCTTGTGACAGAATATGCCAAAAATGGAGAAATTTTTGACTATCTTGCTAATCATGGCCGGTTAAATGAGTCTGAAGCCAGGCGAAAAT
TCTGGCAAATCCTGTCTGCTGTTGATTATTGTCATGGTCGGAAGATTGTGCACCGTGACCTCAAAGCTGAAAATCTCCTGCTGGATAACA
ACATGAATATCAAAATAGCAGATTTCGGTTTTGGAAATTTCTTTAAAAGTGGTGAACTGCTGGCAACATGGTGTGGCAGCCCCCCTTATG
CAGCCCCAGAAGTCTTTGAAGGGCAGCAGTATGAAGGACCACAGCTGGACATCTGGAGTATGGGAGTTGTTCTTTATGTCCTTGTCTGTG
GAGCTCTGCCCTTTGATGGACCGACTCTTCCAATTTTGAGGCAGAGGGTTCTGGAAGGAAGATTCCGGATTCCGTATTTCATGTCAGAAG
ATTGCGAGCACCTTATCCGAAGGATGTTGGTCCTAGACCCATCCAAACGGCTAACCATAGCCCAAATCAAGGAGCATAAATGGATGCTCA
TAGAAGTTCCTGTCCAGAGACCTGTTCTCTATCCACAAGAGCAAGAAAATGAGCCATCCATCGGGGAGTTTAATGAGCAGGTTCTGCGAC
TGATGCACAGCCTTGGAATAGATCAGCAGAAAACCATTGAGTCTTTGCAGAACAAGAGCTATAACCACTTTGCTGCCATTTATTTCTTGT
TGGTGGAGCGCCTGAAATCACATCGGAGCAGTTTCCCAGTGGAGCAGAGACTTGATGGCCGCCAGCGTCGGCCTAGCACCATTGCTGAGC
AAACAGTTGCCAAGGCACAGACTGTGGGGCTCCCAGTGACCATGCATTCACCGAACATGAGGCTGCTGCGATCTGCCCTCCTCCCCCAGG
CATCCAACGTGGAGGCCTTTTCATTTCCAGCATCTGGCTGTCAGGCGGAAGCTGCATTCATGGAAGAAGAGTGTGTGGACACTCCAAAGG
TATCCTACCTCCTGGAAGGGGGCAGCATGGCCCATGAAGACTTCTGTGGACACACTGGTAAAATGAACCCAGGAGATTTGCAGTGGATGA
CTGCGGGCCGGGGCATTCTGCACGCTGAGATGCCTTGCTCAGAGGAGCCAGCCCATGGCCTACAACTGTGGGTTAATTTGAGGAGCTCAG
AGAAGATGGTGGAGCCTCAGTACCAGGAACTGAAAAGTGAAGAAATCCCTAAACCCAGTAAGGATGGTGTGACAGTTGCTGTCATTTCTG
GAGAAGCCCTGGGAATAAAGTCCAAGGTTTACACTCGCACACCAACCTTATATTTGGACTTCAAATTGGACCCAGGAGCCAAACATTCCC
AACCTATCCCTAAAGGGTGGACAAGCTTCATTTACACGATATCTGGAGATGTGTATATTGGGCCCGATGATGCACAACAAAAAATAGAAC
CTCATCACACAGCAGTGCTTGGAGAAGGTGACAGTGTCCAGGTGGAGAACAAGGATCCCAAGAGAAGCCACTTTGTCTTAATTGCTGGGG
AGCCATTAAGAGAACCAGTTATCCAACATGGTCCATTTGTGATGAACACCAATGAAGAGATTTCTCAAGCTATTCTTGATTTCAGAAACG
CAAAAAATGGGTTTGAAAGGGCCAAAACCTGGAAATCAAAGATTGGGAACTAGTGGAAAGCGGAAGAGCAGGTCTTGATGTGTCCTAGAA
TTTTGCCATTTCTGAGATTGAGCCATTGAAGGCATTCCATTTCTAAAGCTTATTTAGCCGGTGCTTCTAAAGAATTCCACACTAACGTGA

>In-frame_SIK2_ENST00000304987_chr11_111583099_+_PIR_ENST00000380421_chrX_15477863_-_2328nt
GACGTCGGCGCACGTCAGCGGCGGCGCGCGCCTGGCTGGGCCCTGGGGAGCGGGAGGGAAGGAGCGAAGGAGCGAAGGAGCAAGCGGAGC
GGCCGTCGCCCAAGCCAAGCCGCGCTGCCAACCCTCCCGCCCGCCCGCGCTCCTGTCCGCCGTGTCTAGCAGCGGGGCCCAGCATGGTCA
TGGCGGATGGCCCGAGGCACTTGCAGCGCGGGCCGGTCCGGGTGGGGTTCTACGACATCGAGGGCACGCTGGGCAAGGGCAACTTCGCTG
TGGTGAAGCTGGGGCGGCACCGGATCACCAAGACGGAGGTGGCAATAAAAATAATCGATAAGTCTCAGCTGGATGCAGTGAACCTTGAGA
AAATCTACCGAGAAGTACAAATAATGAAAATGTTAGACCACCCTCACATAATCAAACTTTATCAGGTAATGGAGACCAAAAGTATGTTGT
ACCTTGTGACAGAATATGCCAAAAATGGAGAAATTTTTGACTATCTTGCTAATCATGGCCGGTTAAATGAGTCTGAAGCCAGGCGAAAAT
TCTGGCAAATCCTGTCTGCTGTTGATTATTGTCATGGTCGGAAGATTGTGCACCGTGACCTCAAAGCTGAAAATCTCCTGCTGGATAACA
ACATGAATATCAAAATAGCAGATTTCGGTTTTGGAAATTTCTTTAAAAGTGGTGAACTGCTGGCAACATGGTGTGGCAGCCCCCCTTATG
CAGCCCCAGAAGTCTTTGAAGGGCAGCAGTATGAAGGACCACAGCTGGACATCTGGAGTATGGGAGTTGTTCTTTATGTCCTTGTCTGTG
GAGCTCTGCCCTTTGATGGACCGACTCTTCCAATTTTGAGGCAGAGGGTTCTGGAAGGAAGATTCCGGATTCCGTATTTCATGTCAGAAG
ATTGCGAGCACCTTATCCGAAGGATGTTGGTCCTAGACCCATCCAAACGGCTAACCATAGCCCAAATCAAGGAGCATAAATGGATGCTCA
TAGAAGTTCCTGTCCAGAGACCTGTTCTCTATCCACAAGAGCAAGAAAATGAGCCATCCATCGGGGAGTTTAATGAGCAGGTTCTGCGAC
TGATGCACAGCCTTGGAATAGATCAGCAGAAAACCATTGAGTCTTTGCAGAACAAGAGCTATAACCACTTTGCTGCCATTTATTTCTTGT
TGGTGGAGCGCCTGAAATCACATCGGAGCAGTTTCCCAGTGGAGCAGAGACTTGATGGCCGCCAGCGTCGGCCTAGCACCATTGCTGAGC
AAACAGTTGCCAAGGCACAGACTGTGGGGCTCCCAGTGACCATGCATTCACCGAACATGAGGCTGCTGCGATCTGCCCTCCTCCCCCAGG
CATCCAACGTGGAGGCCTTTTCATTTCCAGCATCTGGCTGTCAGGCGGAAGCTGCATTCATGGAAGAAGAGTGTGTGGACACTCCAAAGG
TATCCTACCTCCTGGAAGGGGGCAGCATGGCCCATGAAGACTTCTGTGGACACACTGGTAAAATGAACCCAGGAGATTTGCAGTGGATGA
CTGCGGGCCGGGGCATTCTGCACGCTGAGATGCCTTGCTCAGAGGAGCCAGCCCATGGCCTACAACTGTGGGTTAATTTGAGGAGCTCAG
AGAAGATGGTGGAGCCTCAGTACCAGGAACTGAAAAGTGAAGAAATCCCTAAACCCAGTAAGGATGGTGTGACAGTTGCTGTCATTTCTG
GAGAAGCCCTGGGAATAAAGTCCAAGGTTTACACTCGCACACCAACCTTATATTTGGACTTCAAATTGGACCCAGGAGCCAAACATTCCC
AACCTATCCCTAAAGGGTGGACAAGCTTCATTTACACGATATCTGGAGATGTGTATATTGGGCCCGATGATGCACAACAAAAAATAGAAC
CTCATCACACAGCAGTGCTTGGAGAAGGTGACAGTGTCCAGGTGGAGAACAAGGATCCCAAGAGAAGCCACTTTGTCTTAATTGCTGGGG
AGCCATTAAGAGAACCAGTTATCCAACATGGTCCATTTGTGATGAACACCAATGAAGAGATTTCTCAAGCTATTCTTGATTTCAGAAACG
CAAAAAATGGGTTTGAAAGGGCCAAAACCTGGAAATCAAAGATTGGGAACTAGTGGAAAGCGGAAGAGCAGGTCTTGATGTGTCCTAGAA
TTTTGCCATTTCTGAGATTGAGCCATTGAAGGCATTCCATTTCTAAAGCTTATTTAGCCGGTGCTTCTAAAGAATTCCACACTAACGTGA


Top

FusionGenePPI for SIK2_PIR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SIK2CRTC2, PRKAA1, HDAC5, YWHAQ, APP, CEP250, VCP, HSPA4, YWHAZ, YWHAE, GABARAPL2, BAG2, CSNK1A1, EMD, FUS, HSPA2, HSPB1, SHROOM3, SLC25A1, SLC25A13, TRIM28, TUBA4A, PPP2R2C, PPP2CA, PPP2R1A, FBXW11, XPO1, SIK1, IL17RA, PROZ, TULP2, IL13RA2, TRIM25PIRBCL3, NFKBIA, NFIX, CLNS1A, STAM, SUGT1, PSMB2, SPEN, PPP2CA, UBL7, ARHGDIA, SMAD9, NXF1, KLHL20, C2orf68, ACAT2, ADK, ANXA7, ASS1, C11orf54, CFL1, CFL2, DCXR, DSTN, FAHD1, FH, FUBP1, GNB2L1, GNPDA1, GNPDA2, GOT1, GRHPR, GSR, HMGCL, HSPE1, HTRA2, MIF, NANS, PARK7, PDCD6IP, CAPG, DAZAP1, SRI, PPIA, SIN3A, SNX3, SOD1, SRXN1, TIA1, TIAL1, TKT, UBE2L3, FGB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SIK2_PIR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SIK2_PIR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePIRC0011616Contact Dermatitis1CTD_human